HHsearch alignment for GI: 254780920 and conserved domain: PRK08063

>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional.
Probab=99.53  E-value=9.8e-15  Score=109.38  Aligned_cols=225  Identities=15%  Similarity=0.062  Sum_probs=143.6

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH-CCCCEEEEECCCCCHHHHHHHHHH-----CCCCE
Q ss_conf             899767882779999999986898799994788765856777620-379749997638899999999862-----27871
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS-QSNLFSFLQVDICDRECIRSALKE-----FQPDA   76 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~-~~~~v~~i~~Di~d~~~l~~~~~~-----~~~d~   76 (358)
T Consensus         7 alVTGas~GIG~aia~~la~~-Ga~Vvi~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~G~iDi   85 (250)
T PRK08063          7 ALVTGSSRGIGKAIALRLAKE-GYDIAINYARSRKAAEETANEIEQLGRKALVVKANVGDVEKIKEMFSQIDEHFGRLDV   85 (250)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCE
T ss_conf             999587669999999999988-9989997599989999999999954995899984799999999999999998099889


Q ss_pred             EEEECCCCCCC----CCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             78512343322----22222222222222222024788865123221124784278630554311222222222222222
Q gi|254780920|r   77 IVNFAAESHVD----RSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYN  152 (358)
Q Consensus        77 ViHlAa~~~~~----~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~  152 (358)
T Consensus        86 LVnnAg~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~-----m~~~~~G~IVnisS~~~~~~-----------~~  149 (250)
T PRK08063         86 FVNNAASGVLRPAMELEESHWDWTMNINAKALLFCAQEAAKL-----MEKNGGGKIISLSSLGSIRY-----------LE  149 (250)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCCCEEEEEHHHCCC-----------CC
T ss_conf             998785678899266999999999987403799999999999-----98638986158873310567-----------89


Q ss_pred             CCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222233322100000012333---2222222222222333222222222222222222222222222332211332222
Q gi|254780920|r  153 PSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDH  229 (358)
Q Consensus       153 p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~  229 (358)
T Consensus       150 ~~~~Y~asKaal~~ltk~lA~ela~~gIrVNaI~PG~i~T~~~~~~~~~~~~~~~~~~~~P~~R---------~g~pedi  220 (250)
T PRK08063        150 NYTTVGVSKAALEALTRYLAVELAPKGIAVNAVSGGAVDTDALKHFPNREELLEDAQANTPAGR---------MVEPEDL  220 (250)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCCCCCHHHHCCCCCHHHHHHHHHCCCCCC---------CCCHHHH
T ss_conf             9604587899999999999999725392899986087987677617984999999986799999---------8699999


Q ss_pred             CCCEEECCCC---CCCCCCCCCCCCCC
Q ss_conf             0000000122---22222111357864
Q gi|254780920|r  230 VRALYLVLKK---GRIGERYNIGGNNE  253 (358)
Q Consensus       230 a~~i~~~~~~---~~~~~~fNigs~~~  253 (358)
T Consensus       221 a~~v~fL~S~~s~~iTG~~i~VDGG~s  247 (250)
T PRK08063        221 VNAVLFLCSPKADMIRGQTIIVDGGRS  247 (250)
T ss_pred             HHHHHHHHCCHHCCCCCCEEEECCCHH
T ss_conf             999999937453482287088594878