HHsearch alignment for GI: 254780920 and conserved domain: PRK08264

>PRK08264 short chain dehydrogenase; Validated.
Probab=99.43  E-value=2.6e-13  Score=100.62  Aligned_cols=160  Identities=18%  Similarity=0.133  Sum_probs=112.9

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCE-EEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC-CCCEEEEE
Q ss_conf             8997678827799999999868987-999947887658567776203797499976388999999998622-78717851
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQ-VLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEF-QPDAIVNF   80 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~-V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~-~~d~ViHl   80 (358)
T Consensus         8 alITGassGIG~aiA~~la~~-Ga~~V~~~~r-~----~~----~~~~~~~~~~~~Dv~d~~~v~~~~~~~~~idvlVnN   77 (235)
T PRK08264          8 VLVTGANRGIGRAFVEELLAR-GAAKVYAAAR-D----PE----SVDLPRVVPLQLDVTDPASVAAAAEQASDVTILINN   77 (235)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCCEEEEECC-C----HH----HCCCCCEEEEEECCCCHHHHHHHHHHCCCCCEEEEC
T ss_conf             999267549999999999986-9977999727-8----40----355598799980689999999999973998699988


Q ss_pred             CCCCCCCCC-----CCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             234332222-----222222222222222024788865123221124784278630554311222222222222222222
Q gi|254780920|r   81 AAESHVDRS-----ILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSS  155 (358)
Q Consensus        81 Aa~~~~~~~-----~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~s  155 (358)
T Consensus        78 AGi~~~~~~~~~~~~~~~~~~~~vNl~g~~~l~~~~~p~-----m~~~~~G~IvnisS~~g~~-----------~~p~~~  141 (235)
T PRK08264         78 AGISRPGSLLAEGDLDALRAEMETNVFGPLRMARAFAPV-----LAANGGGAIVNVLSVLSWV-----------NFPNLG  141 (235)
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEEEECHHHCC-----------CCCCCH
T ss_conf             855778986455999999999999729999999872699-----9857998599992754448-----------999976


Q ss_pred             CCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCC
Q ss_conf             2233322100000012333---22222222222223
Q gi|254780920|r  156 PYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNY  188 (358)
Q Consensus       156 ~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vy  188 (358)
T Consensus       142 ~Y~aSKaal~~~~~~La~El~~~gI~V~~i~PG~v~  177 (235)
T PRK08264        142 AYSASKAAAWSLTQALREELAPQGTRVLGVHPGYID  177 (235)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEECCCC
T ss_conf             799999999999999999850329389999728999