HHsearch alignment for GI: 254780920 and conserved domain: TIGR01830

>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase; InterPro: IPR011284 This entry represents 3-oxoacyl-[ACP] reductase, also called 3-ketoacyl-acyl carrier protein reductase, an enzyme of fatty acid biosynthesis found in many plant and bacterial species. This enzyme is involved in type II fatty acid biosynthesis, where the individual metabolic transformations are carried out by different enzymes rather than by a single enzyme as occurs in type I fatty acid biosynthesis . Structural studies show that the enzyme is a tetramer which forms a typical Rossman fold , . Unlike other members of the short-chain dehydrogenase/reductase superfamily, the enzyme undergoes a marked conformational change upon binding of the NADP(H)cofactor. This conformational change aligns the side chains of the catalytic triad at the active site in an active conformation and increases the affinity of the enzyme for its substrate.; GO: 0004316 3-oxoacyl-[acyl-carrier-protein] reductase activity, 0051287 NAD binding, 0006633 fatty acid biosynthetic process.
Probab=99.40  E-value=3.6e-13  Score=99.79  Aligned_cols=218  Identities=19%  Similarity=0.200  Sum_probs=150.7

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCC-CCEEEEECCCCCHHHHHHHHHH-----CCCCE
Q ss_conf             89976788277999999998689879999478876585677762037-9749997638899999999862-----27871
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQS-NLFSFLQVDICDRECIRSALKE-----FQPDA   76 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~-~~v~~i~~Di~d~~~l~~~~~~-----~~~d~   76 (358)
T Consensus         1 AlVTGasRGIG~AIA~~LA~~-Ga~V~i~y~~~e~~~~~~~~e~~~~G~~a~~~~~dvs~~~~~~~~~~~~~~~~G-iDi   78 (238)
T TIGR01830         1 ALVTGASRGIGRAIALKLAKE-GAKVIITYRTSEEGAEEVVEEIKELGVKAAGVVLDVSDREDVKALVEEAEEELG-IDI   78 (238)
T ss_pred             CEECCCCCHHHHHHHHHHHHC-CCEEEEECCCCHHHHHHHHHHHHHCCCEEEEEEECCCCHHHHHHHHHHHHHHHC-CEE
T ss_conf             967167861679999999867-995999659825788899999985697599996038888999999999999829-908


Q ss_pred             EEEECCCC----CCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCC-CCCCCCCCCCCCCCCCC
Q ss_conf             78512343----32222222222222222222024788865123221124784278630554-31122222222222222
Q gi|254780920|r   77 IVNFAAES----HVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTD-EVYGSLDKGLFSEDMPY  151 (358)
Q Consensus        77 ViHlAa~~----~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~-~vYg~~~~~~~~E~~~~  151 (358)
T Consensus        79 LVNNAGITrD~Ll~RMk~edWd~Vi~~NL~g~F~~t~~v~~-----~M~K~R~GrIINisSVVG~~GN~GQ---------  144 (238)
T TIGR01830        79 LVNNAGITRDNLLMRMKEEDWDAVINVNLKGVFNLTQAVLR-----PMIKQRSGRIINISSVVGLMGNAGQ---------  144 (238)
T ss_pred             EEECCCCCCCCHHCCCCHHHHHHHHHHHHHHHHHHHHHHHH-----HHHHHCCCCEEEEEEHHHHHCCCCH---------
T ss_conf             99787413430100488556899998612668788899889-----8875067434861002000068742---------


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222333221000000123332---222222222222333222222222222222-2222222222223322113322
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIPLAITRM-IEGSHVFLYGDGQNVRDWLYVE  227 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~-~~g~~~~i~g~g~~~Rdfi~v~  227 (358)
T Consensus       145 ---aNYaASKAG~IGftKSlAkElasRnItVNaVAPGFI~Td---MT~~L~e~~~~~~l~~IPLgR~G---------~pE  209 (238)
T TIGR01830       145 ---ANYAASKAGVIGFTKSLAKELASRNITVNAVAPGFIETD---MTDKLSEKVKKAMLSQIPLGRFG---------TPE  209 (238)
T ss_pred             ---HHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCC---CCHHCCHHHHHHHHHCCCCCCCC---------CHH
T ss_conf             ---678888755899999999860368705888748998970---00216988999998527723267---------765


Q ss_pred             CCCCCEEECCC-C--CCCCCCCCCCCC
Q ss_conf             22000000012-2--222221113578
Q gi|254780920|r  228 DHVRALYLVLK-K--GRIGERYNIGGN  251 (358)
Q Consensus       228 D~a~~i~~~~~-~--~~~~~~fNigs~  251 (358)
T Consensus       210 eVA~~v~FLASd~AsYITGqv~~VdGG  236 (238)
T TIGR01830       210 EVANAVAFLASDEASYITGQVIHVDGG  236 (238)
T ss_pred             HHHHHHHHHCCCCCCCCCCCEEECCCC
T ss_conf             699999973251247425516630687