HHsearch alignment for GI: 254780920 and conserved domain: PRK08862

>PRK08862 short chain dehydrogenase; Provisional.
Probab=98.94  E-value=1.5e-09  Score=77.75  Aligned_cols=167  Identities=14%  Similarity=0.122  Sum_probs=102.6

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHH----C-C-CC
Q ss_conf             89976788277999999998689879999478876585677762-0379749997638899999999862----2-7-87
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEI-SQSNLFSFLQVDICDRECIRSALKE----F-Q-PD   75 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~-~~~~~v~~i~~Di~d~~~l~~~~~~----~-~-~d   75 (358)
T Consensus         8 ~lITGas~GIG~aiA~~~A~~-Ga~Vii~~r~~~~l~-~~~~~i~~~g~~~~~~~~d~~~~~~v~~~~~~i~~~~g~~iD   85 (227)
T PRK08862          8 ILITSAGSVLGRTISCHFARL-GATLILCDQDQSALN-DTYEQCSALTDNVYSYQLKDFSQESIRHLFDAIEQQFNRAPD   85 (227)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHHHH-HHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             999798879999999999987-999999969999999-999999975897489995166199999999999999589974


Q ss_pred             EEEEECCCCCCCCC-CCCC----CCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             17851234332222-2222----222222222220247888651232211247842786305543112222222222222
Q gi|254780920|r   76 AIVNFAAESHVDRS-ILGA----DEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMP  150 (358)
Q Consensus        76 ~ViHlAa~~~~~~~-~~~p----~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~  150 (358)
T Consensus        86 vLVNNa~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~m~----~~~~~G~IINi~S~~~~-------------  148 (227)
T PRK08862         86 VLVNNWTSSPLPSLFDEQPSESFIQQLTSLASTLFTYGQVAAERMR----KRKKKGVIVNVISHDDH-------------  148 (227)
T ss_pred             EEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH----HCCCCEEEEEEEEECCC-------------
T ss_conf             9985664577886334588999999999865699999999999999----66998799999768766-------------


Q ss_pred             CCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCC
Q ss_conf             222222233322100000012333---222222222222233
Q gi|254780920|r  151 YNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYG  189 (358)
Q Consensus       151 ~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyG  189 (358)
T Consensus       149 -~~~~~y~asKaav~~lTkslA~Ela~~gIRVNaVaPG~i~T  189 (227)
T PRK08862        149 -QDLTGVESSTALVSGFTHSWAKELTPFNIRVGGVVPSIFNA  189 (227)
T ss_pred             -CCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCEECC
T ss_conf             -88278999999999999999999767498999994380887