HHsearch alignment for GI: 254780920 and conserved domain: PRK08589

>PRK08589 short chain dehydrogenase; Validated.
Probab=99.31  E-value=4.4e-12  Score=93.16  Aligned_cols=222  Identities=18%  Similarity=0.150  Sum_probs=138.5

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             89976788277999999998689879999478876585677762-03797499976388999999998622-----7871
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEI-SQSNLFSFLQVDICDRECIRSALKEF-----QPDA   76 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~-~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d~   76 (358)
T Consensus         9 alVTGas~GIG~aiA~~la~~-Ga~Vv~~d~~~~--~~~~~~~i~~~g~~~~~~~~Dvsd~~~v~~~v~~~~~~~G~iDi   85 (272)
T PRK08589          9 AVITGASTGIGQASAIALAQE-GAYVLAVDIAEA--VSETVDKIKSNGGKAKAYHVDISDEQQVKDFASDIKEQFGHIDV   85 (272)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHH--HHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             999782569999999999986-999999838278--99999999955994899996079999999999999998299878


Q ss_pred             EEEECCCCCCCC-----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             785123433222-----222222222222222202478886512322112478427863055431122222222222222
Q gi|254780920|r   77 IVNFAAESHVDR-----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPY  151 (358)
Q Consensus        77 ViHlAa~~~~~~-----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~  151 (358)
T Consensus        86 LVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~f~~~~~~~p~m-----~~~g-G~IVnisS~~g~~~-----------~  148 (272)
T PRK08589         86 LFNNAGVDNAAGRIHEYPVDVFDKIMAVDMRGTFLMTKMLLPLM-----MEQG-GSIINTSSFSGQAA-----------D  148 (272)
T ss_pred             EEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHCC-CEEEEEECHHHCCC-----------C
T ss_conf             99898667888871009999999999998299999999999999-----9759-90799912343677-----------8


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222333221000000123332---22222222222233322222222222----22222222222222223322113
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIPLA----ITRMIEGSHVFLYGDGQNVRDWL  224 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~~~----i~~~~~g~~~~i~g~g~~~Rdfi  224 (358)
T Consensus       149 ~~~~~Y~asKaal~~lTr~lA~E~a~~gIrVNaVaPG~i~T~~~~--~~~~~~~~~~~~~~~~~~~~-~----~PlgR~g  221 (272)
T PRK08589        149 LYRSGYNAAKGAVINFTKSIAIEYGRDGIRANAIAPGTIETPLVD--KLTGTSEDEAGKTFRENQKW-M----TPLGRLG  221 (272)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCHHHH--HHCCCCHHHHHHHHHHHHHC-C----CCCCCCC
T ss_conf             986689999999999999999997225939999964889864576--65347747889999987544-7----8978977


Q ss_pred             CCCCCCCCEEECCCC---CCCCCCCCCCCC
Q ss_conf             322220000000122---222221113578
Q gi|254780920|r  225 YVEDHVRALYLVLKK---GRIGERYNIGGN  251 (358)
Q Consensus       225 ~v~D~a~~i~~~~~~---~~~~~~fNigs~  251 (358)
T Consensus       222 ~peeiA~~v~FLaSd~asyiTG~~i~VDGG  251 (272)
T PRK08589        222 KPEEVAKLVVFLASDDSSFITGETIRIDGG  251 (272)
T ss_pred             CHHHHHHHHHHHHCCHHCCCCCCEEEECCC
T ss_conf             899999999998185217836854898908