HHsearch alignment for GI: 254780920 and conserved domain: PRK08664

>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed.
Probab=96.13  E-value=0.0091  Score=36.20  Aligned_cols=32  Identities=22%  Similarity=0.458  Sum_probs=26.8

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             94899767882779999999986898799994
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLKIQVLVID   32 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~~~V~~~d   32 (358)
T Consensus         4 ikvaIvGatGy~G~ELirlL~~HP~~ei~~l~   35 (350)
T PRK08664          4 LKVGVLGATGLVGQRFVQLLANHPWFEVTALA   35 (350)
T ss_pred             CEEEEECCCCHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             77999898429999999999709996689999