HHsearch alignment for GI: 254780920 and conserved domain: COG1091

>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane].
Probab=100.00  E-value=1.7e-42  Score=279.16  Aligned_cols=277  Identities=22%  Similarity=0.276  Sum_probs=234.6

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEE
Q ss_conf             94899767882779999999986898799994788765856777620379749997638899999999862278717851
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNF   80 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~ViHl   80 (358)
T Consensus         1 M~iLi~G~~GqLG~~L~~~l~--~~~~v~a~~~~---------------------~~Ditd~~~v~~~i~~~~PDvVIn~   57 (281)
T COG1091           1 MKILITGANGQLGTELRRALP--GEFEVIATDRA---------------------ELDITDPDAVLEVIRETRPDVVINA   57 (281)
T ss_pred             CCEEEECCCCHHHHHHHHHHC--CCCEEEECCCC---------------------CCCCCCHHHHHHHHHHHCCCEEEEC
T ss_conf             958997698767999999717--78439951576---------------------5555685899999986199989987


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             23433222222222222222222202478886512322112478427863055431122222222222222222222333
Q gi|254780920|r   81 AAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSAT  160 (358)
Q Consensus        81 Aa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~s~Yg~s  160 (358)
T Consensus        58 AAyt~vD~aE~~~e~A~~vNa~~~~~lA~aa~~~g----------a~lVhiSTDyVFDG~~~~~Y~E~D~~~P~nvYG~s  127 (281)
T COG1091          58 AAYTAVDKAESEPELAFAVNATGAENLARAAAEVG----------ARLVHISTDYVFDGEKGGPYKETDTPNPLNVYGRS  127 (281)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHC----------CEEEEEECCEEECCCCCCCCCCCCCCCCHHHHHHH
T ss_conf             32036541338989977767799999999999719----------76999634457438989888778999970245477


Q ss_pred             CCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCC
Q ss_conf             22100000012333222222222222233322222222222222222222222222233221133222200000001222
Q gi|254780920|r  161 KASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG  240 (358)
Q Consensus       161 K~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~a~~i~~~~~~~  240 (358)
T Consensus       128 Kl~GE~~v~~~~~~----~~I~Rtswv~g~~g--~nFv~tml~la~~~~~l~vv~--Dq~gsPt~~~dlA~~i~~ll~~~  199 (281)
T COG1091         128 KLAGEEAVRAAGPR----HLILRTSWVYGEYG--NNFVKTMLRLAKEGKELKVVD--DQYGSPTYTEDLADAILELLEKE  199 (281)
T ss_pred             HHHHHHHHHHHCCC----EEEEEEEEEECCCC--CCHHHHHHHHHHCCCCEEEEC--CEEECCCCHHHHHHHHHHHHHCC
T ss_conf             89789999973998----79998565545888--778999999850599269979--84538746999999999998345


Q ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCC-CCCCCCEEECCCCCCCCCEECCCHHHHHHHHCCCCCCCHHHHHHH
Q ss_conf             2222111357864202688999988603426555-686430233488998653003171899998189661089999999
Q gi|254780920|r  241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS-YSHTELIRFIEDRPGHDRRYAIDSSKIKSEIGWFPQENMESGLNK  319 (358)
Q Consensus       241 ~~~~~fNigs~~~~s~~e~~~~i~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~d~~K~~~~Lgw~p~~~l~egi~~  319 (358)
T Consensus       200 ~~~~~yH~~~~g~~Swydfa~~I~~~~~~~~~v~~~~~~~~~~~~a~RP~---~S~L~~~k~~~~~~~~~-~~w~~~l~~  275 (281)
T COG1091         200 KEGGVYHLVNSGECSWYEFAKAIFEEAGVDGEVIEPIASAEYPTPAKRPA---NSSLDTKKLEKAFGLSL-PEWREALKA  275 (281)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCC---CCCCCHHHHHHHHCCCC-CCHHHHHHH
T ss_conf             55867998079741199999999998388864145556223676678975---55425288999748898-259999999


Q ss_pred             HHH
Q ss_conf             999
Q gi|254780920|r  320 TVC  322 (358)
Q Consensus       320 ~i~  322 (358)
T Consensus       276 ~~~  278 (281)
T COG1091         276 LLD  278 (281)
T ss_pred             HHH
T ss_conf             973