HHsearch alignment for GI: 254780920 and conserved domain: PRK12828

>PRK12828 short chain dehydrogenase; Provisional.
Probab=99.46  E-value=1.1e-13  Score=103.03  Aligned_cols=215  Identities=20%  Similarity=0.211  Sum_probs=142.6

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH----C-CCCE
Q ss_conf             4899767882779999999986898799994788765856777620379749997638899999999862----2-7871
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKE----F-QPDA   76 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~----~-~~d~   76 (358)
T Consensus         9 valITGas~GIG~aia~~la~~-Ga~V~i~~~~~~~~-~~~~~~~-~~~~~~~~~~Dvt~~~~~~~~v~~~~~~~G~iDi   85 (239)
T PRK12828          9 VVAITGGFGGLGRATAAWLAAR-GARVALIGRGAAPL-SQTLPGV-PADALRIGGIDLVDPQAARRAVDEVNRQFGRLDA   85 (239)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHHH-HHHHHHH-HCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCCE
T ss_conf             8999472548999999999987-99899997987789-9999875-1788569996079999999999999998399979


Q ss_pred             EEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             785123433222----2222222222222222024788865123221124784278630554311222222222222222
Q gi|254780920|r   77 IVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYN  152 (358)
Q Consensus        77 ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~  152 (358)
T Consensus        86 lVnNAG~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~p~m-----~~~~~G~IInisS~~~~~~-----------~~  149 (239)
T PRK12828         86 LVNIAGAFVWGTIADGDADTWDRMYGVNVKTTLNASKAALPAL-----TASGGGRIVNIGAGAALKA-----------GP  149 (239)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHCCCCEEEEEECHHHCCC-----------CC
T ss_conf             9989778999990449999999999999699999999999999-----8769986999977786777-----------99


Q ss_pred             CCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222333221000000123332---222222222222333222222222222222222222222222332211332222
Q gi|254780920|r  153 PSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDH  229 (358)
Q Consensus       153 p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~  229 (358)
T Consensus       150 ~~~~Y~asKaal~~ltk~lA~e~~~~gIrVN~V~PG~v~T~~~~----------~~~~~~~---~-----~r-~~~p~di  210 (239)
T PRK12828        150 GMGAYAAAKAGVARLTEALAAELLDRGITVNAVLPSIIDTPPNR----------ADMPDAD---F-----SR-WVTPEQI  210 (239)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCHH----------CCCCHHH---C-----CC-CCCHHHH
T ss_conf             96899999999999999999986130908999973878882002----------4185646---1-----79-8999999


Q ss_pred             CCCEEECCCC---CCCCCCCCCCCCCCC
Q ss_conf             0000000122---222221113578642
Q gi|254780920|r  230 VRALYLVLKK---GRIGERYNIGGNNER  254 (358)
Q Consensus       230 a~~i~~~~~~---~~~~~~fNigs~~~~  254 (358)
T Consensus       211 A~~v~fL~Sd~s~~iTG~~i~VdGG~~l  238 (239)
T PRK12828        211 AAVIAFLLSDEAQAITGASIPVDGGVAL  238 (239)
T ss_pred             HHHHHHHHCCHHCCCCCCEEEECCCCCC
T ss_conf             9999999584422855874897978678