HHsearch alignment for GI: 254780920 and conserved domain: KOG1200

>KOG1200 consensus.
Probab=98.45  E-value=1.2e-06  Score=60.00  Aligned_cols=222  Identities=17%  Similarity=0.205  Sum_probs=128.9

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             8997678827799999999868987999947887658567776203797499976388999999998622-----78717
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEF-----QPDAI   77 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d~V   77 (358)
T Consensus        17 ~~vtGg~sGIGrAia~~la-~~Garv~v~dl~~~-~A~ata~~L~g~~~h~aF~~DVS~a~~v~~~l~e~~k~~g~psvl   94 (256)
T KOG1200          17 AAVTGGSSGIGRAIAQLLA-KKGARVAVADLDSA-AAEATAGDLGGYGDHSAFSCDVSKAHDVQNTLEEMEKSLGTPSVL   94 (256)
T ss_pred             EEEECCCCHHHHHHHHHHH-HCCCEEEEEECCHH-HHHHHHHHCCCCCCCCEEEECCCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             4873487507799999997-46967997503224-479998626887765235304675788999999999842997289


Q ss_pred             EEECCCCC----CCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             85123433----22222222222222222220247888651232211247842786305543112222222222222222
Q gi|254780920|r   78 VNFAAESH----VDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNP  153 (358)
Q Consensus        78 iHlAa~~~----~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p  153 (358)
T Consensus        95 VncAGItrD~~Llrmkq~qwd~vi~vNL~gvfl~tqaa~r~~~---~~~~~~~sIiNvsSIV--GkiGN--~-------G  160 (256)
T KOG1200          95 VNCAGITRDGLLLRMKQEQWDSVIAVNLTGVFLVTQAAVRAMV---MNQQQGLSIINVSSIV--GKIGN--F-------G  160 (256)
T ss_pred             EECCCCCCCCCEEECCHHHHHHHHHHHCHHHHHHHHHHHHHHH---HHCCCCCEEEEEHHHH--CCCCC--C-------C
T ss_conf             9757646530201324888888997512136788899999999---7167984388644521--02456--5-------5


Q ss_pred             CCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222233322100000012333---22222222222223332222222222222222222222222223322113322220
Q gi|254780920|r  154 SSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV  230 (358)
Q Consensus       154 ~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~a  230 (358)
T Consensus       161 QtnYAAsK~GvIgftktaArEla~knIrvN~VlPGFI~tpMT--~~mp~~v~~ki~~~iPmgr---------~G~~EevA  229 (256)
T KOG1200         161 QTNYAASKGGVIGFTKTAARELARKNIRVNVVLPGFIATPMT--EAMPPKVLDKILGMIPMGR---------LGEAEEVA  229 (256)
T ss_pred             CHHHHHHCCCEEEEEHHHHHHHHHCCCEEEEECCCCCCCHHH--HHCCHHHHHHHHCCCCCCC---------CCCHHHHH
T ss_conf             223445327555300988998865482476761431168125--4438789999975587644---------58889987


Q ss_pred             CCEEECCC---CCCCCCCCCCCCC
Q ss_conf             00000012---2222221113578
Q gi|254780920|r  231 RALYLVLK---KGRIGERYNIGGN  251 (358)
Q Consensus       231 ~~i~~~~~---~~~~~~~fNigs~  251 (358)
T Consensus       230 ~~V~fLAS~~ssYiTG~t~evtGG  253 (256)
T KOG1200         230 NLVLFLASDASSYITGTTLEVTGG  253 (256)
T ss_pred             HHHHHHHCCCCCCCCCEEEEEECC
T ss_conf             899988154423321516998346