HHsearch alignment for GI: 254780920 and conserved domain: PRK12743

>PRK12743 acetoin dehydrogenase; Provisional.
Probab=99.43  E-value=2.2e-13  Score=101.06  Aligned_cols=224  Identities=15%  Similarity=0.062  Sum_probs=140.4

Q ss_pred             CE--EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH-CCCCEEEEECCCCCHHHHHHHHHH-----C
Q ss_conf             94--899767882779999999986898799994788765856777620-379749997638899999999862-----2
Q gi|254780920|r    1 MR--LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS-QSNLFSFLQVDICDRECIRSALKE-----F   72 (358)
Q Consensus         1 Mk--ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~-~~~~v~~i~~Di~d~~~l~~~~~~-----~   72 (358)
T Consensus         1 M~KValITGgs~GIG~a~a~~la~~-Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~~~~~~~~~~~~~G   79 (253)
T PRK12743          1 MAQVAIVTASDSGIGKACALLLAQQ-GFDIGITWHSDEEGAKETAEEVVSHGVRAEIVHLDLSNLPEGAQAIEKLIQRLG   79 (253)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHC-CCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCC
T ss_conf             9998999075889999999999987-998999748997999999999994599189999048999999999999999819


Q ss_pred             CCCEEEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCC-CCEEEEECCCCCCCCCCCCCCCCC
Q ss_conf             7871785123433222----22222222222222220247888651232211247-842786305543112222222222
Q gi|254780920|r   73 QPDAIVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKK-DQFRFLQISTDEVYGSLDKGLFSE  147 (358)
Q Consensus        73 ~~d~ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~-~~~~~v~~SS~~vYg~~~~~~~~E  147 (358)
T Consensus        80 ~iDilVNnAG~~~~~~~~~~~~~~w~~~~~vNl~~~f~~~~~~~~~m-----~k~~~~G~IVnisS~~~~~~--------  146 (253)
T PRK12743         80 RLDVLVNNAGAMTKAPFLDMAFDEWRKIFTVDVDGAFLCSQIAARHM-----VKQGQGGRIINITSVHEHTP--------  146 (253)
T ss_pred             CCCEEEECCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHCCCCCEEEEEEEHHHCCC--------
T ss_conf             99899989989999980029999999999998599999999999999-----97589963899963665578--------


Q ss_pred             CCCCCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222222233322100000012333---22222222222223332222222222222222222222222223322113
Q gi|254780920|r  148 DMPYNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWL  224 (358)
Q Consensus       148 ~~~~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi  224 (358)
T Consensus       147 ---~~~~~~Y~asKaal~~ltk~lA~ela~~gIrVN~VaPG~i~T~~~~--~~~~~~~~~~~~~iPl---------~R~g  212 (253)
T PRK12743        147 ---LPDASAYTAAKHALGGLTKAMALELVEHKILVNAVAPGAIATPMNG--MDDSDVKPDAEPSIPL---------RRPG  212 (253)
T ss_pred             ---CCCCHHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCCC--CCCHHHHHHHHHCCCC---------CCCC
T ss_conf             ---8985899999999999999999997021929999964889877666--7877799999857998---------9984


Q ss_pred             CCCCCCCCEEECCCC---CCCCCCCCCCCCC
Q ss_conf             322220000000122---2222211135786
Q gi|254780920|r  225 YVEDHVRALYLVLKK---GRIGERYNIGGNN  252 (358)
Q Consensus       225 ~v~D~a~~i~~~~~~---~~~~~~fNigs~~  252 (358)
T Consensus       213 ~pedia~~v~fL~Sd~s~yiTG~~i~VDGG~  243 (253)
T PRK12743        213 HTHEIASLVAWLCSEGASYTTGQSLIVDGGF  243 (253)
T ss_pred             CHHHHHHHHHHHHCCHHCCCCCCEEEECCCE
T ss_conf             9999999999993852258258648978686