HHsearch alignment for GI: 254780920 and conserved domain: PRK07024

>PRK07024 short chain dehydrogenase; Provisional.
Probab=99.53  E-value=3e-14  Score=106.37  Aligned_cols=200  Identities=17%  Similarity=0.140  Sum_probs=131.3

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH----C-CCCE
Q ss_conf             4899767882779999999986898799994788765856777620379749997638899999999862----2-7871
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKE----F-QPDA   76 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~----~-~~d~   76 (358)
T Consensus         4 ~VlITGassGIG~a~A~~la~~-G~~v~l~~R~~~--~L~~~~~~~~~~~~~~~~~Dv~d~~~~~~~~~~~~~~~g~iDi   80 (256)
T PRK07024          4 KVFITGASSGIGQALAREYARQ-GATLGLVARRTD--ALQAFAARLPKARVSVYAADVRDADALAAAAADFIAAHGCPDV   80 (256)
T ss_pred             EEEEECCCHHHHHHHHHHHHHC-CCEEEEEECCHH--HHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             8999846029999999999988-998999989889--9999999767997699981179999999999999998399879


Q ss_pred             EEEECCCCCCCCCC--CCC---CCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCC-CCCCCCCCCCCCC
Q ss_conf             78512343322222--222---22222222222024788865123221124784278630554311-2222222222222
Q gi|254780920|r   77 IVNFAAESHVDRSI--LGA---DEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVY-GSLDKGLFSEDMP  150 (358)
Q Consensus        77 ViHlAa~~~~~~~~--~~p---~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vY-g~~~~~~~~E~~~  150 (358)
T Consensus        81 linNAGi~~~~~~~~~~d~~~~~~~~~vN~~g~~~~~~~~lp~-----m~~~~~G~Iv~isS~ag~~g~-----------  144 (256)
T PRK07024         81 VIANAGISVGTLTGEGEDLAVFREVMDTNYYGMVATFEPFIAP-----MRAARRGTLVGIASVAGVRGL-----------  144 (256)
T ss_pred             EEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHCCCCCEEEEECCHHHCCCC-----------
T ss_conf             9988855678864453789999999999999999999987687-----502689349984354541689-----------


Q ss_pred             CCCCCCCCCCCCCCEEEECCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222223332210000001233---322222222222223332222222222222222222222222223322113322
Q gi|254780920|r  151 YNPSSPYSATKASSDYLVLAWGH---TYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVE  227 (358)
Q Consensus       151 ~~p~s~Yg~sK~~~E~~~~~~~~---~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~  227 (358)
T Consensus       145 -p~~~~Y~ASKaal~~~~esL~~el~~~gI~V~~i~PG~v~T~----------m~----~~~~~~~p-------~~~~pe  202 (256)
T PRK07024        145 -PGAGAYSASKAAAIKYLESLRVELRPAGVRVVTIAPGYIRTP----------MT----AHNPYPMP-------FLMDAD  202 (256)
T ss_pred             -CCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCC----------CC----CCCCCCCC-------CCCCHH
T ss_conf             -997079999999999999999986577948999971899588----------77----77999998-------768999


Q ss_pred             CCCCCEEECCCCCCC
Q ss_conf             220000000122222
Q gi|254780920|r  228 DHVRALYLVLKKGRI  242 (358)
Q Consensus       228 D~a~~i~~~~~~~~~  242 (358)
T Consensus       203 ~vA~~i~~ai~~~~~  217 (256)
T PRK07024        203 RFAARAARAIARGRS  217 (256)
T ss_pred             HHHHHHHHHHHCCCC
T ss_conf             999999999975998