HHsearch alignment for GI: 254780920 and conserved domain: PRK12320

>PRK12320 hypothetical protein; Provisional.
Probab=99.73  E-value=2.2e-17  Score=125.51  Aligned_cols=246  Identities=17%  Similarity=0.198  Sum_probs=158.6

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEE
Q ss_conf             94899767882779999999986898799994788765856777620379749997638899999999862278717851
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNF   80 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~ViHl   80 (358)
T Consensus         1 M~i~VT~A~G~lGR~la~rLla~-GH~V~Giar~r~---------~s~~~~~dFV~A~iRd~v-~~el~~--~AD~V~Hl   67 (699)
T PRK12320          1 MQILVTDATGAVGRSVTRQLIAA-GHTVSGIAQHPH---------DALDPRVDYVCASLRNPV-LQELAG--EADAVIHL   67 (699)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHC-CCEEEEEECCCC---------CCCCCCCCEEECHHHHHH-HHHHCC--CCCEEEEE
T ss_conf             94788346215677899999866-872454404798---------666754555421123099-997404--55548882


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             23433222222222222222222202478886512322112478427863055431122222222222222222222333
Q gi|254780920|r   81 AAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSAT  160 (358)
Q Consensus        81 Aa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~s~Yg~s  160 (358)
T Consensus        68 A~~~~~-----~p~---~~~idG~a~V~~A~a---------~~G~-R~vfvs~Aa--g~p-~-------------ly---  110 (699)
T PRK12320         68 APVDTS-----APG---GVGITGLAHVANAAA---------RAGA-RLLFVSQAA--GRP-E-------------LY---  110 (699)
T ss_pred             CCCCCC-----CCC---CCCCHHHHHHHHHHH---------HHCC-CEEEEECCC--CCH-H-------------HC---
T ss_conf             255689-----998---546366889999998---------6188-179860578--980-3-------------31---


Q ss_pred             CCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCEEECCCC
Q ss_conf             2210000001233322222222222223332222222222222222222222222223-322113322220000000122
Q gi|254780920|r  161 KASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQ-NVRDWLYVEDHVRALYLVLKK  239 (358)
Q Consensus       161 K~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~-~~Rdfi~v~D~a~~i~~~~~~  239 (358)
T Consensus       111 -r~~E~lva~----~~~~~v~iR~A~~vGR~-l-D----~~V~R~~A---~~~~~~~Sa~pmqVvHlDD~~R~Lv~Al~~  176 (699)
T PRK12320        111 -RQAETLVST----GWAPSLVIRIAPPVGRQ-L-D----WMVCRTVA---TLLRSKVSARPIRVLHLDDLVRFLVLALNT  176 (699)
T ss_pred             -CHHHHHHHC----CCCCEEEEEECCCCCCC-H-H----HHHHHHHH---HCCCCCCCCCCEEEEEHHHHHHHHHHHHHC
T ss_conf             -579999862----48860699961554531-6-7----89998753---232677776722787577799999999824


Q ss_pred             CCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCEEECCCCCC--CCCEECCCHHHHHHHHCCCCCCCHHHHH
Q ss_conf             22222111357864202688999988603426555686430233488998--6530031718999981896610899999
Q gi|254780920|r  240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPG--HDRRYAIDSSKIKSEIGWFPQENMESGL  317 (358)
Q Consensus       240 ~~~~~~fNigs~~~~s~~e~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~d~~K~~~~Lgw~p~~~l~egi  317 (358)
T Consensus       177 ~~sG-vVnLAap~~~~~~~----a~~llr~~~P~~---------r~~Rv~s~a~l~P~mD~a~~qe~W~F~~~W~a~eav  242 (699)
T PRK12320        177 DRNG-VVDLATPDTTNVVT----AWRLLRSVDPHL---------RTRRVRSWEQLIPEVDIAAVQEDWNFEFGWQATEAI  242 (699)
T ss_pred             CCCC-CEEECCCCCCHHHH----HHHHHCCCCCCC---------CCCCCCCHHHHCCHHHHHHHHHHHCCCCCCCHHHHH
T ss_conf             6777-43314898515999----999717778433---------444577577736245588777864888342247788


Q ss_pred             HHHHHHH
Q ss_conf             9999999
Q gi|254780920|r  318 NKTVCWY  324 (358)
Q Consensus       318 ~~~i~w~  324 (358)
T Consensus       243 ~D~~~~~  249 (699)
T PRK12320        243 VDTGRGL  249 (699)
T ss_pred             HHHHHHH
T ss_conf             7641343