HHsearch alignment for GI: 254780920 and conserved domain: KOG1371

>KOG1371 consensus.
Probab=100.00  E-value=0  Score=378.60  Aligned_cols=313  Identities=26%  Similarity=0.382  Sum_probs=267.9

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCC--CHHHHHHHHC-CCCEEEEECCCCCHHHHHHHHHHCCCCEE
Q ss_conf             94899767882779999999986898799994788765--8567776203-79749997638899999999862278717
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAG--NLNSLKEISQ-SNLFSFLQVDICDRECIRSALKEFQPDAI   77 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~--~~~~~~~~~~-~~~v~~i~~Di~d~~~l~~~~~~~~~d~V   77 (358)
T Consensus         3 ~~VLVtGgaGyiGsht~l~L~~~-gy~v~~vDNl~n~~~~sl~r~~~l~~~~~~v~f~~~Dl~D~~~L~kvF~~~~fd~V   81 (343)
T KOG1371           3 KHVLVTGGAGYIGSHTVLALLKR-GYGVVIVDNLNNSYLESLKRVRQLLGEGKSVFFVEGDLNDAEALEKLFSEVKFDAV   81 (343)
T ss_pred             CEEEEECCCCCEEHHHHHHHHHC-CCCEEEEECCCCCCHHHHHHHHHHCCCCCCEEEEEECCCCHHHHHHHHHHCCCCEE
T ss_conf             37999668763105999999867-98179982433212467788998627877438998156689999999863388657


Q ss_pred             EEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCC-CCCC
Q ss_conf             851234332222222222222222222024788865123221124784278630554311222222222222222-2222
Q gi|254780920|r   78 VNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYN-PSSP  156 (358)
Q Consensus        78 iHlAa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~-p~s~  156 (358)
T Consensus        82 ~Hfa~~~~vgeS~~~p~~Y~~nNi~gtlnlLe~~~~---------~~~~~~V~sssatvYG~p~~vp~te~~~t~~p~~p  152 (343)
T KOG1371          82 MHFAALAAVGESMENPLSYYHNNIAGTLNLLEVMKA---------HNVKALVFSSSATVYGLPTKVPITEEDPTDQPTNP  152 (343)
T ss_pred             EEEHHHHCCCHHHHCCHHHEEHHHHHHHHHHHHHHH---------CCCCEEEEECCEEEECCCCEECCCCCCCCCCCCCC
T ss_conf             762444133156628223100211468999999997---------59864888423046347643203576877888886


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCC--CCCC--------CCCCCCCCCCCCCCCC--CCCCC------CCCC
Q ss_conf             233322100000012333222222222222233--3222--------2222222222222222--22222------2223
Q gi|254780920|r  157 YSATKASSDYLVLAWGHTYGIPVLLSNCSNNYG--PYHF--------PEKLIPLAITRMIEGS--HVFLY------GDGQ  218 (358)
Q Consensus       157 Yg~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyG--p~~~--------~~~~i~~~i~~~~~g~--~~~i~------g~g~  218 (358)
T Consensus       153 yg~tK~~iE~i~~d~~~~~~~~~~~LRyfn~~ga~p~Gr~ge~p~~~~nnl~p-~v~~vaigr~~~l~v~g~d~~t~dgt  231 (343)
T KOG1371         153 YGKTKKAIEEIIHDYNKAYGWKVTGLRYFNVIGAHPSGRIGEAPLGIPNNLLP-YVFQVAIGRRPNLQVVGRDYTTIDGT  231 (343)
T ss_pred             CCHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCC-CCCCHHCCCCCCCEEECCCCCCCCCC
T ss_conf             40136779997676531456047998842556766546778887667565340-13300002324525404766021797


Q ss_pred             CCCCCCCCCCCCCCEEECCCCCC---CCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCEEECCCCCCCCCEEC
Q ss_conf             32211332222000000012222---222111357864202688999988603426555686430233488998653003
Q gi|254780920|r  219 NVRDWLYVEDHVRALYLVLKKGR---IGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYA  295 (358)
Q Consensus       219 ~~Rdfi~v~D~a~~i~~~~~~~~---~~~~fNigs~~~~s~~e~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  295 (358)
T Consensus       232 ~vrdyi~v~Dla~~h~~al~k~~~~~~~~i~Nlgtg~g~~V~~lv~a~~k~~g~~~k~--------~~v~~R~gdv~~~y  303 (343)
T KOG1371         232 IVRDYIHVLDLADGHVAALGKLRGAAEFGVYNLGTGKGSSVLELVTAFEKALGVKIKK--------KVVPRRNGDVAFVY  303 (343)
T ss_pred             EEECCEEEEEHHHHHHHHHHCCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHCCCCCC--------CCCCCCCCCCEEEE
T ss_conf             1123220166477889876420000003457604788822999999999875579872--------00377899841465


Q ss_pred             CCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             1718999981896610899999999999988678655
Q gi|254780920|r  296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR  332 (358)
Q Consensus       296 ~d~~K~~~~Lgw~p~~~l~egi~~~i~w~~~n~~~~~  332 (358)
T Consensus       304 a~~~~a~~elgwk~~~~iee~c~dlw~W~~~np~gy~  340 (343)
T KOG1371         304 ANPSKAQRELGWKAKYGLQEMLKDLWRWQKQNPSGYD  340 (343)
T ss_pred             ECHHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCC
T ss_conf             1747899984886423899999999998751987677