HHsearch alignment for GI: 254780920 and conserved domain: PRK00436

>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated.
Probab=97.01  E-value=0.0049  Score=37.82  Aligned_cols=39  Identities=23%  Similarity=0.602  Sum_probs=29.4

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCC
Q ss_conf             948997678827799999999868987999947887658
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGN   39 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~   39 (358)
T Consensus         2 ~kVaIvGAtG~vG~eli~lL~~hp~~ei~~las~~saGk   40 (345)
T PRK00436          2 IKVAIVGASGYTGGELLRLLLNHPEVEIVYLTSRSSAGK   40 (345)
T ss_pred             CEEEEECCCCHHHHHHHHHHHCCCCCEEEEEECCCCCCC
T ss_conf             199998966188999999998099867999975786897