HHsearch alignment for GI: 254780920 and conserved domain: PRK07062

>PRK07062 short chain dehydrogenase; Provisional.
Probab=99.41  E-value=2.8e-13  Score=100.44  Aligned_cols=226  Identities=13%  Similarity=0.048  Sum_probs=143.5

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH---CCCCEEEEECCCCCHHHHHHHHHH-----CC
Q ss_conf             4899767882779999999986898799994788765856777620---379749997638899999999862-----27
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS---QSNLFSFLQVDICDRECIRSALKE-----FQ   73 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~---~~~~v~~i~~Di~d~~~l~~~~~~-----~~   73 (358)
T Consensus        10 ~alITG~s~GIG~a~a~~la~~-Ga~Vvi~~r~~~~l-~~~~~~l~~~~~~~~~~~~~~Dvt~~~~v~~~v~~~~~~~G~   87 (265)
T PRK07062         10 VAVVTGGSSGIGLATVELLLEA-GASVAICGRDEERL-ASAEARLREKFPGARLLAARCDVLDEADVAAFAAAVEARFGG   87 (265)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHHH-HHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHHCC
T ss_conf             8999575779999999999987-99999997988999-999999987369965999975799999999999999998399


Q ss_pred             CCEEEEECCCCCCC----CCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             87178512343322----22222222222222222024788865123221124784278630554311222222222222
Q gi|254780920|r   74 PDAIVNFAAESHVD----RSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDM  149 (358)
Q Consensus        74 ~d~ViHlAa~~~~~----~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~  149 (358)
T Consensus        88 iDiLVnNAg~~~~~~~~~~~~e~w~~~~~~nl~~~~~~~~~~~p~m-----~~~~~G~IInisS~~~~~-----------  151 (265)
T PRK07062         88 VDMLVNNAGQGRVSTFADTTDDAWRDELELKYFSVIRPTRAFLPLL-----RASAAPSITCVNSLLALQ-----------  151 (265)
T ss_pred             CCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHCCCCEEEEEECHHHCC-----------
T ss_conf             8889977888898884879999999999872145899999999999-----962996299993442357-----------


Q ss_pred             CCCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCC----------CCCCCCCCCCCCCCCCC
Q ss_conf             2222222233322100000012333---2222222222222333222222222----------22222222222222222
Q gi|254780920|r  150 PYNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIP----------LAITRMIEGSHVFLYGD  216 (358)
Q Consensus       150 ~~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~----------~~i~~~~~g~~~~i~g~  216 (358)
T Consensus       152 ~~~~~~~Y~asKaal~~ltk~lA~ela~~gIrVN~V~PG~i~T~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~iP----  225 (265)
T PRK07062        152 PEPHMVATSAARAGLLNLVKSLATELAPEGVRVNSILLGLVESGQWR--RRYEARADPGLSWEAWTAALARKKGIP----  225 (265)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCHHH--HHHHHHCCCCCCHHHHHHHHHHHCCCC----
T ss_conf             89996899999999999999999997664939998960858772454--331320254557899999988746999----


Q ss_pred             CCCCCCCCCCCCCCCCEEECCCC---CCCCCCCCCCCCCCC
Q ss_conf             23322113322220000000122---222221113578642
Q gi|254780920|r  217 GQNVRDWLYVEDHVRALYLVLKK---GRIGERYNIGGNNER  254 (358)
Q Consensus       217 g~~~Rdfi~v~D~a~~i~~~~~~---~~~~~~fNigs~~~~  254 (358)
T Consensus       226 ---l~R~g~peevA~~v~fLaS~~s~~iTG~~i~VDGG~s~  263 (265)
T PRK07062        226 ---LGRFGRPDEAARALFFLASPLSSYTTGSHIDVSGGFAR  263 (265)
T ss_pred             ---CCCCCCHHHHHHHHHHHHCCHHCCCCCCEEEECCCCCC
T ss_conf             ---88976899999999999687325735842798978036