HHsearch alignment for GI: 254780920 and conserved domain: PRK07774

>PRK07774 short chain dehydrogenase; Provisional.
Probab=99.55  E-value=5.8e-15  Score=110.78  Aligned_cols=220  Identities=21%  Similarity=0.171  Sum_probs=144.4

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH-CCCCEEEEECCCCCHHHHHHHHHH-----CCCC
Q ss_conf             4899767882779999999986898799994788765856777620-379749997638899999999862-----2787
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS-QSNLFSFLQVDICDRECIRSALKE-----FQPD   75 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~-~~~~v~~i~~Di~d~~~l~~~~~~-----~~~d   75 (358)
T Consensus         8 ~alVTGgs~GiG~aia~~la~~-Ga~V~i~~~~~-~~~~~~~~~i~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~fG~iD   85 (250)
T PRK07774          8 VAIVTGAAGGIGQAYAEALARE-GASVVVADINA-EGAERVAKQIVADGGTAIAVQVDVSDPDSAKAMADRTVSAFGGID   85 (250)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCH-HHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             8999797688999999999986-99999997988-999999999985598499998258999999999999999839998


Q ss_pred             EEEEECCCCCC-------CCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCC
Q ss_conf             17851234332-------22222222222222222202478886512322112478427863055431122222222222
Q gi|254780920|r   76 AIVNFAAESHV-------DRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSED  148 (358)
Q Consensus        76 ~ViHlAa~~~~-------~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~  148 (358)
T Consensus        86 ilVNnAg~~~~~~~~~~~~~~~~~w~~~~~vNl~~~f~~~~~~~~~-----m~~~~~G~IIn~sS~~~~-----------  149 (250)
T PRK07774         86 YLVNNAAIYGGMKLDLLITVPWDYYKKFMSVNLDGALVCTRAVYKH-----MAKRGGGAIVNQSSTAAW-----------  149 (250)
T ss_pred             EEEECCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEEECCCCCC-----------
T ss_conf             9998884357899974212999999999999889999999999999-----998299589997750045-----------


Q ss_pred             CCCCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222222233322100000012333---2222222222222333222222222-2222222222222222223322113
Q gi|254780920|r  149 MPYNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIP-LAITRMIEGSHVFLYGDGQNVRDWL  224 (358)
Q Consensus       149 ~~~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~-~~i~~~~~g~~~~i~g~g~~~Rdfi  224 (358)
T Consensus       150 ---~~~~~Y~asKaal~~ltk~lA~el~~~gIrVN~V~PG~i~t~~~~--~~~~~~~~~~~~~~~Pl---------~R~g  215 (250)
T PRK07774        150 ---LYSNFYGLAKVGINGLTQQLARELGGMNIRVNAIAPGPIDTEATR--TVTPKEFVADMVKGIPL---------SRMG  215 (250)
T ss_pred             ---CCCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCC--CCCCHHHHHHHHHCCCC---------CCCC
T ss_conf             ---785389999999999999999997064948999973878772200--14979999999857998---------8985


Q ss_pred             CCCCCCCCEEECCCC---CCCCCCCCCCCCCC
Q ss_conf             322220000000122---22222111357864
Q gi|254780920|r  225 YVEDHVRALYLVLKK---GRIGERYNIGGNNE  253 (358)
Q Consensus       225 ~v~D~a~~i~~~~~~---~~~~~~fNigs~~~  253 (358)
T Consensus       216 ~pedia~~v~fL~S~~s~~iTGq~i~VDGG~~  247 (250)
T PRK07774        216 TPEDLVGMCLFLLSDAASWITGQIFNVDGGQI  247 (250)
T ss_pred             CHHHHHHHHHHHHCCHHCCCCCCEEEECCCCC
T ss_conf             99999999999948242686498399788812