HHsearch alignment for GI: 254780920 and conserved domain: PRK06200

>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional.
Probab=99.43  E-value=3.1e-13  Score=100.24  Aligned_cols=219  Identities=18%  Similarity=0.137  Sum_probs=133.2

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH-----CCCCEE
Q ss_conf             899767882779999999986898799994788765856777620379749997638899999999862-----278717
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKE-----FQPDAI   77 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~-----~~~d~V   77 (358)
T Consensus         9 alVTGas~GIG~aia~~l~~~-Ga~V~~~~r~~~--~l~~~~~-~~~~~~~~~~~Dv~~~~~~~~~~~~~~~~~G~iDiL   84 (263)
T PRK06200          9 ALITGGGSGIGRALVERFLAE-GARVAVLERSAE--KCASLRQ-RFGDDVLVVEGDVTSYADNQRAVAQTVDRFGKLDCF   84 (263)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHH--HHHHHHH-HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             999586679999999999987-999999979999--9999999-818864687179999999999999999984998889


Q ss_pred             EEECCCCCCCCCCC--C-------CCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCC-CCCCCCCCCCC
Q ss_conf             85123433222222--2-------22222222222202478886512322112478427863055431-12222222222
Q gi|254780920|r   78 VNFAAESHVDRSIL--G-------ADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEV-YGSLDKGLFSE  147 (358)
Q Consensus        78 iHlAa~~~~~~~~~--~-------p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~v-Yg~~~~~~~~E  147 (358)
T Consensus        85 VnnAG~~~~~~~~~~~~~~~~~~~~~~~~~vN~~~~~~~~~~~~p~m------~~~~g~iI~~~S~~~~~~~--------  150 (263)
T PRK06200         85 VGNAGIWDYYTSLVDIPAETLDTAFDEIFRVNVKGYLLGAKAALPAL------KASGGSIIFTLSNSSFYPG--------  150 (263)
T ss_pred             EECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------HHCCCEEEEECCHHHCCCC--------
T ss_conf             97575467777603399789999999999998799999999998988------6079779998220212588--------


Q ss_pred             CCCCCCCCCCCCCCCCCEEEECCCCCCCC--CCCCCCCCCCCCCCCCCCCC---------CCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222222223332210000001233322--22222222222333222222---------22222222222222222222
Q gi|254780920|r  148 DMPYNPSSPYSATKASSDYLVLAWGHTYG--IPVLLSNCSNNYGPYHFPEK---------LIPLAITRMIEGSHVFLYGD  216 (358)
Q Consensus       148 ~~~~~p~s~Yg~sK~~~E~~~~~~~~~~~--l~~~ilR~~~vyGp~~~~~~---------~i~~~i~~~~~g~~~~i~g~  216 (358)
T Consensus       151 ----~~~~~Y~asKaal~~ltr~lA~ela~~IrVN~I~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P------  220 (263)
T PRK06200        151 ----GGGPLYTASKHAVVGLVRQLAYELAPKIRVNGVAPGGTVTDLRGPASLGQGETSISDVPGLADMIAAITP------  220 (263)
T ss_pred             ----CCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCHHHHHHCCCHHHHHHHHHCCC------
T ss_conf             ----9856789999999999999999977998899996288988864421121466542046889999971799------


Q ss_pred             CCCCCCCCCCCCCCCCEEECCC-C---CCCCCCCCCCCCC
Q ss_conf             2332211332222000000012-2---2222211135786
Q gi|254780920|r  217 GQNVRDWLYVEDHVRALYLVLK-K---GRIGERYNIGGNN  252 (358)
Q Consensus       217 g~~~Rdfi~v~D~a~~i~~~~~-~---~~~~~~fNigs~~  252 (358)
T Consensus       221 ---l~R~g~p~dia~~v~fL~Sd~~s~~iTG~~i~vDGG~  257 (263)
T PRK06200        221 ---LQFAPQPEDHTGPYVLLASRRNSRALTGVVINADGGL  257 (263)
T ss_pred             ---CCCCCCHHHHHHHHHHHCCCCCCCCEECCEEEECCCH
T ss_conf             ---8998399999999999808532368458678889362