HHsearch alignment for GI: 254780920 and conserved domain: TIGR03649

>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family. This family consists of fungal proteins of unknown function associated with secondary metabolite biosynthesis, such as of the ergot alkaloids such as ergovaline. Nomenclature differs because gene order differs - this is EasG in Neotyphodium lolii but is designated ergot alkaloid biosynthetic protein A in several other fungi.
Probab=99.67  E-value=1.6e-16  Score=120.23  Aligned_cols=212  Identities=16%  Similarity=0.183  Sum_probs=134.4

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             48997678827799999999868987999947887658567776203797499976388999999998622-----7871
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEF-----QPDA   76 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d~   76 (358)
T Consensus         1 TIlVtGATG~iG~~v~~~L~~-~g~~v~~~~R~~-----~~----~~~~~~~~v~~d~~d~~~~~~a~~~~d~~~~~v~~   70 (285)
T TIGR03649         1 TILLTGGTGKTASRIARLLQA-ASVPFLVASRSS-----SS----SAGPNEKHVKFDWLDEDTWDNPFSSDDGMEPEISA   70 (285)
T ss_pred             CEEEECCCCHHHHHHHHHHHH-CCCCEEEEECCH-----HH----CCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEE
T ss_conf             989998998189999999986-899789995885-----66----46666753686444811488897635323127418


Q ss_pred             EEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             78512343322222222222222222220247888651232211247842786305543112222222222222222222
Q gi|254780920|r   77 IVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSP  156 (358)
Q Consensus        77 ViHlAa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~s~  156 (358)
T Consensus        71 v~l~~p~-~~-----~~-------~~~~~~~i~aA~---------~aGV~~iV~lS~~~~~---~~---------~~---  113 (285)
T TIGR03649        71 VYLVAPP-IP-----DL-------APPMIKFIDFAR---------SKGVRRFVLLSASIIE---KG---------GP---  113 (285)
T ss_pred             EEECCCC-CC-----CH-------HHHHHHHHHHHH---------HCCCCEEEEEECCCCC---CC---------CC---
T ss_conf             9983899-87-----76-------789999999999---------8499889998303566---79---------86---


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEE
Q ss_conf             233322100000012333222222222222233322222222222-2222222222222222332211332222000000
Q gi|254780920|r  157 YSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLA-ITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYL  235 (358)
Q Consensus       157 Yg~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~~~~~i~~~-i~~~~~g~~~~i~g~g~~~Rdfi~v~D~a~~i~~  235 (358)
T Consensus       114 -~~~~~~-~~~----~~~sg~~~tiLRp~~fm------~N~~~~~~~~~i~~~g~~~~-~~gd~~~~~V~~~DiA~vaa~  180 (285)
T TIGR03649       114 -AMGQVH-AHL----DSLGGVEYTVLRPTWFM------ENFSEEFHVEAIRKENKIYS-ATGDGKIPFVSADDIARVAYR  180 (285)
T ss_pred             -CCHHHH-HHH----HHHCCCCEEEEECHHHH------HHHHHHHHHHHHHHCCEEEC-CCCCCCCCCCCHHHHHHHHHH
T ss_conf             -103899-999----97369976999663998------75056665899974897844-478877573558789999999


Q ss_pred             CCCCC-CCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCC
Q ss_conf             01222-222211135786420268899998860342655
Q gi|254780920|r  236 VLKKG-RIGERYNIGGNNERKNIDIVFEIGFLLDALIPK  273 (358)
Q Consensus       236 ~~~~~-~~~~~fNigs~~~~s~~e~~~~i~~~~~~~~~~  273 (358)
T Consensus       181 ~L~~~~~~~~~~~ltGpe~lt~~eiA~~ls~vlGr~V~y  219 (285)
T TIGR03649       181 ALTDKVAPNTDYVVLGPELLTYDDVAEILSRVLGRKITH  219 (285)
T ss_pred             HHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEE
T ss_conf             974977689779986886579999999999987992278