HHsearch alignment for GI: 254780920 and conserved domain: PRK07201

>PRK07201 short chain dehydrogenase; Provisional.
Probab=99.41  E-value=4.6e-13  Score=99.13  Aligned_cols=198  Identities=20%  Similarity=0.173  Sum_probs=128.9

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHH-HHH-CCCCEEEEECCCCCHHHHHHHHHH----C-CCC
Q ss_conf             899767882779999999986898799994788765856777-620-379749997638899999999862----2-787
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLK-EIS-QSNLFSFLQVDICDRECIRSALKE----F-QPD   75 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~-~~~-~~~~v~~i~~Di~d~~~l~~~~~~----~-~~d   75 (358)
T Consensus       379 alITGASSGIG~A~A~~LA~~-GA~Vvl~AR~~e~--Le~v~~ei~~~Gg~a~~~~~DVtd~~~v~~lv~~i~~~~G~ID  455 (663)
T PRK07201        379 VIITGASSGIGRATAIKVAEA-GATVFALARDGEK--LDELVAEIRARGGQAHAYTCDLTDSASVEHTVKDILGRHGHVD  455 (663)
T ss_pred             EEECCCCCHHHHHHHHHHHHC-CCEEEEEECCHHH--HHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCC
T ss_conf             999388759999999999987-9989999899999--9999999995599189999627999999999999999679988


Q ss_pred             EEEEECCCCCCCC---C---CCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             1785123433222---2---222222222222222024788865123221124784278630554311222222222222
Q gi|254780920|r   76 AIVNFAAESHVDR---S---ILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDM  149 (358)
Q Consensus        76 ~ViHlAa~~~~~~---~---~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~  149 (358)
T Consensus       456 VLVNNAG~si~~~~~~~~d~~~d~er~m~vN~~G~v~l~~a~lP~-----M~~r~~G~IVNISSiag~~~~P--------  522 (663)
T PRK07201        456 YLVNNAGRSIRRSVVNSTDRFHDYERTMQLNYFGAVRLVLGLLPH-----MRERRFGHVVNISSIGVQTNAP--------  522 (663)
T ss_pred             EEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCEEEEEECCHHHCCCCC--------
T ss_conf             899896446757501134549999999999749999999999998-----8853993999975565477899--------


Q ss_pred             CCCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222233322100000012333---2222222222222333222222222222222222222222222332211332
Q gi|254780920|r  150 PYNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYV  226 (358)
Q Consensus       150 ~~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v  226 (358)
T Consensus       523 ---~~saYsASKaAl~aftr~La~Ela~~GVrVttI~PG~V~TpM-----iapt-----------~~y~~----~p~l~p  579 (663)
T PRK07201        523 ---RFSAYVASKAALDAFARVAASETLSDGITFTNIHMPLVRTPM-----IAPT-----------KRYNP----VPTLSP  579 (663)
T ss_pred             ---CCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCC-----CCCC-----------CCCCC----CCCCCH
T ss_conf             ---864999999999999999999837578289997159717887-----7875-----------22278----998999


Q ss_pred             CCCCCCEEECCCC
Q ss_conf             2220000000122
Q gi|254780920|r  227 EDHVRALYLVLKK  239 (358)
Q Consensus       227 ~D~a~~i~~~~~~  239 (358)
T Consensus       580 e~aA~~i~~a~~~  592 (663)
T PRK07201        580 EEAADMVARALVE  592 (663)
T ss_pred             HHHHHHHHHHHHC
T ss_conf             9999999999851