HHsearch alignment for GI: 254780920 and conserved domain: PRK08690

>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional.
Probab=99.13  E-value=9.2e-11  Score=85.09  Aligned_cols=224  Identities=9%  Similarity=0.011  Sum_probs=128.4

Q ss_pred             EEEEEC--CCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHC-CCCEEEEECCCCCHHHHHHHHHHC-----C
Q ss_conf             489976--78827799999999868987999947887658567776203-797499976388999999998622-----7
Q gi|254780920|r    2 RLIVTG--GAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQ-SNLFSFLQVDICDRECIRSALKEF-----Q   73 (358)
Q Consensus         2 kILItG--~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~-~~~v~~i~~Di~d~~~l~~~~~~~-----~   73 (358)
T Consensus         8 ~~lVTGa~~~~GIG~aia~~la~~-Ga~v~~~~~~~--~~~~~~~~~~~~~g~~~~~~~Dv~~~~~v~~~~~~~~~~~G~   84 (261)
T PRK08690          8 KILITGMISERSIAYGIAKACREQ-GAELAFTYVVD--KLEERVRKMAAELDSELVFRCDVASDDEINQVFADLGKHWDG   84 (261)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHC-CCEEEEECCCC--HHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHCC
T ss_conf             899989878638999999999985-99999973761--559999999987398089988999999999999999999689


Q ss_pred             CCEEEEECCCCCCCCCCCC---------CCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCC
Q ss_conf             8717851234332222222---------2222222222220247888651232211247842786305543112222222
Q gi|254780920|r   74 PDAIVNFAAESHVDRSILG---------ADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGL  144 (358)
Q Consensus        74 ~d~ViHlAa~~~~~~~~~~---------p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~  144 (358)
T Consensus        85 iD~LVnnaG~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~g~Ii~iss~~~~~~-----  153 (261)
T PRK08690         85 LDGLVHSIGFAPKEALSGDFLDSISREAFNTAHEISAYSLPALAKAARPM------MRGRNSAIVALSYLGAVRA-----  153 (261)
T ss_pred             CCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------HCCCCCCEEEEEEEEEECC-----
T ss_conf             87897525547633345424756159999999998767789999987687------6057841465433320015-----


Q ss_pred             CCCCCCCCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222222222233322100000012333---22222222222223332222222222222222222222222223322
Q gi|254780920|r  145 FSEDMPYNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVR  221 (358)
Q Consensus       145 ~~E~~~~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~R  221 (358)
T Consensus       154 ------~~~~~~y~~sKaal~~ltr~lA~el~~~gIRVN~I~PG~i~T~~~~~~~~~~~~~~~~~~~~Pl~---------  218 (261)
T PRK08690        154 ------IPNYNVMGMAKASLEAGIRFTAACLGKEGIRCNGISAGPIKTLAASGIADFGKLLGHVAAHNPLR---------  218 (261)
T ss_pred             ------CCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHCCCCHHHHHHHHHHCCCCC---------
T ss_conf             ------66310457889999999999999725896899898777885544424787699999998679989---------


Q ss_pred             CCCCCCCCCCCEEECCCC---CCCCCCCCCCCCCCC
Q ss_conf             113322220000000122---222221113578642
Q gi|254780920|r  222 DWLYVEDHVRALYLVLKK---GRIGERYNIGGNNER  254 (358)
Q Consensus       222 dfi~v~D~a~~i~~~~~~---~~~~~~fNigs~~~~  254 (358)
T Consensus       219 R~g~peeia~~v~FL~Sd~ss~iTG~~i~VDGG~ti  254 (261)
T PRK08690        219 RNVTIEEVGNTAAFLLSDLSSGITGEITYVDGGYSI  254 (261)
T ss_pred             CCCCHHHHHHHHHHHHCCHHCCCCCCEEEECCCCCC
T ss_conf             994999999999999385524705863997969301