HHsearch alignment for GI: 254780920 and conserved domain: PRK00048

>PRK00048 dihydrodipicolinate reductase; Provisional.
Probab=96.74  E-value=0.0077  Score=36.63  Aligned_cols=74  Identities=14%  Similarity=0.265  Sum_probs=42.8

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCCEEEE-EECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEE
Q ss_conf             948997678827799999999868987999-9478876585677762037974999763889999999986227871785
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLKIQVLV-IDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVN   79 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~~~V~~-~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~ViH   79 (358)
T Consensus         3 ikI~i~Ga~GrMG~~i~~~i~~~~~~~l~~~i~~~~~~~~g~~~~~~~~~~-----~~~~~~~~~l~~~~~~--~DVvID   75 (265)
T PRK00048          3 IKVGVAGASGRMGRELIEAVEAAEDLELVAALDRPGSPLVGQDAGELAGLG-----KLGVPITDDLEAVLDD--FDVLID   75 (265)
T ss_pred             EEEEEECCCCHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCHHHHCCCC-----CCCCEECCCHHHHHCC--CCEEEE
T ss_conf             599998888877999999998689979999994689723365356652767-----6784311789886055--998998


Q ss_pred             EC
Q ss_conf             12
Q gi|254780920|r   80 FA   81 (358)
Q Consensus        80 lA   81 (358)
T Consensus        76 FS   77 (265)
T PRK00048         76 FT   77 (265)
T ss_pred             CC
T ss_conf             99