HHsearch alignment for GI: 254780920 and conserved domain: COG3268

>COG3268 Uncharacterized conserved protein [Function unknown].
Probab=95.96  E-value=0.025  Score=33.55  Aligned_cols=100  Identities=13%  Similarity=0.263  Sum_probs=63.3

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEECC
Q ss_conf             89976788277999999998689879999478876585677762037974999763889999999986227871785123
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNFAA   82 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~ViHlAa   82 (358)
T Consensus         9 ~iiYGAtGy~G~lvae~l~~~-g~~~-aL----AgRs~~kl~~l~~~LG~~~~~~p~~~p~~~~~~~~~~--~VVlncvG   80 (382)
T COG3268           9 IIIYGATGYAGGLVAEYLARE-GLTA-AL----AGRSSAKLDALRASLGPEAAVFPLGVPAALEAMASRT--QVVLNCVG   80 (382)
T ss_pred             EEEECCCCCHHHHHHHHHHHC-CCCH-HH----CCCCHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHCC--EEEEECCC
T ss_conf             899746552158999999974-8864-32----1688899988998509664446778889999997426--68996146


Q ss_pred             C------CCCCCCCCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             4------33222222222222222222202478886
Q gi|254780920|r   83 E------SHVDRSILGADEFITTNIIGTFILLEETR  112 (358)
Q Consensus        83 ~------~~~~~~~~~p~~~~~~Nv~gt~nil~~~~  112 (358)
T Consensus        81 Pyt~~g~plv~aC~~~GTdY~D--iTGEi~~fe~~i  114 (382)
T COG3268          81 PYTRYGEPLVAACAAAGTDYAD--ITGEIMFFENSI  114 (382)
T ss_pred             CCCCCCCHHHHHHHHHCCCEEE--CCCCHHHHHHHH
T ss_conf             6120264799999971987241--356179999998