HHsearch alignment for GI: 254780920 and conserved domain: PRK05690

>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional.
Probab=96.23  E-value=0.071  Score=30.74  Aligned_cols=31  Identities=29%  Similarity=0.455  Sum_probs=24.2

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEEC
Q ss_conf             48997678827799999999868987999947
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDK   33 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~   33 (358)
T Consensus        34 ~VlivG~GG-lG~~~~~~La~aGvg~i~lvD~   64 (245)
T PRK05690         34 RVLVVGLGG-LGCAAAQYLAAAGVGTLTLVDF   64 (245)
T ss_pred             CEEEECCCH-HHHHHHHHHHHCCCCEEEEEEC
T ss_conf             789987777-7899999999859965999968