HHsearch alignment for GI: 254780920 and conserved domain: KOG0747

>KOG0747 consensus.
Probab=100.00  E-value=0  Score=424.00  Aligned_cols=317  Identities=41%  Similarity=0.715  Sum_probs=296.6

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHC-CCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEE
Q ss_conf             48997678827799999999868-98799994788765856777620379749997638899999999862278717851
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDL-KIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNF   80 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~-~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~ViHl   80 (358)
T Consensus         8 ~vlItgg~gfi~Sn~~~~~~~~~p~~~~v~idkL~~~s~~~~l~~~~n~p~ykfv~~di~~~~~~~~~~~~~~id~vihf   87 (331)
T KOG0747           8 NVLITGGAGFIGSNFINYLVDKYPDYKFVNLDKLDYCSNLKNLEPVRNSPNYKFVEGDIADADLVLYLFETEEIDTVIHF   87 (331)
T ss_pred             EEEEECCCCCCCHHHHHHCCCCCCCCCEEEEECCCCCCCHHHHHHHCCCCCCEEEECHHCCCHHHHHHHCCCCHHHHHHH
T ss_conf             08985476753113455334679987778762000024313544312588716860301050998765336715777767


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCC-CCCCCCCCCCCCC
Q ss_conf             234332222222222222222222024788865123221124784278630554311222222222-2222222222233
Q gi|254780920|r   81 AAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFS-EDMPYNPSSPYSA  159 (358)
Q Consensus        81 Aa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~-E~~~~~p~s~Yg~  159 (358)
T Consensus        88 aa~t~vd~s~~~~~~~~~nnil~t~~Lle~~~~sg--------~i~~fvhvSTdeVYGds~~~~~~~E~s~~nPtnpyAa  159 (331)
T KOG0747          88 AAQTHVDRSFGDSFEFTKNNILSTHVLLEAVRVSG--------NIRRFVHVSTDEVYGDSDEDAVVGEASLLNPTNPYAA  159 (331)
T ss_pred             HHHHHHHHHHCCHHHHHCCCCHHHHHHHHHHHHCC--------CEEEEEEECCCCEECCCCCCCCCCCCCCCCCCCCHHH
T ss_conf             76641466507658774576034577999988504--------7347999646402347664456332256899980378


Q ss_pred             CCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCC
Q ss_conf             32210000001233322222222222223332222222222222222222222222223322113322220000000122
Q gi|254780920|r  160 TKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK  239 (358)
Q Consensus       160 sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~a~~i~~~~~~  239 (358)
T Consensus       160 sKaAaE~~v~Sy~~sy~lpvv~~R~nnVYGP~q~~~klipkFi~l~~~~~~~~i~g~g~~~rs~l~veD~~ea~~~v~~K  239 (331)
T KOG0747         160 SKAAAEMLVRSYGRSYGLPVVTTRMNNVYGPNQYPEKLIPKFIKLAMRGKEYPIHGDGLQTRSYLYVEDVSEAFKAVLEK  239 (331)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHHCCCCCEECCCCCCEEEEEHHHHHHHHHHHHHC
T ss_conf             89999999999876049717999415733888571677688999997189764215741012257699999999999845


Q ss_pred             CCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCEEECCCCCCCCCEECCCHHHHHHHHCCCCCCCHHHHHHH
Q ss_conf             22222111357864202688999988603426555686430233488998653003171899998189661089999999
Q gi|254780920|r  240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSSKIKSEIGWFPQENMESGLNK  319 (358)
Q Consensus       240 ~~~~~~fNigs~~~~s~~e~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~K~~~~Lgw~p~~~l~egi~~  319 (358)
T Consensus       240 g~~geIYNIgtd~e~~~~~l~k~i~eli~~~~~-~~~~~p~~~~v~dRp~nd~Ry~~~~eKik-~LGw~~~~p~~eGLrk  317 (331)
T KOG0747         240 GELGEIYNIGTDDEMRVIDLAKDICELFEKRLP-NIDTEPFIFFVEDRPYNDLRYFLDDEKIK-KLGWRPTTPWEEGLRK  317 (331)
T ss_pred             CCCCCEEECCCCCHHHHHHHHHHHHHHHHHHCC-CCCCCCCCEECCCCCCCCCCCCCCHHHHH-HCCCCCCCCHHHHHHH
T ss_conf             785623641683076699999999999997546-88888863315888764201000588897-5387215767888999


Q ss_pred             HHHHHHHHH
Q ss_conf             999998867
Q gi|254780920|r  320 TVCWYLDNN  328 (358)
Q Consensus       320 ~i~w~~~n~  328 (358)
T Consensus       318 tie~y~~~~  326 (331)
T KOG0747         318 TIEWYTKNF  326 (331)
T ss_pred             HHHHHHHHH
T ss_conf             999998644