HHsearch alignment for GI: 254780920 and conserved domain: PRK07035

>PRK07035 short chain dehydrogenase; Provisional.
Probab=99.52  E-value=1.3e-14  Score=108.69  Aligned_cols=220  Identities=19%  Similarity=0.206  Sum_probs=139.2

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHH-HHH-HCCCCEEEEECCCCCHHHHHHHHHHC-----CC
Q ss_conf             489976788277999999998689879999478876585677-762-03797499976388999999998622-----78
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSL-KEI-SQSNLFSFLQVDICDRECIRSALKEF-----QP   74 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~-~~~-~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~   74 (358)
T Consensus        10 valITGas~GIG~aia~~la~~-Ga~V~i~~r~~~--~l~~~~~~i~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~~G~i   86 (252)
T PRK07035         10 IALVTGASRGIGEAIAKLLAQQ-GAHVIVSSRKLD--GCQAVADAIVAAGGKAEALACHIGEMEQIDALFAQIRERHGRL   86 (252)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHH--HHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC
T ss_conf             8999588749999999999987-998999979889--9999999999649957999824899999999999999982997


Q ss_pred             CEEEEECCCCCC--C---CCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             717851234332--2---22222222222222222024788865123221124784278630554311222222222222
Q gi|254780920|r   75 DAIVNFAAESHV--D---RSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDM  149 (358)
Q Consensus        75 d~ViHlAa~~~~--~---~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~  149 (358)
T Consensus        87 DilVnnAg~~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~-----m~~~~~G~IvnisS~~~~~-----------  150 (252)
T PRK07035         87 DILVNNAAANPYFGHILDTDLGAFQKTVDVNIRGYFFMSVEAGKL-----MKEQGGGSIVNVASVNGVS-----------  150 (252)
T ss_pred             CEEEECCCCCCCCCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHH-----HHHCCCCEEEEECCHHHCC-----------
T ss_conf             789876855888888200999999999998712431000453699-----9966997499972544368-----------


Q ss_pred             CCCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222233322100000012333---222222222222233322222222--22222222222222222223322113
Q gi|254780920|r  150 PYNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLI--PLAITRMIEGSHVFLYGDGQNVRDWL  224 (358)
Q Consensus       150 ~~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i--~~~i~~~~~g~~~~i~g~g~~~Rdfi  224 (358)
T Consensus       151 ~~~~~~~Y~asKaal~~ltr~lA~ela~~gIrVN~V~PG~i~T~~~~--~~~~~~~~~~~~~~~~P---------l~R~g  219 (252)
T PRK07035        151 PGDFQGIYSITKAAVISMTKAFAKECAPFGIRVNALLPGLTDTKFAS--ALFKNDAILKQALAHIP---------LRRHA  219 (252)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCHHHH--CCCCCHHHHHHHHHCCC---------CCCCC
T ss_conf             89874889999999999999999986032959999962878874243--02489999999985699---------99982


Q ss_pred             CCCCCCCCEEECCCC---CCCCCCCCCCCC
Q ss_conf             322220000000122---222221113578
Q gi|254780920|r  225 YVEDHVRALYLVLKK---GRIGERYNIGGN  251 (358)
Q Consensus       225 ~v~D~a~~i~~~~~~---~~~~~~fNigs~  251 (358)
T Consensus       220 ~pedia~~v~fL~S~~a~~iTG~~i~VDGG  249 (252)
T PRK07035        220 EPSEMAGAVLYLVSDASSYTTGECLNVDGG  249 (252)
T ss_pred             CHHHHHHHHHHHHCCHHCCCCCCEEEECCC
T ss_conf             999999999999685422936864886949