BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780919|ref|YP_003065332.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Candidatus Liberibacter asiaticus str. psy62] (198 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780919|ref|YP_003065332.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Candidatus Liberibacter asiaticus str. psy62] Length = 198 Score = 414 bits (1063), Expect = e-118, Method: Compositional matrix adjust. Identities = 198/198 (100%), Positives = 198/198 (100%) Query: 1 MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60 MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR Sbjct: 1 MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQR 60 Query: 61 PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120 PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE Sbjct: 61 PPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLE 120 Query: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE Sbjct: 121 MNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFE 180 Query: 181 YDGLPLLSLNMERDLLCV 198 YDGLPLLSLNMERDLLCV Sbjct: 181 YDGLPLLSLNMERDLLCV 198 >gi|254780445|ref|YP_003064858.1| isoleucyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 963 Score = 22.7 bits (47), Expect = 4.8, Method: Compositional matrix adjust. Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 10/39 (25%) Query: 7 RILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHS 45 RI+KT K + S WFS+ G +D F+ D S Sbjct: 525 RIIKTFKDQGSDAWFSE----------GSRDFFLGDRAS 553 >gi|255764469|ref|YP_003064807.2| putative permease protein [Candidatus Liberibacter asiaticus str. psy62] Length = 361 Score = 21.9 bits (45), Expect = 7.2, Method: Compositional matrix adjust. Identities = 11/24 (45%), Positives = 14/24 (58%) Query: 94 VSLEISANNGLQIYIPTGFAHGFM 117 VSLE S +N +I + G GFM Sbjct: 294 VSLEFSRSNQPRIIVAYGIFSGFM 317 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.323 0.139 0.434 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 130,265 Number of Sequences: 1233 Number of extensions: 5206 Number of successful extensions: 11 Number of sequences better than 100.0: 3 Number of HSP's better than 100.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 8 Number of HSP's gapped (non-prelim): 3 length of query: 198 length of database: 328,796 effective HSP length: 70 effective length of query: 128 effective length of database: 242,486 effective search space: 31038208 effective search space used: 31038208 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 36 (18.5 bits)