HHsearch alignment for GI: 254780920 and conserved domain: KOG1205

>KOG1205 consensus.
Probab=99.16  E-value=1.6e-10  Score=83.56  Aligned_cols=164  Identities=20%  Similarity=0.209  Sum_probs=110.8

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHH----HHHHCCCCEEEEECCCCCHHHHHHHHHH-----C
Q ss_conf             489976788277999999998689879999478876585677----7620379749997638899999999862-----2
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSL----KEISQSNLFSFLQVDICDRECIRSALKE-----F   72 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~----~~~~~~~~v~~i~~Di~d~~~l~~~~~~-----~   72 (358)
T Consensus        14 vVvITGASsGIG~~lA~~la~~-G~~l~lvar~~--rrl~~v~~~l~~~~~~~~v~~~~~Dvs~~~~~~~~~~~~~~~fg   90 (282)
T KOG1205          14 VVLITGASSGIGEALAYELAKR-GAKLVLVARRA--RRLERVAEELRKLGSLEKVLVLQLDVSDEESVKKFVEWAIRHFG   90 (282)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCCEEEEEHHH--HHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHHCC
T ss_conf             8999578717889999999867-77347742432--02899999999747867647996765887889999999998658


Q ss_pred             CCCEEEEECCCCCCCCCC----CCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCC
Q ss_conf             787178512343322222----2222222222222202478886512322112478427863055431122222222222
Q gi|254780920|r   73 QPDAIVNFAAESHVDRSI----LGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSED  148 (358)
Q Consensus        73 ~~d~ViHlAa~~~~~~~~----~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~  148 (358)
T Consensus        91 ~vDvLVNNAG~~~~~~~~~~~~~~~~~~mdtN~~G~V~~Tk~alp~-----m~~r~~GhIVvisSiaG~--~-~~-----  157 (282)
T KOG1205          91 RVDVLVNNAGISLVGFLEDTDIEDVRNVMDTNVFGTVYLTKAALPS-----MKKRNDGHIVVISSIAGK--M-PL-----  157 (282)
T ss_pred             CCCEEEECCCCCCCCCCCCCCHHHHHHHHHHHCHHHHHHHHHHHHH-----HHHCCCCEEEEEECCCCC--C-CC-----
T ss_conf             8888984686565553344768988877100040248999999887-----663289749998061015--5-78-----


Q ss_pred             CCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCC
Q ss_conf             222222222333221000000123332222222222
Q gi|254780920|r  149 MPYNPSSPYSATKASSDYLVLAWGHTYGIPVLLSNC  184 (358)
Q Consensus       149 ~~~~p~s~Yg~sK~~~E~~~~~~~~~~~l~~~ilR~  184 (358)
T Consensus       158 -P~--~~~Y~ASK~Al~~f~etLR~El~~~~~~i~i  190 (282)
T KOG1205         158 -PF--RSIYSASKHALEGFFETLRQELIPLGTIIII  190 (282)
T ss_pred             -CC--CCCCCHHHHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             -86--5541567999999999999996405845999