HHsearch alignment for GI: 254780920 and conserved domain: cd01491

>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1. E1, a highly conserved small protein present universally in eukaryotic cells, is part of cascade to attach ubiquitin (Ub) covalently to substrate proteins. This cascade consists of activating (E1), conjugating (E2), and/or ligating (E3) enzymes and then targets them for degradation by the 26S proteasome. E1 activates ubiquitin by C-terminal adenylation, and subsequently forms a highly reactive thioester bond between its catalytic cysteine and ubiquitin's C-terminus. E1 also associates with E2 and promotes ubiquitin transfer to the E2's catalytic cysteine. Ubiquitin-E1 is a single-chain protein with a weakly conserved two-fold repeat. This CD represents the first repeat of Ub-E1.
Probab=92.76  E-value=0.72  Score=24.60  Aligned_cols=32  Identities=19%  Similarity=0.335  Sum_probs=25.5

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECC
Q ss_conf             489976788277999999998689879999478
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKL   34 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~   34 (358)
T Consensus        21 ~Vli~G~~g-lg~Ei~Knlvl~Gv~~i~i~D~~   52 (286)
T cd01491          21 NVLISGLGG-LGVEIAKNLILAGVKSVTLHDTK   52 (286)
T ss_pred             CEEEECCCH-HHHHHHHHHHHCCCCEEEEEECC
T ss_conf             299999876-39999999997399659999599