HHsearch alignment for GI: 254780920 and conserved domain: PRK12429

>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional.
Probab=99.49  E-value=8.1e-14  Score=103.77  Aligned_cols=230  Identities=18%  Similarity=0.143  Sum_probs=143.3

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHHC-----CCC
Q ss_conf             489976788277999999998689879999478876585677762-03797499976388999999998622-----787
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEI-SQSNLFSFLQVDICDRECIRSALKEF-----QPD   75 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~-~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d   75 (358)
T Consensus         6 ~alITGas~GIG~aia~~la~~-Ga~V~~~~~~~~~~~~-~~~~~~~~g~~~~~~~~D~~~~~~v~~~~~~~~~~~g~iD   83 (258)
T PRK12429          6 TALVTGAASGIGLEIALALAKE-GAKVVIADLNDEAAAK-AAEAIKKAGGKAIGVAMDVTDEEAINAGIDKVVETFGGVD   83 (258)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHHHHH-HHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             8999488758999999999987-9999999798899999-9999984499189998358999999999999999829970


Q ss_pred             EEEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             1785123433222----222222222222222202478886512322112478427863055431122222222222222
Q gi|254780920|r   76 AIVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPY  151 (358)
Q Consensus        76 ~ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~  151 (358)
T Consensus        84 iLVnnAG~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~p~-----m~~~~~G~Iv~isS~~~~~-----------~~  147 (258)
T PRK12429         84 ILVNNAGIQHVAPIEDFPTEKWKKMIAIMLDGAFLTTKAALPH-----MKAQKWGRIINMASVHGLV-----------GS  147 (258)
T ss_pred             EEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHEEEHHHHHHH-----HHHCCCCEEEEECCHHHCC-----------CC
T ss_conf             9998998889988155999999999997623212200677776-----6435992899987755466-----------89


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCC--CCCCCCCCCCCCCC
Q ss_conf             22222233322100000012333---2222222222222333222222222222222-222222--22222233221133
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRM-IEGSHV--FLYGDGQNVRDWLY  225 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~-~~g~~~--~i~g~g~~~Rdfi~  225 (358)
T Consensus       148 ~~~~~Y~asKaal~~lt~~lA~e~~~~gIrvN~V~PG~i~T~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~P~~R~g~  225 (258)
T PRK12429        148 AGKAAYVSAKHGLIGLTKVVALEGATHGVTVNAICPGYVDTPLVR--KQIPDLAKERGISEEEVLEDVLLPLVPQKRFTT  225 (258)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCHH--HHHHHHHHHCCCCHHHHHHHHHHHCCCCCCCCC
T ss_conf             997589999999999999999985320979999974879871022--133678977399979999999972799899849


Q ss_pred             CCCCCCCEEECCCC---CCCCCCCCCCCC
Q ss_conf             22220000000122---222221113578
Q gi|254780920|r  226 VEDHVRALYLVLKK---GRIGERYNIGGN  251 (358)
Q Consensus       226 v~D~a~~i~~~~~~---~~~~~~fNigs~  251 (358)
T Consensus       226 p~dia~~v~fL~S~~s~~itGq~i~VDGG  254 (258)
T PRK12429        226 VEEIADLALFLASFAAKGVTGQAWVVDGG  254 (258)
T ss_pred             HHHHHHHHHHHHCCHHCCCCCCEEEECCC
T ss_conf             99999999999480754901763896946