HHsearch alignment for GI: 254780920 and conserved domain: PRK05855

>PRK05855 short chain dehydrogenase; Validated.
Probab=99.16  E-value=6.1e-11  Score=86.17  Aligned_cols=219  Identities=16%  Similarity=0.076  Sum_probs=128.6

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH-CCCCEEEEECCCCCHHHHHHHHHH----C-CCCE
Q ss_conf             899767882779999999986898799994788765856777620-379749997638899999999862----2-7871
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS-QSNLFSFLQVDICDRECIRSALKE----F-QPDA   76 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~-~~~~v~~i~~Di~d~~~l~~~~~~----~-~~d~   76 (358)
T Consensus       318 AvVTGA~sGIGrA~A~~fA~-~GA~Vvl~Dr~~~~l-~eta~ei~~~G~~a~~~~~DVtd~~av~al~~~v~~~~G~iDI  395 (582)
T PRK05855        318 VVVTGAGSGIGRATALAFAR-EGAEVVASDIDEAAA-ERTAALIRAAGAVAHAYRVDVSDADAMEALAEWVGAEHGVPDI  395 (582)
T ss_pred             EEEECCCCHHHHHHHHHHHH-CCCEEEEECCCHHHH-HHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCCE
T ss_conf             99958757899999999997-799999960799999-9999999951984899975589999999999999997699999


Q ss_pred             EEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCC-CEEEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             785123433222----222222222222222202478886512322112478-427863055431122222222222222
Q gi|254780920|r   77 IVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKD-QFRFLQISTDEVYGSLDKGLFSEDMPY  151 (358)
Q Consensus        77 ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~-~~~~v~~SS~~vYg~~~~~~~~E~~~~  151 (358)
T Consensus       396 LVNNAGI~~~g~~~d~s~e~w~~v~dVNl~Gv~~~~ra~lp~-----M~~rg~gG~IVNiSSiag~~-----------~~  459 (582)
T PRK05855        396 VVNNAGIGMAGGFLDTSAEEWDRVLDVNLWGVIHGCRLFGRQ-----MVERGTGGHIVNVASAAAYA-----------PS  459 (582)
T ss_pred             EEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCCEEEEECCHHHCC-----------CC
T ss_conf             998987589978032999999999988649999999999999-----99649980899967864577-----------89


Q ss_pred             CCCCCCCCCCCCCEEEECCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222223332210000001233---3222222222222233322222222222222222222222222233221133222
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGH---TYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVED  228 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~---~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D  228 (358)
T Consensus       460 p~~~aY~ASKaAV~gftesLr~ELa~~GI~V~aVcPG~I~T~I~~~a-~~~g~~~~~~~~~~~-~~~~~~~~~-~~~Pe~  536 (582)
T PRK05855        460 RSLPAYATSKAAVLMLSECLRAELAEAGIGVTAICPGFVDTNIVATT-RFAGADAEDEARRRK-RADKLYARR-GYGPEK  536 (582)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCC-CCCCCCHHHHHHHHH-HHHHHHHCC-CCCHHH
T ss_conf             88646899999999999999998530297799993184646755556-647876025677888-776665405-999999


Q ss_pred             CCCCEEECCCCCCC
Q ss_conf             20000000122222
Q gi|254780920|r  229 HVRALYLVLKKGRI  242 (358)
Q Consensus       229 ~a~~i~~~~~~~~~  242 (358)
T Consensus       537 vA~~Il~aV~rnr~  550 (582)
T PRK05855        537 VAKAIVSAVKRNKA  550 (582)
T ss_pred             HHHHHHHHHHCCCC
T ss_conf             99999999855998