HHsearch alignment for GI: 254780920 and conserved domain: PRK12746

>PRK12746 short chain dehydrogenase; Provisional.
Probab=99.36  E-value=7.5e-13  Score=97.87  Aligned_cols=219  Identities=22%  Similarity=0.236  Sum_probs=134.5

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEE-ECCCCCCCHHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHH---------
Q ss_conf             89976788277999999998689879999-478876585677762-0379749997638899999999862---------
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVI-DKLTYAGNLNSLKEI-SQSNLFSFLQVDICDRECIRSALKE---------   71 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~-d~~~~~~~~~~~~~~-~~~~~v~~i~~Di~d~~~l~~~~~~---------   71 (358)
T Consensus         9 alITGga~GIG~aia~~la~~-Ga~V~i~~~~-~~~~~~~~~~~~~~~~~~~~~~~~Dv~~~~~~~~~~~~~~~~~~~~~   86 (254)
T PRK12746          9 ALVTGASRGIGRAIAMRLAND-GALVAIHYGR-NKAAADETIREIESNGGKAFLIEADLNSIDGVKKLVEQLKNELQIRV   86 (254)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEECCC-CHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             999484768999999999987-9999996599-98999999999985599289997577999999999999999986641


Q ss_pred             --CCCCEEEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCC
Q ss_conf             --27871785123433222----222222222222222202478886512322112478427863055431122222222
Q gi|254780920|r   72 --FQPDAIVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLF  145 (358)
Q Consensus        72 --~~~d~ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~  145 (358)
T Consensus        87 g~g~iDiLVnnAg~~~~~~~~~~~~~~~~~~~~vNl~~~f~~~k~~~p~m------~~-~G~IVnisS~~~~~-------  152 (254)
T PRK12746         87 GTSEIDILVNNAGIGTQGTIENTTEEIFDEIMAVNIKAPFFLIQQTLPLL------RA-EGRVINISSAEVRL-------  152 (254)
T ss_pred             CCCCCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH------HH-CCCEEEEECHHHCC-------
T ss_conf             68985189979978899991449999999999985346899999999998------61-69669992432335-------


Q ss_pred             CCCCCCCCCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222222222333221000000123332---2222222222223332222222222-222222222222222223322
Q gi|254780920|r  146 SEDMPYNPSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIPL-AITRMIEGSHVFLYGDGQNVR  221 (358)
Q Consensus       146 ~E~~~~~p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~~-~i~~~~~g~~~~i~g~g~~~R  221 (358)
T Consensus       153 ----~~~~~~~Y~asKaal~~ltr~lA~e~a~~gIrVNaVaPG~i~T~~~~--~~~~~~~~~~~~~~~~------~--lg  218 (254)
T PRK12746        153 ----GFTGSIAYGLSKGALNTMTLPLAKHLGERGITVNTIMPGYTKTDINA--KLLDDPEIRNFATNSS------V--FG  218 (254)
T ss_pred             ----CCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHH--HCCCCHHHHHHHHHCC------C--CC
T ss_conf             ----78873778999999999999999996513989999878989863343--3049999999997279------9--78


Q ss_pred             CCCCCCCCCCCEEECCCC---CCCCCCCCCCCC
Q ss_conf             113322220000000122---222221113578
Q gi|254780920|r  222 DWLYVEDHVRALYLVLKK---GRIGERYNIGGN  251 (358)
Q Consensus       222 dfi~v~D~a~~i~~~~~~---~~~~~~fNigs~  251 (358)
T Consensus       219 R~g~p~dia~~v~FL~S~~s~~iTG~~l~VDGG  251 (254)
T PRK12746        219 RIGQVEDIADAVAFLASSDSRWVTGQIIDVSGG  251 (254)
T ss_pred             CCCCHHHHHHHHHHHHCCHHCCEECCEEEECCC
T ss_conf             975999999999999586323840885887958