HHsearch alignment for GI: 254780920 and conserved domain: PRK07417

>PRK07417 arogenate dehydrogenase; Reviewed.
Probab=95.75  E-value=0.033  Score=32.75  Aligned_cols=32  Identities=28%  Similarity=0.381  Sum_probs=28.2

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECC
Q ss_conf             9489976788277999999998689879999478
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKL   34 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~   34 (358)
T Consensus         2 mkI~Ii-GlGLIGgSla~al~-~~~~~V~g~d~~   33 (280)
T PRK07417          2 MNIGIV-GLGLIGGSLGLDLR-SLGHTVYGVSRR   33 (280)
T ss_pred             CEEEEE-ECCHHHHHHHHHHH-HCCCEEEEEECC
T ss_conf             789999-31857999999999-689979999799