HHsearch alignment for GI: 254780920 and conserved domain: KOG1372

>KOG1372 consensus.
Probab=100.00  E-value=3.5e-43  Score=283.30  Aligned_cols=312  Identities=22%  Similarity=0.323  Sum_probs=262.7

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCC------CCEEEEECCCCCHHHHHHHHHHCCCCE
Q ss_conf             89976788277999999998689879999478876585677762037------974999763889999999986227871
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQS------NLFSFLQVDICDRECIRSALKEFQPDA   76 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~------~~v~~i~~Di~d~~~l~~~~~~~~~d~   76 (358)
T Consensus        31 ALITGItGQDGSYLaEfLL~K-gYeVHGiiRRsSsFNT~RIeHlY~nP~~h~~~~mkLHYgDmTDss~L~k~I~~ikPtE  109 (376)
T KOG1372          31 ALITGITGQDGSYLAEFLLSK-GYEVHGIIRRSSSFNTARIEHLYSNPHTHNGASMKLHYGDMTDSSCLIKLISTIKPTE  109 (376)
T ss_pred             EEEECCCCCCCHHHHHHHHCC-CCEEEEEEEECCCCCHHHHHHHHCCCCCCCCCEEEEEECCCCCHHHHHHHHHCCCCHH
T ss_conf             999623688726999998708-8567678860466534557776458400256404785345554388999986058255


Q ss_pred             EEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             78512343322222222222222222220247888651232211247842786305543112222222222222222222
Q gi|254780920|r   77 IVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSP  156 (358)
Q Consensus        77 ViHlAa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~s~  156 (358)
T Consensus       110 iYnLaAQSHVkvSFdlpeYTAeVdavGtLRlLdAi~~c~l------~~~VrfYQAstSElyGkv~e~PQsE~TPFyPRSP  183 (376)
T KOG1372         110 VYNLAAQSHVKVSFDLPEYTAEVDAVGTLRLLDAIRACRL------TEKVRFYQASTSELYGKVQEIPQSETTPFYPRSP  183 (376)
T ss_pred             HHHHHHHCCEEEEECCCHHHEECCCCCHHHHHHHHHHCCC------CCCEEEEECCCHHHCCCCCCCCCCCCCCCCCCCH
T ss_conf             4112000326798514221000102004358989986164------5452688525276546654687556888888985


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2333221000000123332222222222222333222---2222222222222222--2222222233221133222200
Q gi|254780920|r  157 YSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHF---PEKLIPLAITRMIEGS--HVFLYGDGQNVRDWLYVEDHVR  231 (358)
Q Consensus       157 Yg~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~---~~~~i~~~i~~~~~g~--~~~i~g~g~~~Rdfi~v~D~a~  231 (358)
T Consensus       184 Ya~aKmy~~WivvNyREAYnmfAcNGILFNHESPRRGenFVTRKItRsvakI~~gqqe~~~-LGNL~a~RDWGhA~dYVE  262 (376)
T KOG1372         184 YAAAKMYGYWIVVNYREAYNMFACNGILFNHESPRRGENFVTRKITRSVAKISLGQQEKIE-LGNLSALRDWGHAGDYVE  262 (376)
T ss_pred             HHHHHHEEEEEEEEHHHHHCCEEECCEEECCCCCCCCCCHHHHHHHHHHHHHHHCCEEEEE-ECCHHHHCCCCHHHHHHH
T ss_conf             5776441058998848841201313176547787666531357888888785213222576-347034202330677999


Q ss_pred             CEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCC------CCCCC----CEEEC--CCCCCCCCEECCCHH
Q ss_conf             0000012222222111357864202688999988603426555------68643----02334--889986530031718
Q gi|254780920|r  232 ALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS------YSHTE----LIRFI--EDRPGHDRRYAIDSS  299 (358)
Q Consensus       232 ~i~~~~~~~~~~~~fNigs~~~~s~~e~~~~i~~~~~~~~~~~------~~~~~----~~~~~--~~~~~~~~~~~~d~~  299 (358)
T Consensus       263 AMW~mLQ~d~Pd-DfViATge~hsVrEF~~~aF~~ig~~l~Weg~gv~~~~~n~~g~v~V~v~~kYyRPtEVd~LqGdas  341 (376)
T KOG1372         263 AMWLMLQQDSPD-DFVIATGEQHSVREFCNLAFAEIGEVLNWEGEGVDEVGKNDDGVVRVKVDPKYYRPTEVDTLQGDAS  341 (376)
T ss_pred             HHHHHHHCCCCC-CEEEECCCCCCHHHHHHHHHHHHCCEEEECCCCCCCCCCCCCCEEEEEECCCCCCCHHHHHHCCCHH
T ss_conf             999997137987-6588627754199999999986371777435554233336785599996644267302232137767


Q ss_pred             HHHHHHCCCCCCCHHHHHHHHHHH
Q ss_conf             999981896610899999999999
Q gi|254780920|r  300 KIKSEIGWFPQENMESGLNKTVCW  323 (358)
Q Consensus       300 K~~~~Lgw~p~~~l~egi~~~i~w  323 (358)
T Consensus       342 KAk~~LgW~pkv~f~eLVkeMv~~  365 (376)
T KOG1372         342 KAKKTLGWKPKVTFPELVKEMVAS  365 (376)
T ss_pred             HHHHHCCCCCCCCHHHHHHHHHHH
T ss_conf             766640998757689999999986