HHsearch alignment for GI: 254780920 and conserved domain: PRK09009

>PRK09009 C factor cell-cell signaling protein; Provisional.
Probab=99.55  E-value=6.8e-15  Score=110.36  Aligned_cols=215  Identities=19%  Similarity=0.222  Sum_probs=130.8

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC-CCCEEEE
Q ss_conf             948997678827799999999868987999947887658567776203797499976388999999998622-7871785
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEF-QPDAIVN   79 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~-~~d~ViH   79 (358)
T Consensus         1 mnVLITGas~GIG~aia~~l~~~-~~~~~v~~~~~~~------~~~~~~~~v~~~~~Dvt~~~~i~~~~~~~~~iD~lin   73 (235)
T PRK09009          1 MNILIVGGSGGIGKAMVKQLLET-YPDATVHATYRHH------KPDFRHDNVQWHALDVTDEAEIKQLSEQFTQLDWLIN   73 (235)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHC-CCCEEEEEEECCC------CCCCCCCCEEEEECCCCCHHHHHHHHHHHCCCCEEEE
T ss_conf             97999755639999999999856-9980999973776------5444579838998747999999999987087789997


Q ss_pred             ECCCCCCC-----CCC--CCC---CCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             12343322-----222--222---22222222222024788865123221124784278630554311222222222222
Q gi|254780920|r   80 FAAESHVD-----RSI--LGA---DEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDM  149 (358)
Q Consensus        80 lAa~~~~~-----~~~--~~p---~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~  149 (358)
T Consensus        74 nAGi~~~~~~~~~~~~~~~~~~~~~~~~~vN~~~~~~~~~~~~p~-----l~~~~~~~iv~isS~~g--~i~-----~-~  140 (235)
T PRK09009         74 CVGMLHTQDKGPEKSLQSLDSDFFLQNITLNTLPSLLLAKHFTPL-----LKQSESARFAVISAKVG--SIS-----D-N  140 (235)
T ss_pred             CCCCCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHHCCCCCCEEEEEEC--CCC-----C-C
T ss_conf             675244677776468677899999999988619999999999999-----98607876401222341--577-----8-8


Q ss_pred             CCCCCCCCCCCCCCCEEEECCCCCCC-----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222222333221000000123332-----2222222222223332222222222222222222222222223322113
Q gi|254780920|r  150 PYNPSSPYSATKASSDYLVLAWGHTY-----GIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWL  224 (358)
Q Consensus       150 ~~~p~s~Yg~sK~~~E~~~~~~~~~~-----~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi  224 (358)
T Consensus       141 ~~~g~~~Y~aSKaAl~~lt~~la~E~~~~~~~i~V~~i~PG~v~T~----------m~~~~~~~~p~-------~--r~~  201 (235)
T PRK09009        141 RLGGWYSYRASKAALNMFLKTLSIEWQRSLKHGVVLALHPGTTDTP----------LSKPFQQNVPK-------G--KLF  201 (235)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCC----------CCCHHHHCCCC-------C--CCC
T ss_conf             8886236699999999999999999764269968999814865671----------23067857998-------8--882


Q ss_pred             CCCCCCCCEEECCCC---CCCCCCCCCCCCCCCC
Q ss_conf             322220000000122---2222211135786420
Q gi|254780920|r  225 YVEDHVRALYLVLKK---GRIGERYNIGGNNERK  255 (358)
Q Consensus       225 ~v~D~a~~i~~~~~~---~~~~~~fNigs~~~~s  255 (358)
T Consensus       202 ~PeeiA~~i~~L~s~~s~~~tG~~i~vd-G~~~p  234 (235)
T PRK09009        202 TPEYVAQCLLGIIANATPAQSGSFLAYD-GEELP  234 (235)
T ss_pred             CHHHHHHHHHHHHCCCCCCCCCCEEEEC-CCCCC
T ss_conf             9999999999997169723698889789-77876