HHsearch alignment for GI: 254780920 and conserved domain: PRK05993

>PRK05993 short chain dehydrogenase; Provisional.
Probab=99.49  E-value=9.4e-14  Score=103.37  Aligned_cols=162  Identities=18%  Similarity=0.122  Sum_probs=115.6

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH------CCCCE
Q ss_conf             899767882779999999986898799994788765856777620379749997638899999999862------27871
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKE------FQPDA   76 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~------~~~d~   76 (358)
T Consensus         7 vlITGassGIG~alA~~la~~-G~~V~~~~R~-----~~~l~~l-~~~~~~~~~~Dv~d~~~v~~~v~~~~~~~~g~id~   79 (277)
T PRK05993          7 ILITGCSSGIGAYCAHALQKR-GWRVFATCRK-----PEDIAAL-EAEGLEAFYLDYAEPESIAALVAQVLELSGGKLDA   79 (277)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECC-----HHHHHHH-HHCCCEEEEEECCCHHHHHHHHHHHHHHHCCCEEE
T ss_conf             999256869999999999987-9999999799-----9999999-84898199972667799999999999980897069


Q ss_pred             EEEECCCCCCCCCC----CCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             78512343322222----22222222222222024788865123221124784278630554311222222222222222
Q gi|254780920|r   77 IVNFAAESHVDRSI----LGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYN  152 (358)
Q Consensus        77 ViHlAa~~~~~~~~----~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~  152 (358)
T Consensus        80 lvNnAg~~~~g~~e~~~~~~~~~~~~vN~~g~~~~~~~~lP~-----m~~~~~G~IVnisSi~g~~-----------~~p  143 (277)
T PRK05993         80 LFNNGAYGQPGAVEDLPVEALRAQFEANFFGWHDLTRRIIPV-----MRKQGHGRIVQCSSILGLV-----------PMK  143 (277)
T ss_pred             EEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----HCCCCCCEEEEECCHHHCC-----------CCC
T ss_conf             996664356770888679999999887018999999997233-----1348983899988844488-----------899


Q ss_pred             CCCCCCCCCCCCEEEECCCCC---CCCCCCCCCCCCCC
Q ss_conf             222223332210000001233---32222222222222
Q gi|254780920|r  153 PSSPYSATKASSDYLVLAWGH---TYGIPVLLSNCSNN  187 (358)
Q Consensus       153 p~s~Yg~sK~~~E~~~~~~~~---~~~l~~~ilR~~~v  187 (358)
T Consensus       144 ~~~~Y~aSK~Av~~~~~sLr~El~~~gI~V~~i~PG~v  181 (277)
T PRK05993        144 YRGAYNASKFAIEGLSDTLRMELQGSGIHVSLIEPGPI  181 (277)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCC
T ss_conf             98389999999999999999985632868999964888