HHsearch alignment for GI: 254780920 and conserved domain: PRK11908

>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional.
Probab=100.00  E-value=0  Score=486.49  Aligned_cols=317  Identities=19%  Similarity=0.282  Sum_probs=267.3

Q ss_pred             CE-EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCC-CHHHHHHHHHHCCCCEEE
Q ss_conf             94-8997678827799999999868987999947887658567776203797499976388-999999998622787178
Q gi|254780920|r    1 MR-LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC-DRECIRSALKEFQPDAIV   78 (358)
Q Consensus         1 Mk-ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~-d~~~l~~~~~~~~~d~Vi   78 (358)
T Consensus         1 MKkILVTGgaGFIGs~Lv~~Ll~~~~~~V~~~d~~~~-----~~~~~~~~~~~~~~~gDi~~~~~~~~~~~~--~~D~V~   73 (347)
T PRK11908          1 MKKVLILGVNGFIGHHLTKRILETTDWEVYGMDMQTD-----RLGDLVNHPRMHFFEGDITINKEWIEYHVK--KCDVVL   73 (347)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCC-----CHHHHCCCCCEEEEECCCCCCHHHHHHHHC--CCCEEE
T ss_conf             9889997574389999999999828978999979976-----367755799859997754469999997660--598897


Q ss_pred             EECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCC-------
Q ss_conf             5123433222222222222222222202478886512322112478427863055431122222222222222-------
Q gi|254780920|r   79 NFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPY-------  151 (358)
Q Consensus        79 HlAa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~-------  151 (358)
T Consensus        74 HlAa~~~~~~~~~~p~~~~~~nv~~t~~ll~~~~~~---------~-~r~if~SS~~VYG~~~~~~~~~~~~~~~~~p~~  143 (347)
T PRK11908         74 PLVAIATPATYVKQPLRVFELDFEANLPIVRSAVKY---------G-KHLVFPSTSEVYGMCSDEEFDPEASALTYGPIN  143 (347)
T ss_pred             EEHHCCCHHHHHHCHHHHHHHHHHHHHHHHHHHHHH---------C-CEEEECCCCEEECCCCCCCCCCCCCCCCCCCCC
T ss_conf             520003648888688999999999999999999973---------9-838962661265478999989777876578877


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCC--------CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222233322100000012333222222222222233322--------2222222222222222222222222332211
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYH--------FPEKLIPLAITRMIEGSHVFLYGDGQNVRDW  223 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~--------~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdf  223 (358)
T Consensus       144 ~p~~~Y~~sK~~~E~l~~~y~~~~~l~~~ilR~~nvyGP~~~~~~~~~~~~~~vi~~~i~~~~~g~~i~i~g~G~~~Rdf  223 (347)
T PRK11908        144 KPRWIYACSKQLMDRVIWAYGMEEGLNFTLFRPFNWIGPGLDSIYTPKEGSSRVVTQFLGHIVRGEPISLVDGGSQKRAF  223 (347)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCEECCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECC
T ss_conf             86547789999999999999998589879997666766996655685446320279999999838984035999710367


Q ss_pred             CCCCCCCCCEEECCCCC---CCCCCCCCCC-CCCCCHHHHHHHHHHHHCCCCCCCCCCCCCEEEC--------CCCCCCC
Q ss_conf             33222200000001222---2222111357-8642026889999886034265556864302334--------8899865
Q gi|254780920|r  224 LYVEDHVRALYLVLKKG---RIGERYNIGG-NNERKNIDIVFEIGFLLDALIPKSYSHTELIRFI--------EDRPGHD  291 (358)
Q Consensus       224 i~v~D~a~~i~~~~~~~---~~~~~fNigs-~~~~s~~e~~~~i~~~~~~~~~~~~~~~~~~~~~--------~~~~~~~  291 (358)
T Consensus       224 ~yV~D~v~a~~~~l~~~~~~~~~~i~NIGs~~~~~si~el~~~i~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~D~  302 (347)
T PRK11908        224 TDIDDGISALMKIIENKDGVASGKIYNIGNPKNNFSVRELAEKMLELAAEYPEYADSA-KKVKLVETTSGAYYGKGYQDV  302 (347)
T ss_pred             EEHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCCEEHHHHHHHHHHHHCCCCCCCCCH-HCCEEEECCCCCCCCCCCCCH
T ss_conf             8667999999999967788888997995889986369999999999860252003521-015034248864456554435


Q ss_pred             CEECCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             30031718999981896610899999999999988678655323
Q gi|254780920|r  292 RRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLY  335 (358)
Q Consensus       292 ~~~~~d~~K~~~~Lgw~p~~~l~egi~~~i~w~~~n~~~~~~~~  335 (358)
T Consensus       303 ~~~~~di~ka~~~LGw~P~~sleeGl~~ti~wyk~~~~~~~~~~  346 (347)
T PRK11908        303 QNRVPKIDNTMQELGWAPQTTFDDALRRIFEAYRGHVADARALV  346 (347)
T ss_pred             HHCCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             44202769999984996589699999999999987587455531