HHsearch alignment for GI: 254780920 and conserved domain: PRK05086

>PRK05086 malate dehydrogenase; Provisional.
Probab=97.45  E-value=0.001  Score=42.00  Aligned_cols=179  Identities=17%  Similarity=0.080  Sum_probs=85.8

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHC--CCEEEEEECCCCC-CCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEE
Q ss_conf             948997678827799999999868--9879999478876-5856777620379749997638899999999862278717
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDL--KIQVLVIDKLTYA-GNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAI   77 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~--~~~V~~~d~~~~~-~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~V   77 (358)
T Consensus         1 mKV~IiGA~G~VG~s~A~~l~~~~~~~~el~L~Di~~~~~G~alDL~h~~~~~~~~~~~~~--~---~~~~l~~--adiV   73 (312)
T PRK05086          1 MKVAVLGAAGGIGQALALLLKTQLPAGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSGE--D---PTPALEG--ADVV   73 (312)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCHHHHHHCCCCCCCCCEEECC--C---HHHHHCC--CCEE
T ss_conf             9899998998699999999982898777499975888861056565478754665346169--8---6787179--9999


Q ss_pred             EEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEE-EEECCC-CCC--CCCCCCCCCCCCCCCCC
Q ss_conf             85123433222222222222222222202478886512322112478427-863055-431--12222222222222222
Q gi|254780920|r   78 VNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFR-FLQIST-DEV--YGSLDKGLFSEDMPYNP  153 (358)
Q Consensus        78 iHlAa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~-~v~~SS-~~v--Yg~~~~~~~~E~~~~~p  153 (358)
T Consensus        74 vitAG~~rkp--G~tR~dLl~~Na~I~~~i~~~I~~~---------~p~aiiivvsNPvD~mt~ia--~~~~k~~g~~~~  140 (312)
T PRK05086         74 LISAGVARKP--GMDRSDLFNVNAGIVKNLVEKVAKT---------CPKACIGIITNPVNTTVAIA--AEVLKKAGVYDK  140 (312)
T ss_pred             EECCCCCCCC--CCCHHHHHHHHHHHHHHHHHHHHHC---------CCCCEEEEECCCHHHHHHHH--HHHHHHCCCCCC
T ss_conf             9878989985--8988999998789999999988720---------89718999548327789999--999998389980


Q ss_pred             CCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222233322100000012333222222222222233322222222222
Q gi|254780920|r  154 SSPYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLA  201 (358)
Q Consensus       154 ~s~Yg~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~~~~~i~~~  201 (358)
T Consensus       141 ~rv~G~t~LDsaR~r~~la~~l~v~~~~V~-~~ViGeHg~-~t~vPl~  186 (312)
T PRK05086        141 NKLFGVTTLDVIRSETFVAELKGKNPGEVE-VPVIGGHSG-VTILPLL  186 (312)
T ss_pred             CCEEEEEHHHHHHHHHHHHHHHCCCHHHCE-EEEECCCCC-CCEEEEE
T ss_conf             113333128899999999998594866747-769723588-7278630