HHsearch alignment for GI: 254780920 and conserved domain: COG1089

>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane].
Probab=100.00  E-value=0  Score=348.89  Aligned_cols=318  Identities=25%  Similarity=0.333  Sum_probs=272.9

Q ss_pred             CE-EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHH--HH--HHCCCCEEEEECCCCCHHHHHHHHHHCCCC
Q ss_conf             94-89976788277999999998689879999478876585677--76--203797499976388999999998622787
Q gi|254780920|r    1 MR-LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSL--KE--ISQSNLFSFLQVDICDRECIRSALKEFQPD   75 (358)
Q Consensus         1 Mk-ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~--~~--~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d   75 (358)
T Consensus         2 ~K~ALITGITGQDGsYLa~lLLek-GY~VhGi~Rrss~~n~~ri~L~~~~~~~~~~l~l~~gDLtD~~~l~r~l~~v~Pd   80 (345)
T COG1089           2 GKVALITGITGQDGSYLAELLLEK-GYEVHGIKRRSSSFNTPRIHLYEDPHLNDPRLHLHYGDLTDSSNLLRILEEVQPD   80 (345)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHC-CCEEEEEEECCCCCCCCCCHHHCCCCCCCCEEEEEECCCCCHHHHHHHHHHCCCH
T ss_conf             726999544587538999999856-9489878603355776530111165557861799965543568899999860944


Q ss_pred             EEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             17851234332222222222222222222024788865123221124784278630554311222222222222222222
Q gi|254780920|r   76 AIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSS  155 (358)
Q Consensus        76 ~ViHlAa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~s  155 (358)
T Consensus        81 EIYNLaAQS~V~vSFe~P~~T~~~~~iGtlrlLEaiR~~~-------~~~~rfYQAStSE~fG~v~~~pq~E~TPFyPrS  153 (345)
T COG1089          81 EIYNLAAQSHVGVSFEQPEYTADVDAIGTLRLLEAIRILG-------EKKTRFYQASTSELYGLVQEIPQKETTPFYPRS  153 (345)
T ss_pred             HHEECCCCCCCCCCCCCCCEEEEECHHHHHHHHHHHHHHC-------CCCCEEEECCCHHHHCCCCCCCCCCCCCCCCCC
T ss_conf             5330343234553035864025310067889999999748-------766079965617760676667544689998897


Q ss_pred             CCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCC
Q ss_conf             2233322100000012333222222222222233322---222222222222222222222-222233221133222200
Q gi|254780920|r  156 PYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYH---FPEKLIPLAITRMIEGSHVFL-YGDGQNVRDWLYVEDHVR  231 (358)
Q Consensus       156 ~Yg~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~---~~~~~i~~~i~~~~~g~~~~i-~g~g~~~Rdfi~v~D~a~  231 (358)
T Consensus       154 PYAvAKlYa~W~tvNYResYgl~AcnGILFNHESP~Rge~FVTRKIt~ava~Ik~G~q~~l~lGNldAkRDWG~A~DYVe  233 (345)
T COG1089         154 PYAVAKLYAYWITVNYRESYGLFACNGILFNHESPLRGETFVTRKITRAVARIKLGLQDKLYLGNLDAKRDWGHAKDYVE  233 (345)
T ss_pred             HHHHHHHHHHHEEEEHHHHCCCEEECCEEECCCCCCCCCCEEHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCHHHHHH
T ss_conf             78899987776030147634733431144337898775310338999999998706612687436331023431678999


Q ss_pred             CEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCC-----------CCCCCCEEECCC--CCCCCCEECCCH
Q ss_conf             0000012222222111357864202688999988603426555-----------686430233488--998653003171
Q gi|254780920|r  232 ALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS-----------YSHTELIRFIED--RPGHDRRYAIDS  298 (358)
Q Consensus       232 ~i~~~~~~~~~~~~fNigs~~~~s~~e~~~~i~~~~~~~~~~~-----------~~~~~~~~~~~~--~~~~~~~~~~d~  298 (358)
T Consensus       234 ~mwlmLQq~~P-ddyViATg~t~sVrefv~~Af~~~g~~l~w~g~g~~e~g~da~tG~~~V~idp~~fRPaEVd~Llgdp  312 (345)
T COG1089         234 AMWLMLQQEEP-DDYVIATGETHSVREFVELAFEMVGIDLEWEGTGVDEKGVDAKTGKIIVEIDPRYFRPAEVDLLLGDP  312 (345)
T ss_pred             HHHHHHCCCCC-CCEEEECCCEEEHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCEEEEECCCCCCCHHHHHHCCCH
T ss_conf             99999744799-84488527522399999999997085588730355311312456752699870106831255652887


Q ss_pred             HHHHHHHCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             89999818966108999999999999886
Q gi|254780920|r  299 SKIKSEIGWFPQENMESGLNKTVCWYLDN  327 (358)
Q Consensus       299 ~K~~~~Lgw~p~~~l~egi~~~i~w~~~n  327 (358)
T Consensus       313 ~KA~~~LGW~~~~~~~elv~~Mv~~dl~~  341 (345)
T COG1089         313 TKAKEKLGWRPEVSLEELVREMVEADLEA  341 (345)
T ss_pred             HHHHHHCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             89899709966667999999999999998