HHsearch alignment for GI: 254780920 and conserved domain: PRK05416

>PRK05416 hypothetical protein; Provisional.
Probab=91.77  E-value=0.46  Score=25.76  Aligned_cols=125  Identities=22%  Similarity=0.189  Sum_probs=60.4

Q ss_pred             CE-EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCC---CCEEEEECCCCCHHH---HHHHHHH--
Q ss_conf             94-89976788277999999998689879999478876585677762037---974999763889999---9999862--
Q gi|254780920|r    1 MR-LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQS---NLFSFLQVDICDREC---IRSALKE--   71 (358)
Q Consensus         1 Mk-ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~---~~v~~i~~Di~d~~~---l~~~~~~--   71 (358)
T Consensus         6 m~lviVTGlSG-AGKStAl~~LEDlGy--~ciDNlP~~Ll~~l~~~~~~~~~~~~l-Av~iD~R~~~~~~~l~~~~~~l~   81 (292)
T PRK05416          6 MRLVIVTGLSG-AGKSVALRALEDLGY--YCVDNLPPSLLPKLVELLAQSGGIDKV-AVVIDVRSRPFFLDLPEALDELR   81 (292)
T ss_pred             EEEEEEECCCC-CCHHHHHHHHHHCCC--EEECCCCHHHHHHHHHHHHCCCCCCCE-EEEEECCCCCCHHHHHHHHHHHH
T ss_conf             68999968997-879999999981794--478688889999999997247887706-99982466544778999999998


Q ss_pred             ---CCCCEEEEECCC--CCCCCC----CCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCC
Q ss_conf             ---278717851234--332222----22222222222222202478886512322112478427863055431
Q gi|254780920|r   72 ---FQPDAIVNFAAE--SHVDRS----ILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEV  136 (358)
Q Consensus        72 ---~~~d~ViHlAa~--~~~~~~----~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~v  136 (358)
T Consensus        82 ~~~~~~~ilF-LdA~~~~LlrRy~eTRR~HPL~~~------~~~L~eaI~~Er~~L~~ir~~Ad~vIDTS~l~~  148 (292)
T PRK05416         82 ERGIDVRVLF-LDASDEVLIRRYSETRRRHPLSGD------GGSLLEAIELERELLAPLRERADLVIDTSELSV  148 (292)
T ss_pred             HCCCCEEEEE-EECCHHHHHHHHHHCCCCCCCCCC------CCCHHHHHHHHHHHHHHHHHHCCEEEECCCCCH
T ss_conf             5799559999-978869999988750689998889------999899999999999999974028974799999