HHsearch alignment for GI: 254780920 and conserved domain: KOG0725

>KOG0725 consensus.
Probab=98.93  E-value=1e-08  Score=72.57  Aligned_cols=174  Identities=20%  Similarity=0.136  Sum_probs=115.6

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHH---HHHHCCCCEEEEECCCCCHHHHHHHHH----H--C
Q ss_conf             489976788277999999998689879999478876585677---762037974999763889999999986----2--2
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSL---KEISQSNLFSFLQVDICDRECIRSALK----E--F   72 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~---~~~~~~~~v~~i~~Di~d~~~l~~~~~----~--~   72 (358)
T Consensus        10 valVTG~s~GIG~aia~~la~-~Ga~v~i~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~Dv~~~~~~~~l~~~~~~~~~G   88 (270)
T KOG0725          10 VALVTGGSSGIGKAIALLLAK-AGAKVVITGRSEERLEETAQELGGLGYTGGKVLAIVCDVSKEVDVEKLVEFAVEKFFG   88 (270)
T ss_pred             EEEEECCCCCHHHHHHHHHHH-CCCEEEEEECCHHHHHHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHHHHHHHCC
T ss_conf             899979998158999999998-7998999845456667789998743677761489975557678899999999998478


Q ss_pred             CCCEEEEECCCCCCC-----CCCCCCCCCCCCCCCC-CCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCC
Q ss_conf             787178512343322-----2222222222222222-2024788865123221124784278630554311222222222
Q gi|254780920|r   73 QPDAIVNFAAESHVD-----RSILGADEFITTNIIG-TFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFS  146 (358)
Q Consensus        73 ~~d~ViHlAa~~~~~-----~~~~~p~~~~~~Nv~g-t~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~  146 (358)
T Consensus        89 kidiLvnnag~~~~~~~~~~~s~e~~d~~~~~Nl~G~~~~~~~~a~~~~-----~~~~gg~I~~~ss~~~~~~~------  157 (270)
T KOG0725          89 KIDILVNNAGALGLTGSILDLSEEVFDKIMATNLRGSAFCLKQAARPML-----KKSKGGSIVNISSVAGVGPG------  157 (270)
T ss_pred             CCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHCCCHHHHHHHHHHHHHH-----HHCCCCEEEEECCCCCCCCC------
T ss_conf             8877987266467887442199999988886403127899999999999-----85389469996664455667------


Q ss_pred             CCCCCCCCCCCCCCCCCCEEEECCCCC---CCCCCCCCCCCCCCCCCC
Q ss_conf             222222222223332210000001233---322222222222223332
Q gi|254780920|r  147 EDMPYNPSSPYSATKASSDYLVLAWGH---TYGIPVLLSNCSNNYGPY  191 (358)
Q Consensus       147 E~~~~~p~s~Yg~sK~~~E~~~~~~~~---~~~l~~~ilR~~~vyGp~  191 (358)
T Consensus       158 ---~~~~-~~Y~~sK~al~~ltr~lA~El~~~gIRvN~v~PG~i~T~~  201 (270)
T KOG0725         158 ---PGSG-VAYGVSKAALLQLTRSLAKELAKHGIRVNSVSPGLVKTSL  201 (270)
T ss_pred             ---CCCC-CCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCH
T ss_conf             ---7765-2001149999998999999998639368883468670440