Query         gi|254780920|ref|YP_003065333.1| dTDP-glucose 4,6-dehydratase [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 358
No_of_seqs    128 out of 22775
Neff          8.6 
Searched_HMMs 39220
Date          Mon May 30 01:59:12 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780920.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 TIGR01181 dTDP_gluc_dehyt dTDP 100.0       0       0  633.3  16.7  333    2-334     1-340 (340)
  2 PRK10084 dTDP-glucose 4,6 dehy 100.0       0       0  544.4  17.4  337    1-337     1-347 (352)
  3 COG1088 RfbB dTDP-D-glucose 4, 100.0       0       0  542.9  18.2  326    1-337     1-329 (340)
  4 PRK10217 dTDP-glucose 4,6-dehy 100.0       0       0  538.0  18.8  336    1-336     1-343 (355)
  5 TIGR01179 galE UDP-glucose 4-e 100.0       0       0  528.2  13.9  309    2-329     1-339 (341)
  6 PRK11908 NAD-dependent epimera 100.0       0       0  486.5  13.9  317    1-335     1-346 (347)
  7 PRK10675 UDP-galactose-4-epime 100.0       0       0  483.0  15.6  312    1-332     1-337 (338)
  8 COG1087 GalE UDP-glucose 4-epi 100.0       0       0  456.0  15.0  305    1-328     1-326 (329)
  9 PRK11150 rfaD ADP-L-glycero-D- 100.0       0       0  424.8  11.6  295    3-325     2-307 (308)
 10 KOG0747 consensus              100.0       0       0  424.0   9.4  317    2-328     8-326 (331)
 11 TIGR02622 CDP_4_6_dhtase CDP-g 100.0       0       0  402.8  14.7  309    2-326     6-340 (361)
 12 TIGR03466 HpnA hopanoid-associ 100.0       0       0  404.5  11.8  304    1-329     1-327 (328)
 13 KOG1429 consensus              100.0       0       0  399.0  12.9  302    1-330    28-336 (350)
 14 pfam02719 Polysacc_synt_2 Poly 100.0       0       0  389.7  10.7  250    3-291     1-255 (280)
 15 KOG1371 consensus              100.0       0       0  378.6  17.0  313    1-332     3-340 (343)
 16 pfam04321 RmlD_sub_bind RmlD s 100.0       0       0  383.0  11.6  279    3-325     1-284 (284)
 17 TIGR01472 gmd GDP-mannose 4,6- 100.0       0       0  372.6  14.0  316    3-323     3-360 (365)
 18 TIGR02197 heptose_epim ADP-L-g 100.0       0       0  362.7   9.9  311    3-326     1-352 (353)
 19 PRK08125 bifunctional UDP-gluc 100.0       0       0  352.7  12.9  311    2-329   317-654 (660)
 20 COG1089 Gmd GDP-D-mannose dehy 100.0       0       0  348.9  14.6  318    1-327     2-341 (345)
 21 pfam01370 Epimerase NAD depend 100.0       0       0  357.4   6.8  231    3-248     1-235 (235)
 22 COG0451 WcaG Nucleoside-diphos 100.0       0       0  335.7  13.0  303    1-328     1-312 (314)
 23 TIGR03589 PseB UDP-N-acetylglu 100.0       0       0  336.5   9.1  246    2-291     6-256 (324)
 24 pfam01073 3Beta_HSD 3-beta hyd 100.0       0       0  335.4   9.4  252    4-272     1-273 (280)
 25 KOG1431 consensus              100.0 1.4E-45       0  299.6  10.0  292    1-331     2-313 (315)
 26 COG1086 Predicted nucleoside-d 100.0 4.2E-45       0  295.1  10.2  258    2-290   252-514 (588)
 27 KOG1372 consensus              100.0 3.5E-43       0  283.3  14.0  312    3-323    31-365 (376)
 28 TIGR01214 rmlD dTDP-4-dehydror 100.0 1.6E-43       0  285.4  10.3  291    2-322     1-315 (317)
 29 PRK09987 dTDP-4-dehydrorhamnos 100.0 3.1E-43       0  283.6  10.5  283    1-324     1-293 (299)
 30 COG1091 RfbD dTDP-4-dehydrorha 100.0 1.7E-42       0  279.2  12.1  277    1-322     1-278 (281)
 31 KOG1430 consensus              100.0 4.3E-42       0  276.6  13.8  313    2-328     6-349 (361)
 32 KOG1502 consensus              100.0 1.3E-39 3.4E-44  261.4  12.5  304    1-328     7-324 (327)
 33 TIGR01777 yfcH conserved hypot 100.0 6.4E-34 1.6E-38  226.7   4.1  295    3-317     1-307 (307)
 34 CHL00194 ycf39 Ycf39; Provisio 100.0 7.7E-32   2E-36  214.0  10.9  278    1-325     1-300 (319)
 35 pfam07993 NAD_binding_4 Male s 100.0 2.3E-32   6E-37  217.1   6.5  213    5-233     1-245 (245)
 36 PRK07201 short chain dehydroge 100.0 5.8E-30 1.5E-34  202.5   9.5  251    1-269     1-270 (663)
 37 COG1090 Predicted nucleoside-d 100.0 1.1E-28 2.8E-33  194.7   7.6  280    3-322     1-295 (297)
 38 TIGR03443 alpha_am_amid L-amin  99.9 3.4E-27 8.7E-32  185.5   9.0  246    2-266   973-1262(1389)
 39 KOG2774 consensus               99.9 2.7E-26 6.9E-31  180.0   7.9  303    2-332    46-358 (366)
 40 TIGR01746 Thioester-redct thio  99.9 3.1E-26 7.9E-31  179.7   8.1  259    2-272     1-313 (405)
 41 pfam05368 NmrA NmrA-like famil  99.9 1.4E-25 3.5E-30  175.7   8.9  227    3-272     1-229 (232)
 42 COG3320 Putative dehydrogenase  99.9 7.4E-25 1.9E-29  171.2   9.9  250    1-265     1-289 (382)
 43 KOG1221 consensus               99.8 1.6E-19 4.1E-24  138.6  11.0  252    2-268    14-332 (467)
 44 PRK05865 hypothetical protein;  99.8 1.3E-18 3.4E-23  133.0   9.9  251    1-325     1-257 (854)
 45 PRK12320 hypothetical protein;  99.7 2.2E-17 5.7E-22  125.5   9.3  246    1-324     1-249 (699)
 46 KOG2865 consensus               99.7 5.4E-17 1.4E-21  123.2   8.3  304    3-344    64-389 (391)
 47 PRK05653 fabG 3-ketoacyl-(acyl  99.7 3.3E-17 8.5E-22  124.5   4.8  220    2-251     7-243 (246)
 48 TIGR03649 ergot_EASG ergot alk  99.7 1.6E-16 4.2E-21  120.2   7.7  212    2-273     1-219 (285)
 49 PRK12825 fabG 3-ketoacyl-(acyl  99.7 8.7E-17 2.2E-21  121.9   5.9  221    3-252    10-247 (250)
 50 PRK12826 3-ketoacyl-(acyl-carr  99.6 4.6E-16 1.2E-20  117.5   4.8  226    3-254     9-251 (253)
 51 PRK05557 fabG 3-ketoacyl-(acyl  99.6 8.5E-16 2.2E-20  115.9   6.2  219    3-251     8-244 (248)
 52 PRK10538 3-hydroxy acid dehydr  99.6 1.2E-15 3.1E-20  114.9   6.6  209    1-241     1-224 (248)
 53 COG0702 Predicted nucleoside-d  99.6 2.9E-15 7.4E-20  112.6   8.4  222    1-273     1-224 (275)
 54 PRK07578 short chain dehydroge  99.6 1.1E-15 2.7E-20  115.3   5.6  192    1-249     1-199 (199)
 55 PRK08267 short chain dehydroge  99.6 2.3E-15 5.9E-20  113.2   7.3  207    1-241     1-222 (258)
 56 PRK05565 fabG 3-ketoacyl-(acyl  99.6   1E-15 2.6E-20  115.3   5.4  221    3-251     8-244 (247)
 57 PRK08217 fabG 3-ketoacyl-(acyl  99.6 1.7E-15 4.3E-20  114.0   5.5  220    3-251     8-250 (253)
 58 PRK08220 2,3-dihydroxybenzoate  99.6 1.2E-15   3E-20  115.0   4.6  218    2-253    10-250 (253)
 59 PRK07479 consensus              99.6 1.6E-15   4E-20  114.3   5.2  223    3-253     8-251 (252)
 60 PRK12824 acetoacetyl-CoA reduc  99.6 1.9E-15 4.8E-20  113.7   5.5  224    1-252     1-242 (245)
 61 PRK07856 short chain dehydroge  99.6 3.5E-15   9E-20  112.1   5.8  219    2-255    10-243 (254)
 62 PRK07231 fabG 3-ketoacyl-(acyl  99.6 3.4E-15 8.6E-20  112.2   5.5  224    2-253     8-249 (250)
 63 PRK07454 short chain dehydroge  99.6 3.1E-15   8E-20  112.4   5.3  206    1-242     6-226 (241)
 64 PRK06482 short chain dehydroge  99.6 1.3E-14 3.2E-19  108.7   7.5  166    1-188     1-182 (276)
 65 PRK07774 short chain dehydroge  99.6 5.8E-15 1.5E-19  110.8   5.6  220    2-253     8-247 (250)
 66 PRK09730 hypothetical protein;  99.6 5.3E-15 1.3E-19  111.0   5.4  228    1-252     1-247 (247)
 67 PRK09009 C factor cell-cell si  99.5 6.8E-15 1.7E-19  110.4   5.8  215    1-255     1-234 (235)
 68 PRK05875 short chain dehydroge  99.5 2.9E-15 7.3E-20  112.6   3.6  225    3-253    10-253 (277)
 69 PRK08340 glucose-1-dehydrogena  99.5 1.3E-14 3.3E-19  108.6   6.9  229    1-255     1-256 (259)
 70 PRK09135 pteridine reductase;   99.5 7.7E-15   2E-19  110.0   5.5  225    3-255     9-248 (249)
 71 PRK08339 short chain dehydroge  99.5 6.8E-15 1.7E-19  110.4   5.0  226    3-256    11-262 (263)
 72 PRK06182 short chain dehydroge  99.5 2.1E-14 5.4E-19  107.3   7.5  164    3-189     6-181 (273)
 73 PRK12939 short chain dehydroge  99.5 6.4E-15 1.6E-19  110.5   4.8  222    2-252     9-247 (250)
 74 PRK09242 tropinone reductase;   99.5 8.5E-15 2.2E-19  109.8   5.2  222    2-251    12-252 (258)
 75 PRK08219 short chain dehydroge  99.5   1E-14 2.6E-19  109.2   5.6  204    1-243     3-214 (226)
 76 PRK12384 sorbitol-6-phosphate   99.5 5.3E-15 1.4E-19  111.0   4.0  236    1-253     1-257 (259)
 77 PRK07024 short chain dehydroge  99.5   3E-14 7.7E-19  106.4   7.8  200    2-242     4-217 (256)
 78 PRK08063 enoyl-(acyl carrier p  99.5 9.8E-15 2.5E-19  109.4   5.3  225    3-253     7-247 (250)
 79 PRK07102 short chain dehydroge  99.5 2.2E-14 5.5E-19  107.3   6.9  201    1-242     1-215 (243)
 80 PRK06181 short chain dehydroge  99.5 1.4E-14 3.5E-19  108.5   5.8  211    2-242     3-228 (263)
 81 PRK07035 short chain dehydroge  99.5 1.3E-14 3.2E-19  108.7   5.5  220    2-251    10-249 (252)
 82 PRK07060 short chain dehydroge  99.5 1.4E-14 3.4E-19  108.5   5.6  218    2-252    11-242 (245)
 83 PRK06180 short chain dehydroge  99.5   2E-14   5E-19  107.5   6.3  167    1-187     4-183 (277)
 84 PRK08993 2-deoxy-D-gluconate 3  99.5 1.1E-14 2.8E-19  109.1   4.8  223    2-251    12-249 (253)
 85 PRK07677 short chain dehydroge  99.5 1.8E-14 4.7E-19  107.7   5.9  225    2-254     5-249 (254)
 86 PRK08277 D-mannonate oxidoredu  99.5 1.1E-14 2.7E-19  109.1   4.6  224    2-252    12-272 (278)
 87 PRK05693 short chain dehydroge  99.5 2.6E-14 6.5E-19  106.8   6.5  163    1-187     1-176 (274)
 88 PRK07890 short chain dehydroge  99.5 1.1E-14 2.7E-19  109.1   4.5  224    2-253     7-256 (258)
 89 PRK07831 short chain dehydroge  99.5 2.6E-14 6.8E-19  106.7   6.4  225    2-252    18-260 (261)
 90 PRK08263 short chain dehydroge  99.5 2.8E-14 7.3E-19  106.5   6.5  163    3-187     6-182 (275)
 91 PRK06113 7-alpha-hydroxysteroi  99.5   2E-14 5.1E-19  107.5   5.7  223    3-253    14-251 (255)
 92 PRK06179 short chain dehydroge  99.5 3.8E-14 9.6E-19  105.8   7.1  161    3-188     7-179 (270)
 93 PRK12827 short chain dehydroge  99.5 1.6E-14   4E-19  108.1   5.1  222    3-251     9-249 (251)
 94 PRK06101 short chain dehydroge  99.5 3.4E-14 8.7E-19  106.1   6.8  197    1-242     1-208 (241)
 95 PRK07707 consensus              99.5 1.3E-14 3.2E-19  108.7   4.6  222    1-251     1-236 (239)
 96 PRK06124 gluconate 5-dehydroge  99.5 1.9E-14 4.9E-19  107.6   5.5  226    2-254    16-257 (259)
 97 PRK07326 short chain dehydroge  99.5 2.4E-14   6E-19  107.0   5.9  201    3-242     8-220 (235)
 98 PRK05872 short chain dehydroge  99.5 2.7E-14 6.9E-19  106.7   6.1  210    3-246    12-238 (296)
 99 PRK06483 short chain dehydroge  99.5 1.6E-14 4.2E-19  108.0   4.8  218    1-252     1-233 (236)
100 TIGR03206 benzo_BadH 2-hydroxy  99.5 1.4E-14 3.5E-19  108.5   4.3  227    2-252     5-248 (250)
101 PRK08085 gluconate 5-dehydroge  99.5 1.5E-14 3.9E-19  108.2   4.5  224    2-255    11-253 (254)
102 PRK05650 short chain dehydroge  99.5 4.8E-14 1.2E-18  105.1   7.0  210    2-241     2-227 (270)
103 PRK08017 short chain dehydroge  99.5   6E-14 1.5E-18  104.6   7.3  211    1-243     1-226 (256)
104 PRK07069 short chain dehydroge  99.5 2.3E-14 5.8E-19  107.1   4.9  224    2-251     1-247 (251)
105 pfam08659 KR KR domain. This e  99.5 4.3E-14 1.1E-18  105.4   6.2  163    2-187     2-178 (181)
106 PRK05993 short chain dehydroge  99.5 9.4E-14 2.4E-18  103.4   7.9  162    3-187     7-181 (277)
107 PRK07985 oxidoreductase; Provi  99.5 5.1E-14 1.3E-18  105.0   6.5  223    2-252    51-291 (294)
108 PRK09186 flagellin modificatio  99.5 3.2E-14 8.1E-19  106.3   5.4  227    2-252     6-253 (255)
109 PRK07577 short chain dehydroge  99.5 2.1E-14 5.3E-19  107.4   4.5  214    2-253     5-233 (234)
110 PRK06550 fabG 3-ketoacyl-(acyl  99.5   2E-14 5.2E-19  107.4   4.3  214    2-252     7-234 (237)
111 PRK07067 sorbitol dehydrogenas  99.5 3.1E-14   8E-19  106.3   5.2  232    3-254     8-255 (256)
112 PRK12429 3-hydroxybutyrate deh  99.5 8.1E-14 2.1E-18  103.8   7.3  230    2-251     6-254 (258)
113 PRK08213 gluconate 5-dehydroge  99.5 4.1E-14 1.1E-18  105.5   5.6  225    2-252    14-256 (259)
114 PRK06841 short chain dehydroge  99.5 3.9E-14 9.9E-19  105.7   5.4  220    3-253    18-253 (255)
115 PRK12823 benD 1,6-dihydroxycyc  99.5 4.1E-14   1E-18  105.6   5.4  220    3-252    11-258 (260)
116 PRK06947 glucose-1-dehydrogena  99.5 6.6E-14 1.7E-18  104.3   6.4  226    3-252     9-252 (252)
117 PRK08251 short chain dehydroge  99.5 1.1E-13 2.9E-18  102.9   7.4  200    2-242     4-220 (248)
118 PRK07041 short chain dehydroge  99.5   6E-14 1.5E-18  104.5   5.9  218    2-252     9-237 (240)
119 PRK12936 3-ketoacyl-(acyl-carr  99.5 5.1E-14 1.3E-18  105.0   5.4  217    2-252     8-242 (245)
120 PRK06172 short chain dehydroge  99.5 4.9E-14 1.2E-18  105.1   5.1  222    3-251    10-249 (253)
121 PRK12938 acetyacetyl-CoA reduc  99.5 7.1E-14 1.8E-18  104.1   5.8  222    3-252     6-243 (246)
122 PRK08324 short chain dehydroge  99.5 7.2E-14 1.8E-18  104.1   5.6  231    3-253   424-671 (676)
123 PRK12828 short chain dehydroge  99.5 1.1E-13 2.7E-18  103.0   6.5  215    2-254     9-238 (239)
124 PRK06227 consensus              99.5 5.3E-14 1.4E-18  104.9   4.9  225    3-254     8-250 (256)
125 PRK07478 short chain dehydroge  99.5 6.7E-14 1.7E-18  104.3   5.4  226    3-255     9-252 (254)
126 smart00822 PKS_KR This enzymat  99.5   2E-13 5.2E-18  101.3   7.8  164    2-187     2-178 (180)
127 PRK12937 short chain dehydroge  99.5 7.7E-14   2E-18  103.9   5.5  220    3-251     8-243 (245)
128 PRK06398 aldose dehydrogenase;  99.5 3.2E-14 8.3E-19  106.2   3.6  218    3-252     9-245 (256)
129 PRK09134 short chain dehydroge  99.5 1.1E-13 2.9E-18  102.9   6.4  224    3-256    12-248 (256)
130 PRK07576 short chain dehydroge  99.5 6.8E-14 1.7E-18  104.2   5.2  223    2-253    10-250 (260)
131 PRK07775 short chain dehydroge  99.5   9E-14 2.3E-18  103.5   5.7  215    2-242    12-242 (275)
132 PRK12745 3-ketoacyl-(acyl-carr  99.5 1.7E-13 4.2E-18  101.9   6.8  230    3-254     8-256 (259)
133 PRK06138 short chain dehydroge  99.5   8E-14   2E-18  103.8   5.1  224    3-251     8-248 (252)
134 PRK06935 2-deoxy-D-gluconate 3  99.5   8E-14   2E-18  103.8   5.0  219    3-251    18-254 (258)
135 PRK06924 short chain dehydroge  99.5 1.4E-13 3.7E-18  102.2   6.3  215    1-239     1-236 (251)
136 PRK06953 short chain dehydroge  99.5   1E-13 2.7E-18  103.1   5.5  165    1-187     1-177 (222)
137 PRK07814 short chain dehydroge  99.4   9E-14 2.3E-18  103.5   5.1  225    2-255    12-254 (263)
138 PRK07776 consensus              99.4 1.5E-13 3.9E-18  102.1   6.2  221    2-252    10-245 (252)
139 PRK07074 short chain dehydroge  99.4 1.1E-13 2.8E-18  102.9   5.5  221    3-252     5-240 (256)
140 PRK06123 short chain dehydroge  99.4 1.7E-13 4.3E-18  101.8   6.5  226    3-252     6-249 (249)
141 PRK07523 gluconate 5-dehydroge  99.4 7.6E-14 1.9E-18  103.9   4.7  223    2-254    11-249 (251)
142 PRK05717 oxidoreductase; Valid  99.4 1.2E-13 3.1E-18  102.7   5.6  222    3-255    13-250 (255)
143 PRK08642 fabG 3-ketoacyl-(acyl  99.4 6.4E-14 1.6E-18  104.4   4.0  222    2-253     8-252 (254)
144 PRK07666 fabG 3-ketoacyl-(acyl  99.4 1.3E-13 3.3E-18  102.5   5.5  203    2-242     8-225 (238)
145 PRK12481 2-deoxy-D-gluconate 3  99.4 1.4E-13 3.6E-18  102.3   5.7  223    2-251    10-247 (251)
146 PRK06057 short chain dehydroge  99.4 1.5E-13 3.8E-18  102.2   5.6  219    3-252    10-247 (255)
147 PRK06171 sorbitol-6-phosphate   99.4 1.7E-13 4.4E-18  101.8   5.9  221    3-253    12-264 (266)
148 PRK09291 short chain dehydroge  99.4 2.3E-13 5.8E-18  101.0   6.5  168    2-189     4-180 (257)
149 PRK08264 short chain dehydroge  99.4 2.6E-13 6.7E-18  100.6   6.7  160    3-188     8-177 (235)
150 PRK07023 short chain dehydroge  99.4 2.9E-13 7.4E-18  100.4   6.9  166    1-188     2-183 (243)
151 PRK12743 acetoin dehydrogenase  99.4 2.2E-13 5.7E-18  101.1   6.2  224    1-252     1-243 (253)
152 PRK09072 short chain dehydroge  99.4 2.7E-13 6.8E-18  100.6   6.5  207    2-243     7-224 (262)
153 PRK06200 2,3-dihydroxy-2,3-dih  99.4 3.1E-13 7.8E-18  100.2   6.8  219    3-252     9-257 (263)
154 PRK08265 short chain dehydroge  99.4 4.4E-13 1.1E-17   99.3   7.5  223    3-253     9-245 (261)
155 PRK06114 short chain dehydroge  99.4 1.8E-13 4.5E-18  101.7   5.5  223    3-251    19-258 (262)
156 PRK06701 short chain dehydroge  99.4 3.6E-13 9.3E-18   99.8   7.1  221    3-253    48-286 (289)
157 PRK08936 glucose-1-dehydrogena  99.4   3E-13 7.7E-18  100.3   6.0  224    3-252    10-250 (261)
158 PRK12935 acetoacetyl-CoA reduc  99.4 2.3E-13 5.8E-18  101.0   5.4  221    3-251     9-244 (247)
159 PRK06346 consensus              99.4 3.8E-13 9.7E-18   99.7   6.5  223    3-251     8-248 (251)
160 PRK12829 short chain dehydroge  99.4 2.9E-13 7.4E-18  100.4   5.9  229    2-252    13-261 (264)
161 PRK07201 short chain dehydroge  99.4 4.6E-13 1.2E-17   99.1   6.9  198    3-239   379-592 (663)
162 PRK05786 fabG 3-ketoacyl-(acyl  99.4 4.2E-13 1.1E-17   99.4   6.6  214    2-253     7-236 (238)
163 PRK06949 short chain dehydroge  99.4 2.7E-13 6.9E-18  100.5   5.6  225    2-251    11-256 (258)
164 PRK07062 short chain dehydroge  99.4 2.8E-13 7.2E-18  100.4   5.6  226    2-254    10-263 (265)
165 PRK06125 short chain dehydroge  99.4 2.5E-13 6.4E-18  100.8   5.1  231    2-252     9-253 (259)
166 PRK06198 short chain dehydroge  99.4 1.9E-13 4.9E-18  101.5   4.4  223    2-251     8-253 (268)
167 PRK06463 fabG 3-ketoacyl-(acyl  99.4 2.4E-13   6E-18  100.9   4.6  220    2-253     9-247 (254)
168 PRK06128 oxidoreductase; Provi  99.4 5.8E-13 1.5E-17   98.5   6.6  224    2-253    57-298 (300)
169 PRK05866 short chain dehydroge  99.4   6E-13 1.5E-17   98.5   6.6  199    2-239    42-257 (290)
170 TIGR01830 3oxo_ACP_reduc 3-oxo  99.4 3.6E-13 9.2E-18   99.8   5.5  218    3-251     1-236 (238)
171 PRK08643 acetoin reductase; Va  99.4 6.9E-13 1.7E-17   98.1   6.8  228    1-252     1-253 (256)
172 PRK06500 short chain dehydroge  99.4 6.1E-13 1.5E-17   98.4   6.5  219    2-252     8-246 (249)
173 TIGR03325 BphB_TodD cis-2,3-di  99.4 1.1E-12 2.7E-17   96.9   7.4  227    3-252     8-255 (262)
174 PRK07832 short chain dehydroge  99.4 9.4E-13 2.4E-17   97.3   7.0  217    2-242     2-234 (272)
175 PRK07097 gluconate 5-dehydroge  99.4 1.1E-12 2.8E-17   96.9   7.0  225    2-252    12-257 (265)
176 PRK08226 short chain dehydroge  99.4 3.3E-13 8.4E-18  100.1   4.2  225    2-255     8-256 (263)
177 PRK05867 short chain dehydroge  99.4 6.2E-13 1.6E-17   98.4   5.6  222    2-252    11-250 (253)
178 pfam00106 adh_short short chai  99.4 1.1E-12 2.8E-17   96.8   6.8  152    2-175     2-166 (167)
179 PRK08177 short chain dehydroge  99.4   6E-13 1.5E-17   98.4   5.3  165    2-187     3-180 (225)
180 PRK12744 short chain dehydroge  99.4 1.7E-12 4.4E-17   95.7   7.6  226    2-251    10-253 (257)
181 PRK08628 short chain dehydroge  99.4 1.9E-12 4.9E-17   95.4   7.6  220    2-252     9-250 (258)
182 PRK06914 short chain dehydroge  99.4 1.6E-12 4.2E-17   95.8   7.2  166    3-187     6-186 (280)
183 PRK05599 hypothetical protein;  99.4 1.8E-12 4.5E-17   95.6   7.2  207    1-248     1-222 (246)
184 PRK12748 3-ketoacyl-(acyl-carr  99.4 6.1E-13 1.6E-17   98.4   4.8  220    3-253     8-255 (257)
185 PRK07063 short chain dehydroge  99.4 1.7E-12 4.4E-17   95.6   7.1  224    3-253    10-254 (259)
186 PRK12746 short chain dehydroge  99.4 7.5E-13 1.9E-17   97.9   5.1  219    3-251     9-251 (254)
187 PRK07806 short chain dehydroge  99.4 1.7E-12 4.3E-17   95.7   6.9  222    3-252     9-243 (248)
188 PRK06523 short chain dehydroge  99.4 1.4E-12 3.6E-17   96.2   6.3  225    2-253    11-257 (260)
189 PRK07825 short chain dehydroge  99.4 1.3E-12 3.4E-17   96.4   6.0  199    2-242     7-218 (273)
190 PRK06139 short chain dehydroge  99.3 1.9E-12 4.8E-17   95.4   6.4  212    3-250     9-236 (324)
191 PRK08945 short chain dehydroge  99.3 2.3E-12 5.9E-17   94.8   6.8  199    2-238    15-231 (245)
192 PRK08416 7-alpha-hydroxysteroi  99.3 1.2E-12 3.1E-17   96.6   5.3  225    2-252    10-257 (260)
193 PRK12747 short chain dehydroge  99.3 8.4E-13 2.1E-17   97.5   4.4  222    2-252     6-250 (252)
194 PRK13394 3-hydroxybutyrate deh  99.3 1.1E-12 2.7E-17   96.9   4.8  230    3-252    10-259 (262)
195 PRK06194 hypothetical protein;  99.3 4.3E-12 1.1E-16   93.2   7.7  171    3-187     9-196 (301)
196 PRK06484 short chain dehydroge  99.3 1.9E-12 4.9E-17   95.3   5.8  216    3-251     8-243 (530)
197 PRK07370 enoyl-(acyl carrier p  99.3 3.5E-12 8.9E-17   93.8   6.8  223    2-252     9-254 (259)
198 PRK06077 fabG 3-ketoacyl-(acyl  99.3 2.5E-12 6.5E-17   94.6   6.0  224    3-252     6-242 (249)
199 PRK12859 3-ketoacyl-(acyl-carr  99.3 2.3E-12 5.9E-17   94.8   5.7  217    3-251     9-254 (257)
200 PRK08594 enoyl-(acyl carrier p  99.3 4.7E-12 1.2E-16   93.0   7.2  221    2-252     8-252 (256)
201 PRK06079 enoyl-(acyl carrier p  99.3 3.4E-12 8.7E-17   93.8   6.5  220    2-252     9-249 (252)
202 PRK06196 oxidoreductase; Provi  99.3 7.9E-12   2E-16   91.6   8.1  177    2-189    28-216 (316)
203 PRK08589 short chain dehydroge  99.3 4.4E-12 1.1E-16   93.2   6.5  222    3-251     9-251 (272)
204 PRK12742 oxidoreductase; Provi  99.3 5.7E-12 1.4E-16   92.5   7.1  216    2-251     8-234 (237)
205 PRK06484 short chain dehydroge  99.3 4.2E-12 1.1E-16   93.3   6.0  217    3-251   277-512 (530)
206 PRK07109 short chain dehydroge  99.3 7.9E-12   2E-16   91.6   7.1  213    3-250    11-239 (338)
207 PRK07904 short chain dehydroge  99.3 1.5E-11 3.9E-16   89.8   8.4  203    2-242    10-225 (253)
208 PRK05876 short chain dehydroge  99.3 6.3E-12 1.6E-16   92.2   6.3  167    3-188     9-190 (275)
209 PRK05854 short chain dehydroge  99.3 1.5E-11 3.7E-16   90.0   7.6  179    3-188    17-211 (314)
210 PRK07792 fabG 3-ketoacyl-(acyl  99.3 1.3E-11 3.3E-16   90.3   6.6  222    3-252    12-251 (303)
211 PRK08278 short chain dehydroge  99.3 1.7E-11 4.4E-16   89.5   7.1  204    3-239     9-232 (273)
212 PRK06505 enoyl-(acyl carrier p  99.2 1.1E-11 2.8E-16   90.8   5.4  222    2-253     9-252 (271)
213 PRK08703 short chain dehydroge  99.2 2.2E-11 5.6E-16   88.9   6.5  208    2-247     8-238 (239)
214 COG0300 DltE Short-chain dehyd  99.2 2.5E-11 6.3E-16   88.6   6.1  203    2-242     8-229 (265)
215 PRK07791 short chain dehydroge  99.2 3.5E-11 8.9E-16   87.7   6.7  221    2-252     8-256 (285)
216 PRK07453 protochlorophyllide o  99.2 6.6E-11 1.7E-15   85.9   8.2  179    2-189     8-229 (322)
217 PRK08415 enoyl-(acyl carrier p  99.2 1.6E-11 4.1E-16   89.7   4.6  221    2-252     7-249 (274)
218 PRK07533 enoyl-(acyl carrier p  99.2 2.4E-11   6E-16   88.7   5.4  221    2-252     8-250 (254)
219 KOG3019 consensus               99.2 1.6E-11   4E-16   89.8   4.2  276    4-321    16-314 (315)
220 PRK08159 enoyl-(acyl carrier p  99.2 4.3E-11 1.1E-15   87.1   6.0  217    2-252    12-254 (272)
221 PRK05884 short chain dehydroge  99.2 7.2E-11 1.8E-15   85.7   7.0  201    1-252     1-218 (223)
222 PRK06603 enoyl-(acyl carrier p  99.2 3.7E-11 9.6E-16   87.5   5.2  221    2-253    10-253 (260)
223 KOG1205 consensus               99.2 1.6E-10 4.2E-15   83.6   8.4  164    2-184    14-190 (282)
224 TIGR01829 AcAcCoA_reduct aceto  99.2 1.1E-10 2.9E-15   84.5   7.5  213    2-252     1-242 (244)
225 PRK06197 short chain dehydroge  99.2 1.1E-10 2.7E-15   84.7   7.3  179    3-187    19-213 (306)
226 PRK05855 short chain dehydroge  99.2 6.1E-11 1.6E-15   86.2   5.9  219    3-242   318-550 (582)
227 PRK07984 enoyl-(acyl carrier p  99.2 5.3E-11 1.4E-15   86.5   5.6  223    2-254     8-253 (262)
228 COG1028 FabG Dehydrogenases wi  99.1 1.8E-10 4.6E-15   83.3   7.5  167    1-187     6-189 (251)
229 PRK07889 enoyl-(acyl carrier p  99.1 6.1E-11 1.6E-15   86.2   5.1  219    2-252     9-251 (256)
230 PRK08690 enoyl-(acyl carrier p  99.1 9.2E-11 2.3E-15   85.1   5.9  224    2-254     8-254 (261)
231 PRK06997 enoyl-(acyl carrier p  99.1 7.8E-11   2E-15   85.5   5.3  221    2-252     8-251 (260)
232 COG2910 Putative NADH-flavin r  99.1 1.3E-10 3.3E-15   84.2   6.1  206    1-248     1-209 (211)
233 COG4221 Short-chain alcohol de  99.1 2.3E-10 5.9E-15   82.6   7.2  207    3-242     9-231 (246)
234 PRK12428 3-alpha-hydroxysteroi  99.1 3.2E-10 8.1E-15   81.8   7.0  220    2-253     7-251 (261)
235 PRK08261 fabG 3-ketoacyl-(acyl  99.1 2.3E-10   6E-15   82.6   6.1  218    3-251   210-442 (447)
236 KOG1203 consensus               99.1 4.3E-10 1.1E-14   81.0   7.1  162    1-188    80-247 (411)
237 PRK06940 short chain dehydroge  99.0 1.6E-10 4.1E-15   83.6   4.1  229    2-253     6-267 (277)
238 KOG1208 consensus               99.0 1.1E-09 2.7E-14   78.6   7.2  183    2-191    37-233 (314)
239 KOG1210 consensus               98.9 2.5E-09 6.5E-14   76.3   7.1  208    2-240    35-260 (331)
240 PRK08303 short chain dehydroge  98.9 1.7E-09 4.4E-14   77.3   6.1  173    3-190    11-211 (305)
241 PRK08862 short chain dehydroge  98.9 1.5E-09 3.7E-14   77.8   5.5  167    3-189     8-189 (227)
242 KOG0725 consensus               98.9   1E-08 2.6E-13   72.6   9.7  174    2-191    10-201 (270)
243 KOG4169 consensus               98.9 8.7E-09 2.2E-13   73.0   8.5  216    2-252     7-244 (261)
244 KOG1209 consensus               98.8   1E-08 2.7E-13   72.5   7.3  148    2-172     9-167 (289)
245 KOG4288 consensus               98.8 4.1E-10   1E-14   81.1  -0.1  221    1-247     3-270 (283)
246 KOG1611 consensus               98.8 2.3E-08 5.8E-13   70.4   7.7  175    3-187     6-204 (249)
247 TIGR01963 PHB_DH 3-hydroxybuty  98.8 3.7E-08 9.5E-13   69.1   8.8  228    1-251     1-254 (258)
248 KOG1201 consensus               98.8 2.3E-08 5.9E-13   70.4   7.4  204    2-243    40-259 (300)
249 TIGR02632 RhaD_aldol-ADH rhamn  98.8   2E-08 5.1E-13   70.8   7.0  233    3-255   427-706 (709)
250 COG3967 DltE Short-chain dehyd  98.7   7E-08 1.8E-12   67.4   7.5  166    3-190     8-188 (245)
251 PRK06720 hypothetical protein;  98.7 2.1E-07 5.3E-12   64.6   9.9  128    3-139    19-157 (169)
252 COG1748 LYS9 Saccharopine dehy  98.6 5.5E-07 1.4E-11   62.0   8.9   76    1-84      2-79  (389)
253 TIGR02415 23BDH acetoin reduct  98.6 1.1E-07 2.9E-12   66.2   5.2  165    3-183     3-179 (258)
254 PRK12367 short chain dehydroge  98.5 4.2E-07 1.1E-11   62.7   8.1  144    2-168    19-164 (250)
255 KOG1610 consensus               98.5 2.7E-07 6.8E-12   63.9   6.9  163    3-185    32-209 (322)
256 KOG1200 consensus               98.4 1.2E-06   3E-11   60.0   8.1  222    3-251    17-253 (256)
257 PRK07424 bifunctional sterol d  98.4 1.9E-06 4.9E-11   58.7   8.3  146    2-168   182-329 (410)
258 PRK06300 enoyl-(acyl carrier p  98.3 4.1E-07   1E-11   62.8   2.7  224    3-253    11-286 (298)
259 pfam03435 Saccharop_dh Sacchar  98.3 5.1E-06 1.3E-10   56.1   8.2   76    3-83      1-77  (384)
260 KOG4039 consensus               98.3 6.5E-06 1.7E-10   55.4   8.3  154    1-192    19-174 (238)
261 PRK09496 trkA potassium transp  98.3 7.5E-06 1.9E-10   55.0   8.5   72    1-80      1-72  (455)
262 KOG1014 consensus               98.2 2.8E-06 7.1E-11   57.7   5.1  169    3-190    52-236 (312)
263 KOG1207 consensus               98.2 5.3E-06 1.4E-10   56.0   6.4  204    2-239     9-226 (245)
264 KOG1478 consensus               98.2 6.3E-06 1.6E-10   55.5   6.8  177    1-184     2-227 (341)
265 pfam08643 DUF1776 Fungal famil  98.2 3.4E-06 8.7E-11   57.1   5.2  167    3-188     6-201 (296)
266 KOG1199 consensus               98.1 2.9E-05 7.3E-10   51.5   9.2  156    3-174    12-184 (260)
267 cd01337 MDH_glyoxysomal_mitoch  97.9 3.6E-05 9.1E-10   50.9   5.9  182    1-201     1-185 (310)
268 cd00704 MDH Malate dehydrogena  97.8 2.1E-05 5.4E-10   52.3   3.6  196    1-215     1-205 (323)
269 cd01338 MDH_choloroplast_like   97.8 1.3E-05 3.3E-10   53.6   2.3  190    1-212     3-204 (322)
270 PRK05442 malate dehydrogenase;  97.5 4.5E-05 1.1E-09   50.3   2.0  192    1-211     5-205 (325)
271 PRK05086 malate dehydrogenase;  97.5   0.001 2.6E-08   42.0   8.3  179    1-201     1-186 (312)
272 PRK08309 short chain dehydroge  97.4 0.00066 1.7E-08   43.2   7.2   67    1-71      1-68  (182)
273 cd05294 LDH-like_MDH_nadp A la  97.4 0.00031 7.8E-09   45.2   4.7  186    1-213     1-197 (309)
274 cd01336 MDH_cytoplasmic_cytoso  97.3  0.0005 1.3E-08   43.9   5.2  184    1-201     3-193 (325)
275 PRK12767 carbamoyl phosphate s  97.2  0.0023 5.8E-08   39.9   7.8   70    1-80      2-76  (325)
276 PRK06732 phosphopantothenate--  97.2   0.002 5.1E-08   40.2   7.5   76    1-86      1-94  (228)
277 KOG1204 consensus               97.2 6.5E-05 1.7E-09   49.3  -0.2  164    3-187     9-190 (253)
278 cd05292 LDH_2 A subgroup of L-  97.2  0.0011 2.8E-08   41.8   5.9  184    1-212     1-191 (308)
279 cd05290 LDH_3 A subgroup of L-  97.1  0.0009 2.3E-08   42.3   5.0  188    2-214     1-196 (307)
280 PRK09288 purT phosphoribosylgl  97.1  0.0063 1.6E-07   37.2   8.9   67    2-78     14-80  (395)
281 COG0569 TrkA K+ transport syst  97.1  0.0045 1.2E-07   38.0   8.2   70    1-79      1-72  (225)
282 PRK00436 argC N-acetyl-gamma-g  97.0  0.0049 1.3E-07   37.8   7.9   39    1-39      2-40  (345)
283 TIGR01850 argC N-acetyl-gamma-  97.0  0.0025 6.4E-08   39.6   6.4  209    1-269     1-234 (361)
284 PRK08655 prephenate dehydrogen  97.0  0.0024 6.2E-08   39.7   6.0   32    1-33      1-32  (441)
285 COG4982 3-oxoacyl-[acyl-carrie  96.9  0.0057 1.5E-07   37.4   7.8  174    3-191   399-604 (866)
286 TIGR01831 fabG_rel 3-oxoacyl-(  96.9  0.0039   1E-07   38.4   6.9  172    3-187     1-182 (239)
287 COG0039 Mdh Malate/lactate deh  96.8  0.0024 6.1E-08   39.8   5.2  189    1-213     1-194 (313)
288 pfam00056 Ldh_1_N lactate/mala  96.8  0.0032 8.1E-08   39.0   5.8  103    1-113     1-107 (142)
289 pfam01113 DapB_N Dihydrodipico  96.8  0.0065 1.6E-07   37.1   7.3   33    1-33      1-34  (122)
290 PRK00048 dihydrodipicolinate r  96.7  0.0077   2E-07   36.6   7.1   74    1-81      3-77  (265)
291 TIGR01832 kduD 2-deoxy-D-gluco  96.7  0.0024 6.1E-08   39.8   4.4  168    2-188     7-188 (249)
292 COG0027 PurT Formate-dependent  96.7  0.0071 1.8E-07   36.9   6.5   69    2-80     14-82  (394)
293 PTZ00325 malate dehydrogenase;  96.6   0.017 4.2E-07   34.6   8.3  177    2-200     3-184 (313)
294 PRK06223 malate dehydrogenase;  96.6  0.0024 6.1E-08   39.8   3.6  186    1-212     1-193 (312)
295 TIGR01289 LPOR light-dependent  96.6  0.0072 1.8E-07   36.8   6.0  180    3-187     6-226 (321)
296 cd01078 NAD_bind_H4MPT_DH NADP  96.5   0.013 3.3E-07   35.2   6.8   75    2-81     30-105 (194)
297 TIGR01759 MalateDH-SF1 malate   96.4   0.011 2.7E-07   35.8   6.2  117    2-130     5-128 (329)
298 pfam02571 CbiJ Precorrin-6x re  96.4   0.025 6.4E-07   33.5   7.7   90    1-114     1-90  (246)
299 TIGR02114 coaB_strep phosphopa  96.3   0.015 3.7E-07   34.9   6.5   77    1-85      1-95  (253)
300 PRK12446 N-acetylglucosaminyl   96.3   0.017 4.4E-07   34.5   6.7  102    1-108     1-132 (352)
301 cd00650 LDH_MDH_like NAD-depen  96.3  0.0058 1.5E-07   37.4   4.1  170    3-193     1-176 (263)
302 PRK05690 molybdopterin biosynt  96.2   0.071 1.8E-06   30.7   9.5   31    2-33     34-64  (245)
303 KOG1202 consensus               96.2   0.024   6E-07   33.7   6.9  160    3-185  1771-1945(2376)
304 KOG2733 consensus               96.2   0.011 2.8E-07   35.7   5.1   88    3-98      8-114 (423)
305 KOG4022 consensus               96.1  0.0076 1.9E-07   36.7   4.2   71    2-83      5-82  (236)
306 PRK08664 aspartate-semialdehyd  96.1  0.0091 2.3E-07   36.2   4.5   32    1-32      4-35  (350)
307 TIGR02823 oxido_YhdH putative   96.1  0.0084 2.2E-07   36.4   4.2   29    2-31    151-179 (330)
308 PRK05447 1-deoxy-D-xylulose 5-  96.0    0.04   1E-06   32.2   7.5   76    1-80      1-95  (379)
309 TIGR00036 dapB dihydrodipicoli  96.0   0.012 3.2E-07   35.4   4.8   80    1-83      2-85  (281)
310 PRK11199 tyrA bifunctional cho  96.0   0.037 9.4E-07   32.5   7.2   31    2-33    100-130 (374)
311 PRK05579 bifunctional phosphop  96.0   0.054 1.4E-06   31.5   7.9   29    2-31      5-37  (392)
312 COG3268 Uncharacterized conser  96.0   0.025 6.3E-07   33.6   6.1  100    3-112     9-114 (382)
313 PTZ00117 malate dehydrogenase;  95.9   0.015 3.8E-07   34.9   4.8  188    1-213     1-194 (313)
314 PRK09620 hypothetical protein;  95.9   0.028 7.1E-07   33.2   6.1   78    1-85      4-99  (229)
315 pfam00899 ThiF ThiF family. Th  95.9    0.13 3.4E-06   29.1   9.7   31    2-33      3-33  (134)
316 TIGR02356 adenyl_thiF thiazole  95.9    0.07 1.8E-06   30.8   8.1   78    2-81     23-123 (210)
317 PRK00726 murG N-acetylglucosam  95.9   0.046 1.2E-06   31.9   7.1  102    1-108     1-132 (359)
318 pfam02254 TrkA_N TrkA-N domain  95.9   0.042 1.1E-06   32.1   6.9   66    3-78      1-66  (115)
319 cd05291 HicDH_like L-2-hydroxy  95.8  0.0059 1.5E-07   37.3   2.4  184    2-212     2-192 (306)
320 PRK07417 arogenate dehydrogena  95.8   0.033 8.5E-07   32.8   6.0   32    1-34      2-33  (280)
321 cd05293 LDH_1 A subgroup of L-  95.7   0.025 6.4E-07   33.5   5.4  186    1-212     4-195 (312)
322 KOG2013 consensus               95.7   0.028   7E-07   33.2   5.6   76    2-80     14-110 (603)
323 PRK00711 D-amino acid dehydrog  95.7   0.017 4.4E-07   34.5   4.3   32    1-34      1-32  (416)
324 pfam03721 UDPG_MGDP_dh_N UDP-g  95.7    0.02 5.1E-07   34.1   4.6   31    1-33      1-31  (185)
325 pfam04127 DFP DNA / pantothena  95.7   0.065 1.7E-06   31.0   7.2   74    2-85      4-96  (197)
326 PRK11863 N-acetyl-gamma-glutam  95.6    0.06 1.5E-06   31.2   6.9   31    2-32      4-34  (314)
327 pfam01118 Semialdhyde_dh Semia  95.6   0.024 6.2E-07   33.6   4.8   31    2-32      1-31  (121)
328 PRK10754 quinone oxidoreductas  95.6    0.03 7.6E-07   33.0   5.2   30    2-32    143-172 (327)
329 PRK05784 phosphoribosylamine--  95.5     0.1 2.6E-06   29.8   7.9   73    1-79      1-75  (485)
330 PRK06019 phosphoribosylaminoim  95.4    0.18 4.5E-06   28.3   8.8   66    1-78      8-73  (377)
331 cd01489 Uba2_SUMO Ubiquitin ac  95.4    0.12 2.9E-06   29.5   7.7   31    2-33      1-31  (312)
332 smart00829 PKS_ER Enoylreducta  95.4   0.094 2.4E-06   30.0   7.2   76    1-82    106-184 (288)
333 COG0002 ArgC Acetylglutamate s  95.3   0.054 1.4E-06   31.5   5.8   33    1-33      3-35  (349)
334 cd04510 consensus               95.3  0.0094 2.4E-07   36.1   1.9  203    1-220     2-213 (334)
335 PRK06849 hypothetical protein;  95.3    0.17 4.4E-06   28.4   8.3   75    1-83      5-86  (387)
336 KOG1198 consensus               95.3   0.068 1.7E-06   30.9   6.2   23    2-25    160-182 (347)
337 cd00300 LDH_like L-lactate deh  95.3   0.037 9.5E-07   32.5   4.9  185    3-212     1-190 (300)
338 smart00859 Semialdhyde_dh Semi  95.2   0.068 1.7E-06   30.9   6.0   30    2-31      1-30  (122)
339 PRK08125 bifunctional UDP-gluc  95.2    0.14 3.6E-06   28.9   7.6   80    1-83      1-85  (660)
340 PRK06598 aspartate-semialdehyd  95.1   0.072 1.8E-06   30.7   5.9   38    2-39      4-43  (348)
341 COG0604 Qor NADPH:quinone redu  95.1   0.094 2.4E-06   30.0   6.5   76    2-82    145-220 (326)
342 cd01484 E1-2_like Ubiquitin ac  95.0    0.19 4.9E-06   28.1   8.0  155    2-185     1-161 (234)
343 TIGR02813 omega_3_PfaA polyket  95.0    0.14 3.6E-06   28.9   7.3  178    2-206  2161-2403(2773)
344 COG0289 DapB Dihydrodipicolina  95.0   0.076 1.9E-06   30.6   5.8   75    1-82      3-78  (266)
345 TIGR03026 NDP-sugDHase nucleot  95.0   0.045 1.1E-06   32.0   4.5   31    1-33      1-31  (411)
346 KOG0023 consensus               94.9    0.15 3.9E-06   28.7   7.1   38  295-333   304-350 (360)
347 PTZ00082 L-lactate dehydrogena  94.8   0.035 8.9E-07   32.6   3.6  185    2-212     9-204 (322)
348 PRK00066 ldh L-lactate dehydro  94.8   0.051 1.3E-06   31.6   4.5  184    2-213     8-198 (315)
349 KOG0172 consensus               94.7     0.1 2.6E-06   29.8   5.9   72    2-81      4-76  (445)
350 PRK09496 trkA potassium transp  94.7     0.3 7.6E-06   26.9   8.3   68    2-78    234-302 (455)
351 PRK08644 thiamine biosynthesis  94.7    0.32 8.1E-06   26.8   9.9   30    2-33     29-59  (209)
352 PRK05671 aspartate-semialdehyd  94.7   0.081 2.1E-06   30.4   5.3   32    1-33      5-39  (336)
353 cd01487 E1_ThiF_like E1_ThiF_l  94.6    0.33 8.4E-06   26.7  10.5   31    2-33      1-31  (174)
354 cd01492 Aos1_SUMO Ubiquitin ac  94.6    0.24 6.2E-06   27.5   7.5   71    2-80     23-95  (197)
355 pfam01488 Shikimate_DH Shikima  94.4    0.12 3.2E-06   29.2   5.8   69    1-83     13-85  (134)
356 PRK06988 putative formyltransf  94.4    0.29 7.3E-06   27.0   7.6   79    1-82      1-86  (313)
357 PRK00885 phosphoribosylamine--  94.4    0.36 9.2E-06   26.4   8.0   67    1-79      1-68  (424)
358 TIGR02817 adh_fam_1 zinc-bindi  94.3    0.15 3.9E-06   28.7   6.0   78    2-88    153-230 (338)
359 cd01488 Uba3_RUB Ubiquitin act  94.3    0.28 7.2E-06   27.1   7.3   31    2-33      1-31  (291)
360 cd05295 MDH_like Malate dehydr  94.3   0.071 1.8E-06   30.7   4.2  202    2-221   125-335 (452)
361 PRK06728 aspartate-semialdehyd  94.2   0.037 9.4E-07   32.5   2.7   39    1-39      6-47  (347)
362 cd00757 ThiF_MoeB_HesA_family   94.2    0.41 1.1E-05   26.1   8.2   31    2-33     23-53  (228)
363 PRK08057 cobalt-precorrin-6x r  94.1    0.23 5.9E-06   27.6   6.6   86    2-114     3-88  (241)
364 COG1660 Predicted P-loop-conta  94.1    0.16 4.2E-06   28.5   5.8   78    1-82      1-92  (286)
365 TIGR00978 asd_EA aspartate-sem  94.0   0.081 2.1E-06   30.4   4.0   32    1-32      1-33  (358)
366 cd04962 GT1_like_5 This family  93.9    0.17 4.5E-06   28.3   5.7   72    1-80      1-90  (371)
367 cd01339 LDH-like_MDH L-lactate  93.9   0.069 1.8E-06   30.8   3.5  184    3-212     1-190 (300)
368 PRK08328 hypothetical protein;  93.7    0.35   9E-06   26.5   6.8   30    2-33     29-59  (230)
369 PRK13771 putative alcohol dehy  93.5     0.4   1E-05   26.2   6.9   13  315-327   285-297 (332)
370 pfam01210 NAD_Gly3P_dh_N NAD-d  93.5    0.32 8.2E-06   26.7   6.4   31    1-33      1-31  (159)
371 PRK06395 phosphoribosylamine--  93.4    0.46 1.2E-05   25.8   7.1   68    1-78      3-70  (435)
372 PRK13304 L-aspartate dehydroge  93.4    0.19   5E-06   28.1   5.2   75    1-89      2-77  (265)
373 PRK08507 prephenate dehydrogen  93.4    0.16 4.2E-06   28.5   4.8   32    1-33      1-33  (275)
374 PRK12409 D-amino acid dehydrog  93.4    0.13 3.4E-06   29.1   4.3   33    1-35      1-34  (410)
375 PRK13303 L-aspartate dehydroge  93.3    0.14 3.6E-06   28.9   4.3   76    1-89      2-77  (265)
376 pfam01408 GFO_IDH_MocA Oxidore  93.3    0.37 9.4E-06   26.4   6.4   67    1-80      1-69  (120)
377 pfam02670 DXP_reductoisom 1-de  93.2    0.38 9.7E-06   26.3   6.4   30    3-32      1-31  (129)
378 PRK13789 phosphoribosylamine--  93.2    0.43 1.1E-05   26.0   6.6   69    1-79      5-74  (426)
379 pfam01470 Peptidase_C15 Pyrogl  93.0     0.2 5.2E-06   28.0   4.8   59    1-81      1-68  (203)
380 PRK06444 prephenate dehydrogen  92.9    0.12   3E-06   29.4   3.4   29    1-30      1-29  (197)
381 PRK07688 thiamine/molybdopteri  92.8    0.31 7.8E-06   26.8   5.5   32    1-33     25-56  (339)
382 cd01491 Ube1_repeat1 Ubiquitin  92.8    0.72 1.8E-05   24.6   7.9   32    2-34     21-52  (286)
383 KOG1496 consensus               92.7    0.26 6.7E-06   27.3   5.0   20    2-21      6-25  (332)
384 COG0136 Asd Aspartate-semialde  92.7    0.26 6.7E-06   27.3   4.9   23    1-23      2-24  (334)
385 PRK11188 rrmJ 23S rRNA methylt  92.5    0.77   2E-05   24.4   7.5   70    1-83     53-127 (209)
386 PRK13194 pyrrolidone-carboxyla  92.5    0.34 8.8E-06   26.5   5.4   59    1-81      1-68  (204)
387 cd01483 E1_enzyme_family Super  92.5    0.78   2E-05   24.4   8.7   32    2-34      1-32  (143)
388 TIGR01500 sepiapter_red sepiap  92.5    0.22 5.6E-06   27.7   4.4  176    3-192     3-206 (267)
389 PRK12475 thiamine/molybdopteri  92.3    0.37 9.5E-06   26.3   5.4   31    2-33     26-56  (337)
390 COG1004 Ugd Predicted UDP-gluc  92.3    0.25 6.4E-06   27.4   4.5   32    1-34      1-32  (414)
391 cd01485 E1-1_like Ubiquitin ac  92.2    0.78   2E-05   24.4   6.9   70    2-80     21-95  (198)
392 TIGR01369 CPSaseII_lrg carbamo  92.2    0.29 7.4E-06   27.0   4.7  207    2-259     8-260 (1089)
393 PRK13886 conjugal transfer pro  92.2     0.6 1.5E-05   25.1   6.3   85    4-89      6-97  (241)
394 pfam03668 ATP_bind_2 P-loop AT  92.2    0.36 9.1E-06   26.4   5.1  124    1-136     1-143 (284)
395 PRK07588 hypothetical protein;  92.1    0.31 7.9E-06   26.8   4.8   33    1-35      1-33  (391)
396 PRK07261 topology modulation p  92.0    0.22 5.6E-06   27.8   3.9   36    1-36      1-36  (171)
397 PRK08229 2-dehydropantoate 2-r  92.0    0.25 6.3E-06   27.4   4.1   31    1-33      3-33  (341)
398 PRK08762 molybdopterin biosynt  92.0     0.9 2.3E-05   24.0   9.2   31    2-33    140-170 (379)
399 cd03802 GT1_AviGT4_like This f  92.0    0.44 1.1E-05   25.9   5.4   31    1-32      1-43  (335)
400 TIGR03451 mycoS_dep_FDH mycoth  91.9    0.47 1.2E-05   25.7   5.5   11  317-327   312-322 (358)
401 PRK05416 hypothetical protein;  91.8    0.46 1.2E-05   25.8   5.3  125    1-136     6-148 (292)
402 PRK13302 putative L-aspartate   91.7    0.43 1.1E-05   25.9   5.1   76    1-89      7-83  (271)
403 PRK06522 2-dehydropantoate 2-r  91.7    0.28 7.1E-06   27.1   4.1   32    1-34      1-32  (307)
404 TIGR01369 CPSaseII_lrg carbamo  91.7   0.058 1.5E-06   31.3   0.6  148    2-191   575-738 (1089)
405 COG0293 FtsJ 23S rRNA methylas  91.6    0.74 1.9E-05   24.5   6.2   70    1-83     47-121 (205)
406 PRK13193 pyrrolidone-carboxyla  91.5    0.54 1.4E-05   25.4   5.5   60    1-82      1-69  (201)
407 PRK13982 bifunctional SbtC-lik  91.5    0.85 2.2E-05   24.2   6.4   27    4-31     74-104 (476)
408 PRK06753 hypothetical protein;  91.2    0.41   1E-05   26.1   4.6   34    1-36      1-34  (373)
409 PRK05396 tdh L-threonine 3-deh  91.1    0.51 1.3E-05   25.5   5.0   11  250-260   240-250 (341)
410 pfam03054 tRNA_Me_trans tRNA m  91.0    0.68 1.7E-05   24.7   5.6   60    1-61      1-72  (354)
411 PRK05597 molybdopterin biosynt  91.0       1 2.6E-05   23.7   6.4   31    2-33     30-60  (355)
412 COG1064 AdhP Zn-dependent alco  91.0     1.1 2.9E-05   23.3   7.4   12  312-324   313-324 (339)
413 PRK11259 solA N-methyltryptoph  90.9    0.39 9.9E-06   26.2   4.2   34    1-36      2-37  (377)
414 PRK07411 hypothetical protein;  90.9     1.1 2.9E-05   23.4   6.6   31    2-33     40-70  (390)
415 PRK11064 wecC UDP-N-acetyl-D-m  90.9    0.44 1.1E-05   25.9   4.5   31    1-33      4-34  (415)
416 KOG1494 consensus               90.8     1.1 2.8E-05   23.5   6.5  155    2-178    30-192 (345)
417 TIGR01758 MDH_euk_cyt malate d  90.7    0.13 3.3E-06   29.1   1.7   20    2-21      1-20  (325)
418 TIGR03366 HpnZ_proposed putati  90.6     1.2 3.2E-05   23.1   7.9   19  245-263   190-208 (280)
419 COG2130 Putative NADP-dependen  90.5     1.3 3.2E-05   23.1   8.3   21  313-333   289-309 (340)
420 COG2085 Predicted dinucleotide  90.5    0.49 1.2E-05   25.6   4.4   31    1-32      1-31  (211)
421 PRK05708 2-dehydropantoate 2-r  90.4     1.3 3.3E-05   23.1   6.8   31    1-33      3-33  (305)
422 PRK13301 putative L-aspartate   90.4    0.34 8.6E-06   26.6   3.5   74    1-89      3-78  (267)
423 TIGR00715 precor6x_red precorr  90.3    0.66 1.7E-05   24.8   5.0   93    1-115     1-94  (260)
424 cd03785 GT1_MurG MurG is an N-  90.0     1.4 3.6E-05   22.8   7.8   98    3-106     3-128 (350)
425 COG2099 CobK Precorrin-6x redu  89.8     1.4 3.7E-05   22.7   6.9   90    1-114     3-92  (257)
426 PRK00005 fmt methionyl-tRNA fo  89.8     1.5 3.7E-05   22.7   8.4   79    1-82      1-87  (309)
427 TIGR00872 gnd_rel 6-phosphoglu  89.8     1.3 3.3E-05   23.1   6.1   86    1-91      1-105 (341)
428 TIGR00438 rrmJ ribosomal RNA l  89.7     1.2   3E-05   23.3   5.9  142    1-169    34-188 (192)
429 TIGR01915 npdG NADPH-dependent  89.7    0.43 1.1E-05   25.9   3.6   31    1-31      1-37  (233)
430 TIGR00243 Dxr 1-deoxy-D-xylulo  89.6     1.1 2.9E-05   23.4   5.7   64    2-71      5-73  (406)
431 PRK13790 phosphoribosylamine--  89.5     1.5 3.9E-05   22.6   7.6   67    1-78      1-68  (415)
432 PRK05600 thiamine biosynthesis  89.5    0.97 2.5E-05   23.8   5.3   71    2-80     43-115 (370)
433 cd01493 APPBP1_RUB Ubiquitin a  89.5     1.5 3.9E-05   22.6   6.4   32    1-34     21-53  (425)
434 COG0623 FabI Enoyl-[acyl-carri  89.3     1.6   4E-05   22.5   6.9  218    2-252     8-250 (259)
435 COG0707 MurG UDP-N-acetylgluco  89.3     1.6   4E-05   22.5   7.9  102    1-108     1-132 (357)
436 PRK07878 molybdopterin biosynt  89.2     1.4 3.6E-05   22.8   6.0   31    2-33     44-74  (392)
437 PRK12921 2-dehydropantoate 2-r  89.1     0.6 1.5E-05   25.1   4.0   31    1-33      1-31  (306)
438 cd05213 NAD_bind_Glutamyl_tRNA  88.9     1.7 4.3E-05   22.4   8.4   10  245-254   241-250 (311)
439 PRK00045 hemA glutamyl-tRNA re  88.5     1.8 4.5E-05   22.2   8.3   14  313-326   325-338 (429)
440 PRK13197 pyrrolidone-carboxyla  88.5     1.2 3.1E-05   23.2   5.2   59    1-81      2-69  (215)
441 COG0287 TyrA Prephenate dehydr  88.3    0.96 2.5E-05   23.8   4.6   31    1-33      4-34  (279)
442 PRK12549 shikimate 5-dehydroge  88.1     1.1 2.9E-05   23.4   4.9   21   52-72     35-59  (284)
443 pfam02737 3HCDH_N 3-hydroxyacy  88.1    0.93 2.4E-05   23.9   4.4   32    2-35      1-32  (180)
444 pfam03447 NAD_binding_3 Homose  88.1    0.41   1E-05   26.1   2.6   64    8-83      1-68  (116)
445 PRK05562 precorrin-2 dehydroge  88.1     1.9 4.9E-05   22.0   7.4   55    1-61     25-79  (222)
446 cd00755 YgdL_like Family of ac  88.0     1.9 4.9E-05   22.0   6.1   69    2-80     13-85  (231)
447 TIGR01296 asd_B aspartate-semi  87.9     0.2   5E-06   28.0   0.9   74    2-84      1-75  (350)
448 TIGR00877 purD phosphoribosyla  87.9     1.4 3.6E-05   22.8   5.2   71    1-78      1-73  (459)
449 pfam03033 Glyco_transf_28 Glyc  87.6       2 5.2E-05   21.8   6.2   78    3-88      2-100 (136)
450 pfam09445 Methyltransf_15 RNA   87.4     2.1 5.3E-05   21.8   6.9   72    2-78      2-76  (165)
451 PRK08118 topology modulation p  87.4     2.1 5.3E-05   21.8   7.8   37    1-37      1-38  (167)
452 TIGR01133 murG undecaprenyldip  87.2       2 5.1E-05   21.9   5.7  101    1-108     6-139 (368)
453 COG1179 Dinucleotide-utilizing  87.0     2.2 5.6E-05   21.6   7.5   30    2-32     32-61  (263)
454 PRK13195 pyrrolidone-carboxyla  86.9    0.81 2.1E-05   24.3   3.6  197    1-271     2-206 (222)
455 PRK10309 galactitol-1-phosphat  86.9     2.2 5.7E-05   21.6   9.3   10  318-327   300-309 (347)
456 cd01490 Ube1_repeat2 Ubiquitin  86.9     1.9 4.9E-05   22.0   5.5   65    2-76      1-74  (435)
457 pfam00070 Pyr_redox Pyridine n  86.8     2.2 5.7E-05   21.6   5.8   31    2-34      1-31  (82)
458 TIGR02667 moaB_proteo molybden  86.8     0.2 5.2E-06   28.0   0.4   17   13-30     24-40  (163)
459 PRK05868 hypothetical protein;  86.8     1.4 3.6E-05   22.8   4.7   33    1-35      1-34  (372)
460 TIGR00421 ubiX_pad polyprenyl   86.3    0.84 2.1E-05   24.2   3.4   28    3-31      4-32  (181)
461 PRK06217 hypothetical protein;  86.3     1.1 2.7E-05   23.6   3.9   35    1-35      2-36  (185)
462 COG1712 Predicted dinucleotide  86.1     1.9 4.9E-05   22.0   5.1   73    1-88      1-75  (255)
463 TIGR01763 MalateDH_bact malate  86.0     1.3 3.2E-05   23.1   4.1  101    1-112     2-109 (308)
464 TIGR02352 thiamin_ThiO glycine  86.0       1 2.5E-05   23.7   3.6   30    3-34      1-30  (357)
465 PRK00094 gpsA NAD(P)H-dependen  85.8     2.5 6.5E-05   21.2   6.8   31    1-33      2-32  (325)
466 TIGR02685 pter_reduc_Leis pter  85.8       2 5.1E-05   21.9   5.1   58    4-63      5-65  (283)
467 PRK13196 pyrrolidone-carboxyla  85.7     2.6 6.6E-05   21.2   6.1   61    1-82      1-71  (212)
468 PRK07538 hypothetical protein;  85.5     1.8 4.6E-05   22.2   4.7   33    1-35      1-33  (413)
469 PRK06847 hypothetical protein;  85.5     1.8 4.5E-05   22.2   4.7   33    1-35      4-37  (375)
470 PRK06901 aspartate-semialdehyd  85.5     1.1 2.7E-05   23.5   3.6   29    1-31      5-33  (323)
471 PRK08040 putative semialdehyde  85.5     2.2 5.5E-05   21.7   5.1   31    2-33      6-39  (337)
472 PRK05134 3-demethylubiquinone-  85.2    0.95 2.4E-05   23.9   3.2   71    2-80     51-121 (233)
473 COG3640 CooC CO dehydrogenase   85.2       2   5E-05   21.9   4.8   32    1-33      1-37  (255)
474 COG0665 DadA Glycine/D-amino a  85.2     1.8 4.6E-05   22.1   4.6   34    1-36      5-38  (387)
475 TIGR03219 salicylate_mono sali  85.1     1.7 4.4E-05   22.3   4.5   34    1-35      1-34  (414)
476 PRK08317 hypothetical protein;  85.1     2.3 5.8E-05   21.5   5.1   74    1-83     21-97  (241)
477 cd01065 NAD_bind_Shikimate_DH   84.8     2.8 7.3E-05   20.9   5.7   31    2-33     21-51  (155)
478 PRK08223 hypothetical protein;  84.7     2.9 7.3E-05   20.9   9.2   30    2-33     29-59  (287)
479 PRK04965 nitric oxide reductas  84.5     2.1 5.3E-05   21.8   4.7   31    2-33      4-35  (378)
480 PRK01747 mnmC 5-methylaminomet  84.3     1.7 4.3E-05   22.4   4.1   32    2-35    258-289 (660)
481 cd01486 Apg7 Apg7 is an E1-lik  84.2     2.7 6.8E-05   21.1   5.1   32    2-34      1-32  (307)
482 KOG1540 consensus               84.2     2.1 5.3E-05   21.8   4.5   16    5-20    107-122 (296)
483 COG0743 Dxr 1-deoxy-D-xylulose  84.1       3 7.7E-05   20.8   6.7   40    1-43      2-42  (385)
484 pfam01266 DAO FAD dependent ox  83.8     1.7 4.4E-05   22.3   4.0   32    2-35      1-32  (309)
485 PRK07045 putative monooxygenas  83.6     2.4 6.2E-05   21.4   4.7   33    1-35      6-38  (388)
486 PRK05808 3-hydroxybutyryl-CoA   83.4     2.2 5.7E-05   21.6   4.5   31    2-34      5-35  (282)
487 PRK07660 consensus              83.4     2.3 5.8E-05   21.5   4.5   31    2-34      5-35  (283)
488 PRK10537 voltage-gated potassi  83.4     3.3 8.3E-05   20.6   5.6   23    9-32    212-234 (356)
489 PRK07530 3-hydroxybutyryl-CoA   83.1     2.3 5.8E-05   21.6   4.4   31    2-34      6-36  (292)
490 cd03820 GT1_amsD_like This fam  83.0     2.8 7.2E-05   21.0   4.9   69    7-81     13-91  (348)
491 PRK00421 murC UDP-N-acetylmura  83.0     3.4 8.6E-05   20.5   6.5   67    2-83     10-77  (459)
492 PRK06567 putative bifunctional  82.9     1.3 3.3E-05   23.1   3.1   32    2-35    403-434 (1048)
493 PRK09260 3-hydroxybutyryl-CoA   82.8     2.3 5.8E-05   21.6   4.3   31    2-34      4-34  (289)
494 COG0111 SerA Phosphoglycerate   82.6     2.8 7.1E-05   21.0   4.7   22  244-265   228-249 (324)
495 COG2039 Pcp Pyrrolidone-carbox  82.5     1.9 4.8E-05   22.1   3.8   60    1-81      1-68  (207)
496 PTZ00098 phosphoethanolamine N  82.5     3.5   9E-05   20.4   5.6   76    1-85     54-129 (263)
497 PRK02318 mannitol-1-phosphate   82.4     2.4 6.2E-05   21.3   4.3   75    1-80      1-87  (381)
498 PRK06129 3-hydroxyacyl-CoA deh  82.1     2.6 6.7E-05   21.1   4.4   30    2-33      4-33  (308)
499 PRK07819 3-hydroxybutyryl-CoA   81.9     2.9 7.5E-05   20.9   4.6   30    2-33      4-33  (284)
500 TIGR00507 aroE shikimate 5-deh  81.6     3.8 9.7E-05   20.2   5.4   69    2-80    123-197 (286)

No 1  
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase; InterPro: IPR005888    The conversion of dTDP-glucose into dTDP-4-keto-6-deoxyglucose by Escherichia coli dTDP-glucose 4,6-dehydratase) takes place in the active site in three steps: dehydrogenation to dTDP-4-ketoglucose, dehydration to dTDP-4-ketoglucose-5,6-ene, and rereduction of C6 to the methyl group. The 4,6-dehydratase makes use of tightly bound NAD^+ as the coenzyme for transiently oxidizing the substrate, activating it for the dehydration step . This and other 4,6-dehydratases catalyze the first committed step in all 6-deoxysugar biosynthetic pathways described to date. Numerous 6-deoxysugars are used in bacterial lipopolysaccharide production as well as in the biosynthesis of a diverse array of secondary metabolites.; GO: 0008460 dTDP-glucose 46-dehydratase activity, 0009225 nucleotide-sugar metabolic process.
Probab=100.00  E-value=0  Score=633.30  Aligned_cols=333  Identities=59%  Similarity=1.052  Sum_probs=314.4

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHC-CCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEE
Q ss_conf             48997678827799999999868-98799994788765856777620379749997638899999999862278717851
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDL-KIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNF   80 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~-~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~ViHl   80 (358)
                      +||||||+|||||++|++.+++. ..+|+++|.+.+.+++.+++.+.+.+++.|++|||+|.+.++++|++.+||+|+||
T Consensus         1 ~~LVTGGaGFIGsnFvry~~~~~~D~~v~vlDkLTYAgn~e~L~~l~~~pr~~Fv~GDI~D~~lv~~~~~e~~~D~VvhF   80 (340)
T TIGR01181         1 RILVTGGAGFIGSNFVRYILNEHPDAEVIVLDKLTYAGNLENLADLEDNPRYRFVKGDIGDRELVDRLLKEHDPDAVVHF   80 (340)
T ss_pred             CCEEECCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHCCCCEEEEC
T ss_conf             92363278525689999999747995799863544557865552332396615674230228899888400176778862


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCC-CCEEEEECCCCCCCCCCCCC--C-CCCCCCCCCCCC
Q ss_conf             2343322222222222222222220247888651232211247-84278630554311222222--2-222222222222
Q gi|254780920|r   81 AAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKK-DQFRFLQISTDEVYGSLDKG--L-FSEDMPYNPSSP  156 (358)
Q Consensus        81 Aa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~-~~~~~v~~SS~~vYg~~~~~--~-~~E~~~~~p~s~  156 (358)
                      ||.|||++|+..|.-+++|||.||.-||||+|....++...++ .++||+|+||++|||+..+.  . ++|++|+.|.||
T Consensus        81 AAESHVDRSI~~P~~F~~TNv~GT~tLLEA~R~~w~aL~e~~~a~~r~l~HiSTDEVYGdl~~~~~~~ftE~tpl~PsSP  160 (340)
T TIGR01181        81 AAESHVDRSISGPEAFIETNVVGTYTLLEAVRKYWHALREAKKAGVRKLHHISTDEVYGDLEKGDPASFTETTPLAPSSP  160 (340)
T ss_pred             CCCCHHHHCCCCCHHHHHCCHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEEECCEEECCCCCCCCEEEEECCCCCCCCC
T ss_conf             22052333014541144403378899999997404456644513102635760301440467896734423278877872


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEC
Q ss_conf             23332210000001233322222222222223332222222222222222222222222223322113322220000000
Q gi|254780920|r  157 YSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLV  236 (358)
Q Consensus       157 Yg~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~a~~i~~~  236 (358)
                      |++||+++++|+++|.+.|||++.|-|++|=|||+|++..+||.+|.+++.|+|+.|+|+|+|+|||+||+|-|+|+.++
T Consensus       161 YSASKAasD~LVrAy~rTYGLp~~ITrCsNNYGPYQfpEKLIPl~I~nal~G~plPvYGdG~~vRDWlyV~DHcrA~~~V  240 (340)
T TIGR01181       161 YSASKAASDLLVRAYHRTYGLPVLITRCSNNYGPYQFPEKLIPLMITNALAGKPLPVYGDGQQVRDWLYVEDHCRAIELV  240 (340)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCEEEEEHHHHHHHHHHH
T ss_conf             45889888789888887548860576885577875674201368999987389983301788320324523478999999


Q ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCC--CCCCCCEEECCCCCCCCCEECCCHHHHHHHHCCCCCCCHH
Q ss_conf             12222222111357864202688999988603426555--6864302334889986530031718999981896610899
Q gi|254780920|r  237 LKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS--YSHTELIRFIEDRPGHDRRYAIDSSKIKSEIGWFPQENME  314 (358)
Q Consensus       237 ~~~~~~~~~fNigs~~~~s~~e~~~~i~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~d~~K~~~~Lgw~p~~~l~  314 (358)
                      |+++..|++||||++++.+.+|+++.|++++|+..+..  -.....+.++.+|||++.|+.+|++|++.+|||+|+++||
T Consensus       241 L~~G~~GE~YNIgg~~Er~NlE~V~~Il~~lgklaP~~p~~~~~~li~~V~DRPGHDrRYAiD~sKi~~ELGW~P~~tfE  320 (340)
T TIGR01181       241 LEKGRVGEVYNIGGGNERTNLEVVEIILELLGKLAPDKPVKSDEDLIEHVEDRPGHDRRYAIDASKIRRELGWAPKYTFE  320 (340)
T ss_pred             HHCCCCCCEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCHHHHEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCHH
T ss_conf             82695212564378762212889999998743207677678884350036769886411044736767616898742389


Q ss_pred             HHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999998867865532
Q gi|254780920|r  315 SGLNKTVCWYLDNNWWWRPL  334 (358)
Q Consensus       315 egi~~~i~w~~~n~~~~~~~  334 (358)
                      |||++||+||++|.|||++|
T Consensus       321 eGlr~Tv~WY~~N~~WWrpl  340 (340)
T TIGR01181       321 EGLRETVQWYLDNEWWWRPL  340 (340)
T ss_pred             HHHHHHHHHHHHHHHHHCCC
T ss_conf             99999999874104553069


No 2  
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional
Probab=100.00  E-value=0  Score=544.38  Aligned_cols=337  Identities=57%  Similarity=1.001  Sum_probs=310.3

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEE
Q ss_conf             94899767882779999999986898799994788765856777620379749997638899999999862278717851
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNF   80 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~ViHl   80 (358)
                      ||||||||+|||||||+++|++++.+.|+++|+++..++..++......+++.|+++||+|...+++++++++||+||||
T Consensus         1 MkILVTGg~GFIGs~l~~~Ll~~~~~~v~~vd~~~~~~~~~~~~~~~~~~~~~~~~~Di~d~~~l~~~~~~~~~D~ViHl   80 (352)
T PRK10084          1 MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADICDRAELDRIFAQHQPDAVMHL   80 (352)
T ss_pred             CEEEEECCHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHHCCCEEEEC
T ss_conf             97999751008999999999977998899984798767788888763089717998567899999999997399999997


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCC---------CCCCC-CCCCC
Q ss_conf             234332222222222222222222024788865123221124784278630554311222---------22222-22222
Q gi|254780920|r   81 AAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSL---------DKGLF-SEDMP  150 (358)
Q Consensus        81 Aa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~---------~~~~~-~E~~~  150 (358)
                      ||.+++..+..+|.+++++|+.||.|+|++||.+...+...+....+|+++||++|||+.         ...|+ +|+++
T Consensus        81 AA~~~~~~s~~~p~~~~~~Nv~gt~nllea~~~~~~~l~~~~~~~~rfv~~SS~~vYG~~~~p~~~~~~~~~p~~~e~~~  160 (352)
T PRK10084         81 AAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDEDKKNAFRFHHISTDEVYGDLPHPDEVENSVELPLFTETTA  160 (352)
T ss_pred             CCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCEEECCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             73466561330967865223786999999999986432001354058887101403468888633356655776557899


Q ss_pred             CCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222223332210000001233322222222222223332222222222222222222222222223322113322220
Q gi|254780920|r  151 YNPSSPYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV  230 (358)
Q Consensus       151 ~~p~s~Yg~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~a  230 (358)
                      ..|.++||.+|+++|.+++.|++++|++++++|++++|||++.+++++|.++.++++|+++.++|+|+|.|||+||+|+|
T Consensus       161 ~~p~~~Y~~sK~~~E~l~~~~~~~~gl~~~i~R~~nvyGP~~~~~~~i~~~i~~~l~g~~i~i~G~G~~~Rdf~yV~D~v  240 (352)
T PRK10084        161 YAPSSPYSASKASSDHLVRAWLRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPIYGKGDQIRDWLYVEDHA  240 (352)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCEECCCCCCCHHHHHHHHHHHCCCEEEEECCCCEEEEEEEHHHHH
T ss_conf             99999899999999999998776515876998527530869996036999999998097368817998567129759999


Q ss_pred             CCEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCEEECCCCCCCCCEECCCHHHHHHHHCCCCC
Q ss_conf             00000012222222111357864202688999988603426555686430233488998653003171899998189661
Q gi|254780920|r  231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSSKIKSEIGWFPQ  310 (358)
Q Consensus       231 ~~i~~~~~~~~~~~~fNigs~~~~s~~e~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~K~~~~Lgw~p~  310 (358)
                      +|+.+++.++..+++||||++++.++.|+++.++++++...+........+.+..+||+++.++.+|++|++++|||+|+
T Consensus       241 ~a~~~~~~~~~~g~~yNig~~~~~s~~e~~~~i~~~~~~~~~~~~~~~~~i~~~~~rp~~~~~~~~d~sk~~~~LGw~P~  320 (352)
T PRK10084        241 RALYKVVTEGKAGETYNIGGHNEKKNLDVVLTICDLLDEIVPKATSYREQITYVADRPGHDRRYAIDASKISRELGWKPQ  320 (352)
T ss_pred             HHHHHHHHCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCEECCCCCCCCCEEEECHHHHHHHHCCCCC
T ss_conf             99999986699999599899997638999999999999874121685323224699999975431389999998499869


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             089999999999998867865532311
Q gi|254780920|r  311 ENMESGLNKTVCWYLDNNWWWRPLYKE  337 (358)
Q Consensus       311 ~~l~egi~~~i~w~~~n~~~~~~~~~~  337 (358)
                      ++|+|||++|++||++|++|.+.++-.
T Consensus       321 ~sl~eGl~~ti~Wy~~N~~~~~~~~~~  347 (352)
T PRK10084        321 ETFESGIRKTVEWYLANTEWVQNVKSG  347 (352)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             999999999999999789999745688


No 3  
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane]
Probab=100.00  E-value=0  Score=542.88  Aligned_cols=326  Identities=60%  Similarity=1.067  Sum_probs=310.8

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCC-CEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEE
Q ss_conf             9489976788277999999998689-879999478876585677762037974999763889999999986227871785
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLK-IQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVN   79 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~-~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~ViH   79 (358)
                      |++|||||+|||||+++++++++.. .+|+++|.+...+++.+++.+.+++++.|+++||+|.+.+.++|++++||+|+|
T Consensus         1 ~~iLVTGGaGFIGsnfvr~~~~~~~d~~v~~~DkLTYAgn~~~l~~~~~~~~~~fv~~DI~D~~~v~~~~~~~~~D~Vvh   80 (340)
T COG1088           1 MKILVTGGAGFIGSNFVRYILNKHPDDHVVNLDKLTYAGNLENLADVEDSPRYRFVQGDICDRELVDRLFKEYQPDAVVH   80 (340)
T ss_pred             CCEEEECCCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHCCCCEEEE
T ss_conf             93799657515778999999960997528997523315778788864069971588545547999999997448875998


Q ss_pred             ECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCC--CCCCCCCCCCCCCC
Q ss_conf             1234332222222222222222222024788865123221124784278630554311222222--22222222222222
Q gi|254780920|r   80 FAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPY  157 (358)
Q Consensus        80 lAa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~--~~~E~~~~~p~s~Y  157 (358)
                      +||.+++++|+.+|..++++|+.||.+|||++|....        ..||+++||++|||+....  .++|++|+.|.|||
T Consensus        81 fAAESHVDRSI~~P~~Fi~TNv~GT~~LLEaar~~~~--------~frf~HISTDEVYG~l~~~~~~FtE~tp~~PsSPY  152 (340)
T COG1088          81 FAAESHVDRSIDGPAPFIQTNVVGTYTLLEAARKYWG--------KFRFHHISTDEVYGDLGLDDDAFTETTPYNPSSPY  152 (340)
T ss_pred             ECHHCCCCCCCCCHHHHHHCCHHHHHHHHHHHHHHCC--------CCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             1100133223357055340002879999999998466--------62079941521025666788875447999999974


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECC
Q ss_conf             33322100000012333222222222222233322222222222222222222222222233221133222200000001
Q gi|254780920|r  158 SATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVL  237 (358)
Q Consensus       158 g~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~a~~i~~~~  237 (358)
                      ++||+++++++++|.+.||++++|.|++|-|||+|++..+||.+|.+++.|+|++++|+|.|.|||+||+|-|+|+.+++
T Consensus       153 SASKAasD~lVray~~TYglp~~ItrcSNNYGPyqfpEKlIP~~I~nal~g~~lpvYGdG~~iRDWl~VeDh~~ai~~Vl  232 (340)
T COG1088         153 SASKAASDLLVRAYVRTYGLPATITRCSNNYGPYQFPEKLIPLMIINALLGKPLPVYGDGLQIRDWLYVEDHCRAIDLVL  232 (340)
T ss_pred             CHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHCCCCCCEECCCCCEEEEEEEHHHHHHHHHHH
T ss_conf             04455678999999987199669844777768876715566799999973999854369854020587175788999999


Q ss_pred             CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCEEECCCCCCCCCEECCCHHHHHHHHCCCCCCCHHHHH
Q ss_conf             22222221113578642026889999886034265556864302334889986530031718999981896610899999
Q gi|254780920|r  238 KKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSSKIKSEIGWFPQENMESGL  317 (358)
Q Consensus       238 ~~~~~~~~fNigs~~~~s~~e~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~K~~~~Lgw~p~~~l~egi  317 (358)
                      .+++.|++||||++++.+.+|+++.|++++++..+.   ....+++..+|||+..++.+|.+|++++|||+|+++||+||
T Consensus       233 ~kg~~GE~YNIgg~~E~~Nlevv~~i~~~l~~~~~~---~~~li~~V~DRpGHD~RYaid~~Ki~~eLgW~P~~~fe~Gl  309 (340)
T COG1088         233 TKGKIGETYNIGGGNERTNLEVVKTICELLGKDKPD---YRDLITFVEDRPGHDRRYAIDASKIKRELGWRPQETFETGL  309 (340)
T ss_pred             HCCCCCCEEEECCCCCCHHHHHHHHHHHHHCCCCCC---HHHHEEECCCCCCCCCCEEECHHHHHHHCCCCCCCCHHHHH
T ss_conf             568677668717875200799999999986766511---04124761678997501010667776542988678888899


Q ss_pred             HHHHHHHHHHHHHHHHHHHC
Q ss_conf             99999998867865532311
Q gi|254780920|r  318 NKTVCWYLDNNWWWRPLYKE  337 (358)
Q Consensus       318 ~~~i~w~~~n~~~~~~~~~~  337 (358)
                      ++|++||++|.|||+++..+
T Consensus       310 rkTv~WY~~N~~Ww~~l~~~  329 (340)
T COG1088         310 RKTVDWYLDNEWWWEPLKDG  329 (340)
T ss_pred             HHHHHHHHHHHHHHHHHHCC
T ss_conf             99999998557777764265


No 4  
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional
Probab=100.00  E-value=0  Score=537.99  Aligned_cols=336  Identities=60%  Similarity=1.060  Sum_probs=307.0

Q ss_pred             CE-EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEE
Q ss_conf             94-89976788277999999998689879999478876585677762037974999763889999999986227871785
Q gi|254780920|r    1 MR-LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVN   79 (358)
Q Consensus         1 Mk-ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~ViH   79 (358)
                      || ||||||+|||||||+++|+++.++.|+++|+++..++...+......+++.|+++|++|...+++++++++||+|||
T Consensus         1 MKkILVTGg~GFIGs~Lv~~Ll~~~~~~v~~~d~~~~~~~~~~~~~~~~~~~~~~~~~Di~d~~~l~~~~~~~~pD~ViH   80 (355)
T PRK10217          1 MRKILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDICDRAELARVFTEYQPDCVMH   80 (355)
T ss_pred             CCEEEECCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHCCCCEEEE
T ss_conf             99699937875799999999997699889998289876525444454127871699800588999999998619988999


Q ss_pred             ECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCC--CCCCCCCCCCCCCCCC
Q ss_conf             12343322222222222222222220247888651232211247842786305543112222--2222222222222222
Q gi|254780920|r   80 FAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPY  157 (358)
Q Consensus        80 lAa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~--~~~~~E~~~~~p~s~Y  157 (358)
                      |||.++++.+..+|..++++|+.||.|+|++||.+...+........+|+++||++|||+..  ..+++|+++..|.++|
T Consensus        81 lAa~~~~~~s~~~p~~~~~~N~~gt~~lleaar~~~~~l~~~~~~~~~~~~~SS~~vYG~~~~~~~~~~E~~~~~P~s~Y  160 (355)
T PRK10217         81 LAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNALTEDKKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPY  160 (355)
T ss_pred             ECCCCCHHHHHCCHHHHHHHCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCHHCCCCCCCCCCCCCCCCCCCCCCHH
T ss_conf             42422110121196775430307578999999997754433036614888655420036777888876778888999888


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECC
Q ss_conf             33322100000012333222222222222233322222222222222222222222222233221133222200000001
Q gi|254780920|r  158 SATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVL  237 (358)
Q Consensus       158 g~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~a~~i~~~~  237 (358)
                      |.||+++|.++..|+++||++++++||+++|||++.+++++|.++.+++.|+++.++|+|+|.|||+||+|+|+|+++++
T Consensus       161 g~sK~~~E~l~~~~~~~~gl~~~i~R~~nvYGP~~~~~~~i~~~i~~~~~g~~i~i~G~G~q~Rdf~yV~D~v~a~~~~~  240 (355)
T PRK10217        161 SASKASSDHLVRAWLRTYGLPTLITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVA  240 (355)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEECCCCEECCCCCCCHHHHHHHHHHHCCCCCCCCCCCCEEEEEEEHHHHHHHHHHHH
T ss_conf             99987665543555541588769723575579199984049999999974998862799982897585899999999999


Q ss_pred             CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCC----CCCCCCCEEECCCCCCCCCEECCCHHHHHHHHCCCCCCCH
Q ss_conf             222222211135786420268899998860342655----5686430233488998653003171899998189661089
Q gi|254780920|r  238 KKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPK----SYSHTELIRFIEDRPGHDRRYAIDSSKIKSEIGWFPQENM  313 (358)
Q Consensus       238 ~~~~~~~~fNigs~~~~s~~e~~~~i~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~d~~K~~~~Lgw~p~~~l  313 (358)
                      +++..+++||||++++.++.++++.++++++.....    .......+.+.++||+++.++.+|++|++++|||+|+++|
T Consensus       241 ~~~~~ge~yNiG~g~~~~~~~~~~~i~~~~~~l~~~~~~~~~~~~~~i~~~~~rp~~~~~~~~D~ska~~~LGw~P~~sl  320 (355)
T PRK10217        241 TTGKVGETYNIGGHNERKNLDVVETICELLEELAPNKPHGVAHYRDLITFVADRPGHDLRYAIDASKIARELGWLPQETF  320 (355)
T ss_pred             HCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEECCCCCCCCCEEEECHHHHHHHHCCCCCCCH
T ss_conf             66999997997999962079999999999997623566554443455156799999985632288999998499889999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999886786553231
Q gi|254780920|r  314 ESGLNKTVCWYLDNNWWWRPLYK  336 (358)
Q Consensus       314 ~egi~~~i~w~~~n~~~~~~~~~  336 (358)
                      +|||++|++||++|.+||+++..
T Consensus       321 eeGl~~ti~Wy~~n~~~~~~~~~  343 (355)
T PRK10217        321 ESGMRKTVQWYLANESWWKQVQD  343 (355)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             99999999999988999987655


No 5  
>TIGR01179 galE UDP-glucose 4-epimerase; InterPro: IPR005886    Synonym: UDP-galactose 4-epimerase UDP-glucose 4-epimerase (5.1.3.2 from EC) interconverts UDP-glucose and UDP-galactose which are precursors of glucose- and galactose-containing exopolysaccharides (EPS). A set of related proteins, some of which are tentatively identified as UDP-glucose-4-epimerase in Thermotoga maritima, Bacillus halodurans, and several archaea, but deeply branched from this set and lacking experimental evidence, are excluded and described by a separate model. ; GO: 0003978 UDP-glucose 4-epimerase activity, 0006012 galactose metabolic process.
Probab=100.00  E-value=0  Score=528.22  Aligned_cols=309  Identities=28%  Similarity=0.455  Sum_probs=276.5

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH--CCCCEEEEECCCCCHHHHHHHHH----HCCCC
Q ss_conf             4899767882779999999986898799994788765856777620--37974999763889999999986----22787
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS--QSNLFSFLQVDICDRECIRSALK----EFQPD   75 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~--~~~~v~~i~~Di~d~~~l~~~~~----~~~~d   75 (358)
                      |||||||+||||||+|++|+++ ||+|+++||++. ++.+-++...  ..+.+.||++||.|.+.|+.+|.    +.+||
T Consensus         1 ~iLVTGGAGYIGSHt~~~Ll~~-G~ev~vlDNLs~-G~~~~l~~~~~~~G~~~~fv~gDL~D~~~l~~~f~kqql~~~id   78 (341)
T TIGR01179         1 KILVTGGAGYIGSHTVRQLLES-GYEVVVLDNLSN-GSAEALKRGEEITGKEVTFVEGDLRDRELLRRVFEKQQLEHKID   78 (341)
T ss_pred             CEEEEECCCCCHHHHHHHHHHC-CCEEEEEECCCC-CCHHHHCCCCEECCCCCEEEEECCHHHHHHHHHHHHHHHCCCCC
T ss_conf             9268614664435887887635-972899815788-84887500234148532058717515799999987743116754


Q ss_pred             EEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCC-CC
Q ss_conf             17851234332222222222222222222024788865123221124784278630554311222222222222222-22
Q gi|254780920|r   76 AIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYN-PS  154 (358)
Q Consensus        76 ~ViHlAa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~-p~  154 (358)
                      +||||||...|++|..+|.+|+++||.||++||++|+.         .++++|||+||++|||.+.+.|++|++|++ |.
T Consensus        79 AViHFAg~~~VgESv~~Pl~YY~NNv~nTl~L~~~m~~---------~GV~~~iFSSsAaVYG~p~~~Pi~E~~pl~~Pi  149 (341)
T TIGR01179        79 AVIHFAGLIAVGESVQKPLKYYRNNVVNTLNLLEAMQE---------TGVKKFIFSSSAAVYGEPESIPISEDSPLGDPI  149 (341)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH---------HCCCCEEECCCCEEECCCCCCCCCCCCCCCCCC
T ss_conf             67520112125255752454400046899999999998---------189741530421450778855502225677874


Q ss_pred             CCCCCCCCCCEEEECCCCCC-CCCCCCCCCCCCCCCC---C-CC-------CCCCCCCCCCCCC-CCCCCCCCC------
Q ss_conf             22233322100000012333-2222222222222333---2-22-------2222222222222-222222222------
Q gi|254780920|r  155 SPYSATKASSDYLVLAWGHT-YGIPVLLSNCSNNYGP---Y-HF-------PEKLIPLAITRMI-EGSHVFLYG------  215 (358)
Q Consensus       155 s~Yg~sK~~~E~~~~~~~~~-~~l~~~ilR~~~vyGp---~-~~-------~~~~i~~~i~~~~-~g~~~~i~g------  215 (358)
                      ||||.||+|.|++++++++. +++++++||.||+.|.   + ..       ++++||.....|. +..++.+||      
T Consensus       150 nPYG~sKlM~E~iL~D~~~a~~~~~~v~LRYFNv~GA~p~GY~iGe~~~~~tNhLip~~~~~A~G~~~~l~IFGtDYPT~  229 (341)
T TIGR01179       150 NPYGRSKLMVERILRDLSKADPDLSYVILRYFNVAGADPEGYEIGEDPPGITNHLIPYACQVAVGKRDKLTIFGTDYPTP  229 (341)
T ss_pred             CCCCCCHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCEECCCCCCCC
T ss_conf             86655668899999999873876779985057851448887723668520294189999998448997313624878767


Q ss_pred             CCCCCCCCCCCCCCCCCEEECCCC---CCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCEEECCCCCCCCC
Q ss_conf             223322113322220000000122---22222111357864202688999988603426555686430233488998653
Q gi|254780920|r  216 DGQNVRDWLYVEDHVRALYLVLKK---GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDR  292 (358)
Q Consensus       216 ~g~~~Rdfi~v~D~a~~i~~~~~~---~~~~~~fNigs~~~~s~~e~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  292 (358)
                      ||+++||||||+|+|+|++.||+.   +...++||+|.|+.+|++|+++.+.++.|..++        .++.+.|+||++
T Consensus       230 DGTcvRDYIHV~DLA~AH~~Al~~L~~g~~s~~~NlG~G~G~SV~EVi~a~~~vsG~~~~--------~~~~~RR~GDpa  301 (341)
T TIGR01179       230 DGTCVRDYIHVMDLAEAHLAALEYLENGGESHVYNLGYGQGFSVLEVIEAFKKVSGKDIP--------VELAPRRPGDPA  301 (341)
T ss_pred             CCCEEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHHHHHHHHCCCEEE--------EEECCCCCCCCC
T ss_conf             987653002002077789999999860796369862467541099999998661098137--------887687798845


Q ss_pred             EECCCHHHHHHHHCCCCCCC-HHHHHHHHHHHHHHHHH
Q ss_conf             00317189999818966108-99999999999988678
Q gi|254780920|r  293 RYAIDSSKIKSEIGWFPQEN-MESGLNKTVCWYLDNNW  329 (358)
Q Consensus       293 ~~~~d~~K~~~~Lgw~p~~~-l~egi~~~i~w~~~n~~  329 (358)
                      .+++|.+|++++|||+|+++ ||+.|+..++|.+.++.
T Consensus       302 ~l~Ada~ki~~~LgW~p~y~~Le~i~~~AW~W~~~~~~  339 (341)
T TIGR01179       302 SLVADASKIRRELGWQPKYDDLEIIIKTAWRWESRNPN  339 (341)
T ss_pred             EEECCHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHCCC
T ss_conf             48738699997538534568889999999999986578


No 6  
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional
Probab=100.00  E-value=0  Score=486.49  Aligned_cols=317  Identities=19%  Similarity=0.282  Sum_probs=267.3

Q ss_pred             CE-EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCC-CHHHHHHHHHHCCCCEEE
Q ss_conf             94-8997678827799999999868987999947887658567776203797499976388-999999998622787178
Q gi|254780920|r    1 MR-LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC-DRECIRSALKEFQPDAIV   78 (358)
Q Consensus         1 Mk-ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~-d~~~l~~~~~~~~~d~Vi   78 (358)
                      || ||||||+|||||||+++|+++.+++|+++|+...     +.......++++|+++|++ +.+.++.+++  ++|+||
T Consensus         1 MKkILVTGgaGFIGs~Lv~~Ll~~~~~~V~~~d~~~~-----~~~~~~~~~~~~~~~gDi~~~~~~~~~~~~--~~D~V~   73 (347)
T PRK11908          1 MKKVLILGVNGFIGHHLTKRILETTDWEVYGMDMQTD-----RLGDLVNHPRMHFFEGDITINKEWIEYHVK--KCDVVL   73 (347)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCC-----CHHHHCCCCCEEEEECCCCCCHHHHHHHHC--CCCEEE
T ss_conf             9889997574389999999999828978999979976-----367755799859997754469999997660--598897


Q ss_pred             EECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCC-------
Q ss_conf             5123433222222222222222222202478886512322112478427863055431122222222222222-------
Q gi|254780920|r   79 NFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPY-------  151 (358)
Q Consensus        79 HlAa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~-------  151 (358)
                      ||||.+++..+..+|..++++|+.||.+++++|+..         + ++|||+||++|||.....+++|++++       
T Consensus        74 HlAa~~~~~~~~~~p~~~~~~nv~~t~~ll~~~~~~---------~-~r~if~SS~~VYG~~~~~~~~~~~~~~~~~p~~  143 (347)
T PRK11908         74 PLVAIATPATYVKQPLRVFELDFEANLPIVRSAVKY---------G-KHLVFPSTSEVYGMCSDEEFDPEASALTYGPIN  143 (347)
T ss_pred             EEHHCCCHHHHHHCHHHHHHHHHHHHHHHHHHHHHH---------C-CEEEECCCCEEECCCCCCCCCCCCCCCCCCCCC
T ss_conf             520003648888688999999999999999999973---------9-838962661265478999989777876578877


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCC--------CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222233322100000012333222222222222233322--------2222222222222222222222222332211
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYH--------FPEKLIPLAITRMIEGSHVFLYGDGQNVRDW  223 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~--------~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdf  223 (358)
                      .|.++||.||.++|.+++.|+++++++++++||+|+|||+.        ...++++.|+.++++|+++.++|+|+|+|||
T Consensus       144 ~p~~~Y~~sK~~~E~l~~~y~~~~~l~~~ilR~~nvyGP~~~~~~~~~~~~~~vi~~~i~~~~~g~~i~i~g~G~~~Rdf  223 (347)
T PRK11908        144 KPRWIYACSKQLMDRVIWAYGMEEGLNFTLFRPFNWIGPGLDSIYTPKEGSSRVVTQFLGHIVRGEPISLVDGGSQKRAF  223 (347)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCEECCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECC
T ss_conf             86547789999999999999998589879997666766996655685446320279999999838984035999710367


Q ss_pred             CCCCCCCCCEEECCCCC---CCCCCCCCCC-CCCCCHHHHHHHHHHHHCCCCCCCCCCCCCEEEC--------CCCCCCC
Q ss_conf             33222200000001222---2222111357-8642026889999886034265556864302334--------8899865
Q gi|254780920|r  224 LYVEDHVRALYLVLKKG---RIGERYNIGG-NNERKNIDIVFEIGFLLDALIPKSYSHTELIRFI--------EDRPGHD  291 (358)
Q Consensus       224 i~v~D~a~~i~~~~~~~---~~~~~fNigs-~~~~s~~e~~~~i~~~~~~~~~~~~~~~~~~~~~--------~~~~~~~  291 (358)
                      +||+|+++|+++++++.   ..+++||||+ ++.+|+.|+++.+.++++......... ......        +....|+
T Consensus       224 ~yV~D~v~a~~~~l~~~~~~~~~~i~NIGs~~~~~si~el~~~i~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~D~  302 (347)
T PRK11908        224 TDIDDGISALMKIIENKDGVASGKIYNIGNPKNNFSVRELAEKMLELAAEYPEYADSA-KKVKLVETTSGAYYGKGYQDV  302 (347)
T ss_pred             EEHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCCEEHHHHHHHHHHHHCCCCCCCCCH-HCCEEEECCCCCCCCCCCCCH
T ss_conf             8667999999999967788888997995889986369999999999860252003521-015034248864456554435


Q ss_pred             CEECCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             30031718999981896610899999999999988678655323
Q gi|254780920|r  292 RRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLY  335 (358)
Q Consensus       292 ~~~~~d~~K~~~~Lgw~p~~~l~egi~~~i~w~~~n~~~~~~~~  335 (358)
                      .+..+|++|++++|||+|+++|+|||++|++|||+|-.++|.+.
T Consensus       303 ~~~~~di~ka~~~LGw~P~~sleeGl~~ti~wyk~~~~~~~~~~  346 (347)
T PRK11908        303 QNRVPKIDNTMQELGWAPQTTFDDALRRIFEAYRGHVADARALV  346 (347)
T ss_pred             HHCCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             44202769999984996589699999999999987587455531


No 7  
>PRK10675 UDP-galactose-4-epimerase; Provisional
Probab=100.00  E-value=0  Score=483.04  Aligned_cols=312  Identities=24%  Similarity=0.384  Sum_probs=265.4

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHH--HCCCCEEEEECCCCCHHHHHHHHHHCCCCEEE
Q ss_conf             9489976788277999999998689879999478876585677762--03797499976388999999998622787178
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEI--SQSNLFSFLQVDICDRECIRSALKEFQPDAIV   78 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~--~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~Vi   78 (358)
                      ||||||||+||||||||++|+++ |++|+++|++..... ..++.+  ...+.++|+++||+|...+++++++.+||+||
T Consensus         1 MkvLVTGg~GFIGs~l~~~Ll~~-g~~V~~~d~~~~~~~-~~~~~~~~~~~~~~~~~~~Di~d~~~~~~~~~~~~~d~V~   78 (338)
T PRK10675          1 MRVLVTGGSGYIGSHTCVQLLQN-GHDVVILDNLCNSKR-SVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVI   78 (338)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCCCCCH-HHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHCCCCEEE
T ss_conf             91999898767999999999978-498999988988737-6788888614788759983279989999999865999999


Q ss_pred             EECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCC-CCCCCC
Q ss_conf             5123433222222222222222222202478886512322112478427863055431122222222222222-222222
Q gi|254780920|r   79 NFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPY-NPSSPY  157 (358)
Q Consensus        79 HlAa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~-~p~s~Y  157 (358)
                      ||||.++++.+..+|..++++|+.||.|||++|+.         .++++|||+||++|||+....|.+|+.+. .|.++|
T Consensus        79 HlAa~~~~~~~~~~p~~~~~~Nv~gt~nllea~~~---------~~vkr~v~~SS~~vYG~~~~~p~~E~~~~~~P~s~Y  149 (338)
T PRK10675         79 HFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRA---------ANVKNLIFSSSATVYGDQPKIPYVESFPTGTPQSPY  149 (338)
T ss_pred             ECCCCCCCCCHHHCHHHHHHHHHHHHHHHHHHHHH---------CCCCEEEEECCCEEECCCCCCCEECCCCCCCCCCCC
T ss_conf             89865454621109899988689889999999997---------398879996372033789889800247899999941


Q ss_pred             CCCCCCCEEEECCCCC-CCCCCCCCCCCCCCCCCCCCC----------CCCCCCCCCCCC--CCCCCCCCC------CCC
Q ss_conf             3332210000001233-322222222222223332222----------222222222222--222222222------223
Q gi|254780920|r  158 SATKASSDYLVLAWGH-TYGIPVLLSNCSNNYGPYHFP----------EKLIPLAITRMI--EGSHVFLYG------DGQ  218 (358)
Q Consensus       158 g~sK~~~E~~~~~~~~-~~~l~~~ilR~~~vyGp~~~~----------~~~i~~~i~~~~--~g~~~~i~g------~g~  218 (358)
                      |.||+++|+++..|.+ .++++++++|++++|||+...          ..+++ ++.++.  ++.++.++|      +|+
T Consensus       150 g~sK~~~E~~l~~~~~~~~~~~~~i~R~fn~~G~~~~~~~g~~~~~~~~~~~~-~i~~~~~~~~~~l~i~G~~~~~~dG~  228 (338)
T PRK10675        150 GKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMP-YIAQVAVGRRDSLAIFGNDYPTEDGT  228 (338)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCCCCCCCCHHHHHH-HHHHHHHCCCCEEEECCCCCCCCCCC
T ss_conf             35578999999999987689868999663542547777668797321679999-99999844787077527975467998


Q ss_pred             CCCCCCCCCCCCCCEEECCCC--CC-CCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCEEECCCCCCCCCEEC
Q ss_conf             322113322220000000122--22-222111357864202688999988603426555686430233488998653003
Q gi|254780920|r  219 NVRDWLYVEDHVRALYLVLKK--GR-IGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYA  295 (358)
Q Consensus       219 ~~Rdfi~v~D~a~~i~~~~~~--~~-~~~~fNigs~~~~s~~e~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  295 (358)
                      |.|||+||+|+|++++++++.  +. ..++||||+|+++|+.|+++.+.++.++...        ..+.+.|+++...+.
T Consensus       229 ~~Rdfi~V~D~~~a~~~a~~~~~~~~~~~i~Nigsg~~~si~el~~~i~~~~g~~~~--------~~~~~~r~~d~~~~~  300 (338)
T PRK10675        229 GVRDYIHVMDLADGHVVAMEKLANKPGVHIYNLGAGVGSSVLDVVNAFSKACGKPVN--------YHFAPRREGDLPAYW  300 (338)
T ss_pred             CCCCCEEHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCEEHHHHHHHHHHHHCCCCC--------EEECCCCCCCCCEEE
T ss_conf             665633187799999999997416898458996799757899999999999789977--------366899999878743


Q ss_pred             CCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             1718999981896610899999999999988678655
Q gi|254780920|r  296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR  332 (358)
Q Consensus       296 ~d~~K~~~~Lgw~p~~~l~egi~~~i~w~~~n~~~~~  332 (358)
                      +|++|++++|||+|+++|+|||++|++||++|+.+|.
T Consensus       301 ~d~~ka~~~LGw~p~~sl~egl~~t~~W~~~~~~~~~  337 (338)
T PRK10675        301 ADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYP  337 (338)
T ss_pred             ECHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCCC
T ss_conf             8799999982998588999999999999995845299


No 8  
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane]
Probab=100.00  E-value=0  Score=456.01  Aligned_cols=305  Identities=28%  Similarity=0.448  Sum_probs=269.4

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEE
Q ss_conf             94899767882779999999986898799994788765856777620379749997638899999999862278717851
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNF   80 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~ViHl   80 (358)
                      |+||||||+||||||.|.+|++ .|++|+++||++.+ +...+....    .+|+++||+|.+.|+++|++.+||.||||
T Consensus         1 ~~iLVtGGAGYIGSHtv~~Ll~-~G~~vvV~DNL~~g-~~~~v~~~~----~~f~~gDi~D~~~L~~vf~~~~idaViHF   74 (329)
T COG1087           1 MKVLVTGGAGYIGSHTVRQLLK-TGHEVVVLDNLSNG-HKIALLKLQ----FKFYEGDLLDRALLTAVFEENKIDAVVHF   74 (329)
T ss_pred             CEEEEECCCCHHHHHHHHHHHH-CCCEEEEEECCCCC-CHHHHHHCC----CCEEEECCCCHHHHHHHHHHCCCCEEEEC
T ss_conf             9299965865468999999997-89848999568878-888860204----85688334319999999986499889987


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             23433222222222222222222202478886512322112478427863055431122222222222222222222333
Q gi|254780920|r   81 AAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSAT  160 (358)
Q Consensus        81 Aa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~s~Yg~s  160 (358)
                      ||...|++|.++|..++++|+.||++||++|+.         .++++|||+||++|||.+...|+.|++|..|.||||.|
T Consensus        75 Aa~~~VgESv~~Pl~Yy~NNv~gTl~Ll~am~~---------~gv~~~vFSStAavYG~p~~~Pi~E~~~~~p~NPYG~s  145 (329)
T COG1087          75 AASISVGESVQNPLKYYDNNVVGTLNLIEAMLQ---------TGVKKFIFSSTAAVYGEPTTSPISETSPLAPINPYGRS  145 (329)
T ss_pred             CCCCCCCHHHHCHHHHHHHCHHHHHHHHHHHHH---------HCCCEEEEECCCHHCCCCCCCCCCCCCCCCCCCCCHHH
T ss_conf             300432344418788886030869999999998---------29976999243010389987664788888998853157


Q ss_pred             CCCCEEEECCCCCCCCCCCCCCCCCCCCCCCC------C---CCCCCCCCCCCCCCC-CCCCCCC------CCCCCCCCC
Q ss_conf             22100000012333222222222222233322------2---222222222222222-2222222------223322113
Q gi|254780920|r  161 KASSDYLVLAWGHTYGIPVLLSNCSNNYGPYH------F---PEKLIPLAITRMIEG-SHVFLYG------DGQNVRDWL  224 (358)
Q Consensus       161 K~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~------~---~~~~i~~~i~~~~~g-~~~~i~g------~g~~~Rdfi  224 (358)
                      |++.|++++.+++.++++++++|.||+-|...      .   .+++||..+..++-. ..+.+||      ||++.||||
T Consensus       146 Klm~E~iL~d~~~a~~~~~v~LRYFN~aGA~~~G~iGe~~~~~thLip~~~q~A~G~r~~l~ifG~DY~T~DGT~iRDYI  225 (329)
T COG1087         146 KLMSEEILRDAAKANPFKVVILRYFNVAGACPDGTLGQRYPGATLLIPVAAEAALGKRDKLFIFGDDYDTKDGTCIRDYI  225 (329)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCEEEEECCCCCCCCCCEEEEEE
T ss_conf             99999999999871697289998513356798876677999933688999999846886557848989999987022343


Q ss_pred             CCCCCCCCEEECCCCC---CCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCEEECCCCCCCCCEECCCHHHH
Q ss_conf             3222200000001222---2222111357864202688999988603426555686430233488998653003171899
Q gi|254780920|r  225 YVEDHVRALYLVLKKG---RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSSKI  301 (358)
Q Consensus       225 ~v~D~a~~i~~~~~~~---~~~~~fNigs~~~~s~~e~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~K~  301 (358)
                      ||.|+|+|++++++.-   ....+||+|+|..+|++|+++.+.++.+..++        .++.+.|+||+..+++|++||
T Consensus       226 HV~DLA~aHv~Al~~L~~~g~~~~~NLG~G~G~SV~evi~a~~~vtg~~ip--------~~~~~RR~GDpa~l~Ad~~kA  297 (329)
T COG1087         226 HVDDLADAHVLALKYLKEGGSNNIFNLGSGNGFSVLEVIEAAKKVTGRDIP--------VEIAPRRAGDPAILVADSSKA  297 (329)
T ss_pred             EHHHHHHHHHHHHHHHHHCCCEEEEECCCCCCEEHHHHHHHHHHHHCCCCC--------EEECCCCCCCCCEEEECHHHH
T ss_conf             246679999999999981896048974689752499999999998699576--------265788999961147678999


Q ss_pred             HHHHCCCCCC-CHHHHHHHHHHHHH-HHH
Q ss_conf             9981896610-89999999999998-867
Q gi|254780920|r  302 KSEIGWFPQE-NMESGLNKTVCWYL-DNN  328 (358)
Q Consensus       302 ~~~Lgw~p~~-~l~egi~~~i~w~~-~n~  328 (358)
                      +++|||+|++ ++++.+++.++|+. +|+
T Consensus       298 ~~~LgW~p~~~~L~~ii~~aw~W~~~~~~  326 (329)
T COG1087         298 RQILGWQPTYDDLEDIIKDAWDWHQQRHG  326 (329)
T ss_pred             HHHHCCCCCCCCHHHHHHHHHHHHHHHCC
T ss_conf             98839976337899999988777664168


No 9  
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional
Probab=100.00  E-value=0  Score=424.79  Aligned_cols=295  Identities=22%  Similarity=0.253  Sum_probs=233.4

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCC-EEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHH-HHHHHHH---CCCCEE
Q ss_conf             899767882779999999986898-79999478876585677762037974999763889999-9999862---278717
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKI-QVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDREC-IRSALKE---FQPDAI   77 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~-~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~-l~~~~~~---~~~d~V   77 (358)
                      ||||||+|||||||++.|+++ |+ +|+++|+++...+..++        .++-.+|..+.+. +.+++..   .++|+|
T Consensus         2 ILVTGgaGFIGS~l~~~L~~~-G~~~V~~~Dnl~~~~~~~~l--------~~~~~~d~~~~~~~~~~~~~~~~~~~id~V   72 (308)
T PRK11150          2 IIVTGGAGFIGSNIVKALNDK-GITDILVVDNLKDGTKFVNL--------VDLDIADYMDKEDFLAQIMAGDDFGDIEAI   72 (308)
T ss_pred             EEEEECCCHHHHHHHHHHHHC-CCCCEEEEECCCCCCCCCCC--------CCCCCCHHCCHHHHHHHHHHCCCCCCCCEE
T ss_conf             999405979999999999977-99809999789997313012--------356310120389999998611345787689


Q ss_pred             EEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             85123433222222222222222222202478886512322112478427863055431122222222222222222222
Q gi|254780920|r   78 VNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPY  157 (358)
Q Consensus        78 iHlAa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~s~Y  157 (358)
                      ||+||.+++..  .++...+++|+.||.|+|++|+.         .++ +|||+||++|||+....|.+|++++.|.|+|
T Consensus        73 ~Hlaa~~~~~~--~~~~~~~~~n~~~t~nll~~~~~---------~~~-~~i~aSSs~vYG~~~~~~~~E~~~~~P~s~Y  140 (308)
T PRK11150         73 FHEGACSSTTE--WDGKYMMDNNYQYSKELLHYCLE---------REI-PFLYASSAATYGGRTSDFIEEREYEKPLNVY  140 (308)
T ss_pred             EECCCCCCCCC--CCCCHHHHHHHHHHHHHHHHHHH---------CCC-CEEEECCHHHHCCCCCCCCCCCCCCCCCCHH
T ss_conf             99986666645--56511321499999999999997---------499-8899547564089888986568889986876


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCC
Q ss_conf             333221000000123332222222222222333222222----222222222222222222-222332211332222000
Q gi|254780920|r  158 SATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEK----LIPLAITRMIEGSHVFLY-GDGQNVRDWLYVEDHVRA  232 (358)
Q Consensus       158 g~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~~~~----~i~~~i~~~~~g~~~~i~-g~g~~~Rdfi~v~D~a~~  232 (358)
                      |.||+++|++++.|+++++++++++|+||||||++....    +++.++.++++|+++.++ |+|+++|||+||+|+|++
T Consensus       141 g~sK~~~E~~~~~~~~~~~~~~~~lR~fnvYGP~~~~~~~~~~v~~~~~~~~~~g~~~~~~~G~g~~~RDfiyV~Dv~~a  220 (308)
T PRK11150        141 GYSKFLFDEYVRQILPEANSQICGFRYFNVYGPREGHKGSMASVAFHLNNQLNNGENPKLFEGSENFKRDFVYVGDVAAV  220 (308)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCEEEEEEEEECCCCCCCCCCCCHHHHHHHHHHCCCCCEEECCCCCEEEEEEEHHHHHHH
T ss_conf             76099999999999998399828987623789597888873207999999997799974753999878845778999999


Q ss_pred             EEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCEEECCCCCCC-CCEECCCHHHHHHHHCCCCCC
Q ss_conf             0000122222221113578642026889999886034265556864302334889986-530031718999981896610
Q gi|254780920|r  233 LYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH-DRRYAIDSSKIKSEIGWFPQE  311 (358)
Q Consensus       233 i~~~~~~~~~~~~fNigs~~~~s~~e~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~d~~K~~~~Lgw~p~~  311 (358)
                      ++.++++...+ +||||+|+++|+.|+++.|.++.++. +...     +++...+++. .....+|++|+++.++|+|++
T Consensus       221 ~~~~~~~~~~g-v~NiGsg~~~si~el~~~i~~~~g~~-~i~~-----i~~p~~~~~~~~~~~~aDisK~~~lg~~~p~~  293 (308)
T PRK11150        221 NLWFLENGVSG-IFNLGTGRAESFQAVADAVLAYHKKG-EIEY-----IPFPDKLKGRYQAFTQADLTKLRAAGYDKPFK  293 (308)
T ss_pred             HHHHHHCCCCC-EEEECCCCCEEHHHHHHHHHHHHCCC-CCEE-----CCCCCCCCCCCCEEEECCHHHHHHHHCCCCCC
T ss_conf             99998569987-49987999697999999999984988-7124-----26854457777511125699999825899987


Q ss_pred             CHHHHHHHHHHHHH
Q ss_conf             89999999999998
Q gi|254780920|r  312 NMESGLNKTVCWYL  325 (358)
Q Consensus       312 ~l~egi~~~i~w~~  325 (358)
                      +|+|||++|++||+
T Consensus       294 sleeGl~~tv~W~~  307 (308)
T PRK11150        294 TVAEGVTEYMAWLN  307 (308)
T ss_pred             CHHHHHHHHHHHHC
T ss_conf             99999999999965


No 10 
>KOG0747 consensus
Probab=100.00  E-value=0  Score=424.00  Aligned_cols=317  Identities=41%  Similarity=0.715  Sum_probs=296.6

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHC-CCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEE
Q ss_conf             48997678827799999999868-98799994788765856777620379749997638899999999862278717851
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDL-KIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNF   80 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~-~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~ViHl   80 (358)
                      +||||||+|||||+.++.+..+. .++.+.+|.+...++...++.....++..|+++|+.+...+..++...++|.|+|+
T Consensus         8 ~vlItgg~gfi~Sn~~~~~~~~~p~~~~v~idkL~~~s~~~~l~~~~n~p~ykfv~~di~~~~~~~~~~~~~~id~vihf   87 (331)
T KOG0747           8 NVLITGGAGFIGSNFINYLVDKYPDYKFVNLDKLDYCSNLKNLEPVRNSPNYKFVEGDIADADLVLYLFETEEIDTVIHF   87 (331)
T ss_pred             EEEEECCCCCCCHHHHHHCCCCCCCCCEEEEECCCCCCCHHHHHHHCCCCCCEEEECHHCCCHHHHHHHCCCCHHHHHHH
T ss_conf             08985476753113455334679987778762000024313544312588716860301050998765336715777767


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCC-CCCCCCCCCCCCC
Q ss_conf             234332222222222222222222024788865123221124784278630554311222222222-2222222222233
Q gi|254780920|r   81 AAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFS-EDMPYNPSSPYSA  159 (358)
Q Consensus        81 Aa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~-E~~~~~p~s~Yg~  159 (358)
                      ||..++++|+-+|..++.+|+++|..+|++++.+.        +.++|||.||++|||++...... |.+.+.|.+||++
T Consensus        88 aa~t~vd~s~~~~~~~~~nnil~t~~Lle~~~~sg--------~i~~fvhvSTdeVYGds~~~~~~~E~s~~nPtnpyAa  159 (331)
T KOG0747          88 AAQTHVDRSFGDSFEFTKNNILSTHVLLEAVRVSG--------NIRRFVHVSTDEVYGDSDEDAVVGEASLLNPTNPYAA  159 (331)
T ss_pred             HHHHHHHHHHCCHHHHHCCCCHHHHHHHHHHHHCC--------CEEEEEEECCCCEECCCCCCCCCCCCCCCCCCCCHHH
T ss_conf             76641466507658774576034577999988504--------7347999646402347664456332256899980378


Q ss_pred             CCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCC
Q ss_conf             32210000001233322222222222223332222222222222222222222222223322113322220000000122
Q gi|254780920|r  160 TKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK  239 (358)
Q Consensus       160 sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~a~~i~~~~~~  239 (358)
                      +|+|+|+++++|.++|+++++++|..|||||++++..+||.||..+..+++..+.|+|.+.|+|+||+|+++|+..++++
T Consensus       160 sKaAaE~~v~Sy~~sy~lpvv~~R~nnVYGP~q~~~klipkFi~l~~~~~~~~i~g~g~~~rs~l~veD~~ea~~~v~~K  239 (331)
T KOG0747         160 SKAAAEMLVRSYGRSYGLPVVTTRMNNVYGPNQYPEKLIPKFIKLAMRGKEYPIHGDGLQTRSYLYVEDVSEAFKAVLEK  239 (331)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHHCCCCCEECCCCCCEEEEEHHHHHHHHHHHHHC
T ss_conf             89999999999876049717999415733888571677688999997189764215741012257699999999999845


Q ss_pred             CCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCEEECCCCCCCCCEECCCHHHHHHHHCCCCCCCHHHHHHH
Q ss_conf             22222111357864202688999988603426555686430233488998653003171899998189661089999999
Q gi|254780920|r  240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSSKIKSEIGWFPQENMESGLNK  319 (358)
Q Consensus       240 ~~~~~~fNigs~~~~s~~e~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~K~~~~Lgw~p~~~l~egi~~  319 (358)
                      +..|++||||+..+++..|+++.|.+++++... .....+.+.+.++||....++.+|.+|++ .|||+|+++|++||++
T Consensus       240 g~~geIYNIgtd~e~~~~~l~k~i~eli~~~~~-~~~~~p~~~~v~dRp~nd~Ry~~~~eKik-~LGw~~~~p~~eGLrk  317 (331)
T KOG0747         240 GELGEIYNIGTDDEMRVIDLAKDICELFEKRLP-NIDTEPFIFFVEDRPYNDLRYFLDDEKIK-KLGWRPTTPWEEGLRK  317 (331)
T ss_pred             CCCCCEEECCCCCHHHHHHHHHHHHHHHHHHCC-CCCCCCCCEECCCCCCCCCCCCCCHHHHH-HCCCCCCCCHHHHHHH
T ss_conf             785623641683076699999999999997546-88888863315888764201000588897-5387215767888999


Q ss_pred             HHHHHHHHH
Q ss_conf             999998867
Q gi|254780920|r  320 TVCWYLDNN  328 (358)
Q Consensus       320 ~i~w~~~n~  328 (358)
                      ||+||.+|.
T Consensus       318 tie~y~~~~  326 (331)
T KOG0747         318 TIEWYTKNF  326 (331)
T ss_pred             HHHHHHHHH
T ss_conf             999998644


No 11 
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase; InterPro: IPR013445    This entry contains CDP-glucose 4,6-dehydratases from a variety of Gram-negative and Gram-positive bacteria. Members are typically encoded next to a gene that encodes a glucose-1-phosphate cytidylyltransferase, which produces the substrate CDP-D-glucose. This is used by the proteins in this entry to produce CDP-4-keto-6-deoxyglucose..
Probab=100.00  E-value=0  Score=402.76  Aligned_cols=309  Identities=24%  Similarity=0.402  Sum_probs=257.2

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCE------EEEECCCCCHHHHHHHHHHCCCC
Q ss_conf             489976788277999999998689879999478876585677762037974------99976388999999998622787
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLF------SFLQVDICDRECIRSALKEFQPD   75 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v------~~i~~Di~d~~~l~~~~~~~~~d   75 (358)
                      ||||||.|||-||+|+-+|. +.|.+|.|+- +.+....+.++.....+..      ..+.+||+|.+.|++++++++||
T Consensus         6 kVl~TGHTGFKGSWL~lWL~-~lGA~V~GYS-L~P~t~PnlFe~l~l~~~~~~~Wyf~~~~gDIrD~~~L~~~~~~~~Pe   83 (361)
T TIGR02622         6 KVLITGHTGFKGSWLSLWLL-ELGAEVAGYS-LDPPTSPNLFELLNLAKKIKDSWYFSSIFGDIRDAAKLEKAIAEFKPE   83 (361)
T ss_pred             EEEEECCCCCCHHHHHHHHH-HCCCEEEEEE-CCCCCCCCHHHHHHHHHHHHCCEEEEEEEECCCCHHHHHHHHHHCCCC
T ss_conf             78984578642558999998-4796798971-688788405557525424323505542330323278999999972898


Q ss_pred             EEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCC-CCCCCCCCCCC
Q ss_conf             17851234332222222222222222222024788865123221124784278630554311222222-22222222222
Q gi|254780920|r   76 AIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKG-LFSEDMPYNPS  154 (358)
Q Consensus        76 ~ViHlAa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~-~~~E~~~~~p~  154 (358)
                      +||||||++.|+.|+.+|.++++|||+||.||||++|..        ..++.+|.++|+.||...+-. .+.|+++++..
T Consensus        84 IvFHlAAQPLVr~SY~~P~~Tf~TNVmGT~~lLea~r~~--------~~~~a~v~vTsDK~Y~N~EW~wgYRE~D~LGGh  155 (361)
T TIGR02622        84 IVFHLAAQPLVRKSYADPLETFETNVMGTVNLLEAIRAI--------KSVKAVVLVTSDKVYENKEWVWGYRETDPLGGH  155 (361)
T ss_pred             EEEHHHHHHHHHHHHHCHHHHEEEHHHHHHHHHHHHHHC--------CCCEEEEEEECCEEECCCCCCCCCCCCCCCCCC
T ss_conf             983335427889867320202220032225778899746--------995699986167233078788752324788771


Q ss_pred             CCCCCCCCCCEEEECCCCC----------CCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2223332210000001233----------32222222222222333222-222222222222222222222222332211
Q gi|254780920|r  155 SPYSATKASSDYLVLAWGH----------TYGIPVLLSNCSNNYGPYHF-PEKLIPLAITRMIEGSHVFLYGDGQNVRDW  223 (358)
Q Consensus       155 s~Yg~sK~~~E~~~~~~~~----------~~~l~~~ilR~~~vyGp~~~-~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdf  223 (358)
                      +||+.||.+||.++.+|+.          ++++.+.++|.+||.|.||+ .||+||..|+++..|+.+.| .+|+.+|+|
T Consensus       156 DPYS~SKAcAELv~~syR~SF~~~~~f~~~h~~~iAsaRAGNVIGGGDWs~DRliPD~irA~~~n~~v~I-RnP~A~RPW  234 (361)
T TIGR02622       156 DPYSSSKACAELVIASYRSSFFGEANFQSTHGIKIASARAGNVIGGGDWSEDRLIPDVIRALSSNKIVTI-RNPDATRPW  234 (361)
T ss_pred             CCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCCCCCCCHHHCCHHHHHHHHHCCCEEEE-ECCCCCCCC
T ss_conf             6775328999999999986068888755468636899860640476750010417899996426873774-377885897


Q ss_pred             CCCCCCCCCEEECCCC-----CCCCC-CCCCCCC--CCCCHHHHHHHHHHHHCCCCCCCCCCCCCEEECCCCCCCCCEEC
Q ss_conf             3322220000000122-----22222-1113578--64202688999988603426555686430233488998653003
Q gi|254780920|r  224 LYVEDHVRALYLVLKK-----GRIGE-RYNIGGN--NERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYA  295 (358)
Q Consensus       224 i~v~D~a~~i~~~~~~-----~~~~~-~fNigs~--~~~s~~e~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  295 (358)
                      .||-|.-.+++++.++     ....+ .||.|..  +..++.+++....+...-.-. ....    ...+..|-+...+.
T Consensus       235 QHVLEPL~GYLlLAekL~~~~~~~~~eafNFGP~~~~~~~v~~~v~~~~~~~~g~~~-~~~~----~~~~~~PhEA~lL~  309 (361)
T TIGR02622       235 QHVLEPLSGYLLLAEKLFEGQAELAGEAFNFGPEASENARVVELVADALELWPGDDA-EWEK----QSDNNHPHEANLLK  309 (361)
T ss_pred             CCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCE-EEEC----CCCCCCCCCCCCCC
T ss_conf             430145110799999985287341245545588877765559999999996689831-6406----77898872356677


Q ss_pred             CCHHHHHHHHCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             1718999981896610899999999999988
Q gi|254780920|r  296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLD  326 (358)
Q Consensus       296 ~d~~K~~~~Lgw~p~~~l~egi~~~i~w~~~  326 (358)
                      +||+||+..|||+|+-+++|+|+.|++|||.
T Consensus       310 Ld~~KA~~~LgW~P~w~~~~~v~~T~~WYk~  340 (361)
T TIGR02622       310 LDSDKARALLGWQPRWGLEEAVSRTVEWYKN  340 (361)
T ss_pred             CCHHHHHHHCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             5879998431886554588999999987326


No 12 
>TIGR03466 HpnA hopanoid-associated sugar epimerase. The sequences in this family are members of the pfam01370 superfamily of NAD-dependent epimerases and dehydratases typically acting on nucleotide-sugar substrates. The genes of the family modeled here are generally in the same locus with genes involved in the biosynthesis and elaboration of hopene, the cyclization product of the polyisoprenoid squalene.
Probab=100.00  E-value=0  Score=404.48  Aligned_cols=304  Identities=23%  Similarity=0.325  Sum_probs=240.2

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEE
Q ss_conf             94899767882779999999986898799994788765856777620379749997638899999999862278717851
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNF   80 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~ViHl   80 (358)
                      |||||||||||||+||+++|+++ |++|.++++...  ....+    ....++++++|++|++.++++++++  |+||||
T Consensus         1 MriLVTGgtGfiG~~l~~~L~~~-G~~V~~l~r~~~--~~~~~----~~~~~~~~~gDl~d~~~~~~~~~~~--d~ViH~   71 (328)
T TIGR03466         1 MKVLVTGATGFVGSAVVRLLLER-GEEVRVLVRPTS--DRRNL----EGLDVEIVEGDLRDPASLRKALAGC--RALFHV   71 (328)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCCC--CHHHH----CCCCCEEEEEECCCHHHHHHHHHCC--CEEEEE
T ss_conf             94999867779999999999978-498999989998--65565----2179779982079999999997178--589761


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCC-CCCCCCCCCCCC---CC
Q ss_conf             23433222222222222222222202478886512322112478427863055431122222-222222222222---22
Q gi|254780920|r   81 AAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDK-GLFSEDMPYNPS---SP  156 (358)
Q Consensus        81 Aa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~-~~~~E~~~~~p~---s~  156 (358)
                      ||....  ...+|..++++|+.||.|+|++|+.         .++++|||+||.++||.... .|.+|++|..|.   ++
T Consensus        72 Aa~~~~--~~~~~~~~~~~Nv~gt~nll~aa~~---------~~v~r~V~~SS~~v~g~~~~~~~~~E~~p~~~~~~~~~  140 (328)
T TIGR03466        72 AADYRL--WAPDPEEMYRANVEGTRNLLRAALE---------AGVERVVYTSSVATLGVPGDGTPADETTPSSLEKMIGH  140 (328)
T ss_pred             CCCCCC--CCCCHHHHHHHHHHHHHHHHHHHHH---------CCCCCCEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCH
T ss_conf             342344--6799899999999999999999997---------29874315633578557888874025676545666577


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEC
Q ss_conf             23332210000001233322222222222223332222222222222222222222222223322113322220000000
Q gi|254780920|r  157 YSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLV  236 (358)
Q Consensus       157 Yg~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~a~~i~~~  236 (358)
                      |+.||+++|+++..+.++++++++++||+++|||++........++.++++|+.+...+   ..++|+||+|+|+++.++
T Consensus       141 Y~~sK~~aE~~~~~~~~~~gl~~~ilRp~~v~Gp~d~~~~~~~~~i~~~~~~~~p~~~~---~g~~~v~V~Dva~a~~~a  217 (328)
T TIGR03466       141 YKRSKFLAEEAALRMIAEKGLPVVIVNPSTPIGPRDIKPTPTGRIIVDFLRGKMPAYVD---TGLNLVHVDDVAEGHLLA  217 (328)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEEECCCCEECCCCCCCCCHHHHHHHHHCCCCCEEEC---CCCEEEEEHHHHHHHHHH
T ss_conf             88999999999999999729975997778568899888876699999997599976755---871899838999999999


Q ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCC-----------EEECCCCCC--------CCCEECCC
Q ss_conf             12222222111357864202688999988603426555686430-----------233488998--------65300317
Q gi|254780920|r  237 LKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTEL-----------IRFIEDRPG--------HDRRYAID  297 (358)
Q Consensus       237 ~~~~~~~~~fNigs~~~~s~~e~~~~i~~~~~~~~~~~~~~~~~-----------~~~~~~~~~--------~~~~~~~d  297 (358)
                      ++++..++.||++ ++++++.|+++.+.+.++...+....+...           ..+....|.        ......+|
T Consensus       218 ~~~~~~g~~y~~~-~~~~t~~e~~~~i~~~~g~~~~~~~~p~~~~~~~~~~~e~~~~~~~~~p~~~~~~~~~~~~~~~~d  296 (328)
T TIGR03466       218 LERGRIGERYILG-GENLTLAQILAKLAEITGRKAPRVKLPRWLLLPVAWGAEALARLTGKEPRVTLDGVRMAKKKMYFS  296 (328)
T ss_pred             HHCCCCCCEEEEC-CCCCCHHHHHHHHHHHHCCCCCCEECCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHCCCCCCCC
T ss_conf             7579989879979-997109999999999858998711057378888899999988741999876467776415663117


Q ss_pred             HHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             18999981896610899999999999988678
Q gi|254780920|r  298 SSKIKSEIGWFPQENMESGLNKTVCWYLDNNW  329 (358)
Q Consensus       298 ~~K~~~~Lgw~p~~~l~egi~~~i~w~~~n~~  329 (358)
                      ++||+++|||+|+ +++|||++|++||++|.|
T Consensus       297 ~~kA~~~LG~~p~-~~eegl~~tv~W~~~nG~  327 (328)
T TIGR03466       297 SDKAVRELGYRQR-PAREALRDAVEWFRANGY  327 (328)
T ss_pred             HHHHHHHHCCCCC-CHHHHHHHHHHHHHHCCC
T ss_conf             7999998299978-899999999999998689


No 13 
>KOG1429 consensus
Probab=100.00  E-value=0  Score=398.97  Aligned_cols=302  Identities=29%  Similarity=0.475  Sum_probs=270.3

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEE
Q ss_conf             94899767882779999999986898799994788765856777620379749997638899999999862278717851
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNF   80 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~ViHl   80 (358)
                      |||+||||.||||||||+.|+.+ ||.|+++|+. .+++..++.++...++++.+..|+..+     ++.+  .|.||||
T Consensus        28 lrI~itGgaGFIgSHLvdkLm~e-gh~Via~Dn~-ftg~k~n~~~~~~~~~fel~~hdv~~p-----l~~e--vD~IyhL   98 (350)
T KOG1429          28 LRILITGGAGFIGSHLVDKLMTE-GHEVIALDNY-FTGRKENLEHWIGHPNFELIRHDVVEP-----LLKE--VDQIYHL   98 (350)
T ss_pred             EEEEEECCCCHHHHHHHHHHHHC-CCEEEEEECC-CCCCHHHCCCCCCCCCEEEEEEECHHH-----HHHH--HHHHHHH
T ss_conf             07999657405889999999746-8779998313-455210021003677635897300247-----8887--7788642


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCC-----CCCCCC
Q ss_conf             234332222222222222222222024788865123221124784278630554311222222222222-----222222
Q gi|254780920|r   81 AAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDM-----PYNPSS  155 (358)
Q Consensus        81 Aa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~-----~~~p~s  155 (358)
                      ||..++..+..+|.+++.+|+.||+|+|-.|+.          ..+||+++||+.|||++...|..|+.     |..|++
T Consensus        99 Aapasp~~y~~npvktIktN~igtln~lglakr----------v~aR~l~aSTseVYgdp~~hpq~e~ywg~vnpigpr~  168 (350)
T KOG1429          99 AAPASPPHYKYNPVKTIKTNVIGTLNMLGLAKR----------VGARFLLASTSEVYGDPLVHPQVETYWGNVNPIGPRS  168 (350)
T ss_pred             CCCCCCCCCCCCCCCEEEECCHHHHHHHHHHHH----------HCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCHH
T ss_conf             267787552357650566522226788899987----------3766898640000488556888555321268778723


Q ss_pred             CCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCE
Q ss_conf             22333221000000123332222222222222333222--2222222222222222222222223322113322220000
Q gi|254780920|r  156 PYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHF--PEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRAL  233 (358)
Q Consensus       156 ~Yg~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~--~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~a~~i  233 (358)
                      .|+..|+++|.+|.+|.++.|+.+.|.|+||.|||++.  +.++++.|+.+++.++|+.++|+|.|.|+|.||+|+++++
T Consensus       169 cydegKr~aE~L~~~y~k~~giE~rIaRifNtyGPrm~~~dgrvvsnf~~q~lr~epltv~g~G~qtRSF~yvsD~Vegl  248 (350)
T KOG1429         169 CYDEGKRVAETLCYAYHKQEGIEVRIARIFNTYGPRMHMDDGRVVSNFIAQALRGEPLTVYGDGKQTRSFQYVSDLVEGL  248 (350)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHCCCCEEEECCCCCEEEEEEHHHHHHHH
T ss_conf             45577889999999863015827999843224377631579715689999985279869976983158778699899999


Q ss_pred             EECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCEEECCCCCCCCCEECCCHHHHHHHHCCCCCCCH
Q ss_conf             00012222222111357864202688999988603426555686430233488998653003171899998189661089
Q gi|254780920|r  234 YLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSSKIKSEIGWFPQENM  313 (358)
Q Consensus       234 ~~~~~~~~~~~~fNigs~~~~s~~e~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~K~~~~Lgw~p~~~l  313 (358)
                      +.+++.+..+ .||||+++++|+.|+|+.+.++.+        ....+.+...-+.|+..+..|++++++.|||.|+++|
T Consensus       249 l~Lm~s~~~~-pvNiGnp~e~Tm~elAemv~e~~~--------~~s~i~~~~~~~Ddp~kR~pDi~~ake~LgW~Pkv~L  319 (350)
T KOG1429         249 LRLMESDYRG-PVNIGNPGEFTMLELAEMVKELIG--------PVSEIEFVENGPDDPRKRKPDITKAKEQLGWEPKVSL  319 (350)
T ss_pred             HHHHCCCCCC-CCCCCCCCCEEHHHHHHHHHHHCC--------CCCCEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCH
T ss_conf             9986088767-642699312219999999999717--------7643022477888732358627899997288887727


Q ss_pred             HHHHHHHHHHHHHHHHH
Q ss_conf             99999999999886786
Q gi|254780920|r  314 ESGLNKTVCWYLDNNWW  330 (358)
Q Consensus       314 ~egi~~~i~w~~~n~~~  330 (358)
                      +|||+.|+.||++...+
T Consensus       320 ~egL~~t~~~fr~~i~~  336 (350)
T KOG1429         320 REGLPLTVTYFRERIAR  336 (350)
T ss_pred             HHHHHHHHHHHHHHHHH
T ss_conf             77668899999999999


No 14 
>pfam02719 Polysacc_synt_2 Polysaccharide biosynthesis protein. This is a family of diverse bacterial polysaccharide biosynthesis proteins including the CapD protein, WalL protein mannosyl-transferase and several putative epimerases (e.g. WbiI).
Probab=100.00  E-value=0  Score=389.71  Aligned_cols=250  Identities=26%  Similarity=0.319  Sum_probs=216.2

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCC--HHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEE
Q ss_conf             8997678827799999999868987999947887658--56777620379749997638899999999862278717851
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGN--LNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNF   80 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~--~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~ViHl   80 (358)
                      ||||||+||||||||++|++++.+.|+++|+......  ...+......++++++.+|++|.+.+.+++++.+||+||||
T Consensus         1 ILVTGGaGFIGS~Lv~~Ll~~g~~~v~v~d~~~~~~~~~~~~l~~~~~~~~~~~~~~DI~D~~~l~~~~~~~~~D~V~Hl   80 (280)
T pfam02719         1 VLVTGGGGSIGSELCRQILKFNPKKIILFSRDEFKLYEIEQELREEYNDPKLRFFIGDVRDRERLERAMEEYGVDTVFHA   80 (280)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEC
T ss_conf             79974886799999999996899889999088742778999988626789838998116898999999875499999981


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             23433222222222222222222202478886512322112478427863055431122222222222222222222333
Q gi|254780920|r   81 AAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSAT  160 (358)
Q Consensus        81 Aa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~s~Yg~s  160 (358)
                      ||.++++.+..+|..++++|+.||.|+||+|+.         .++++|||+||+.+              ..|.|+||.|
T Consensus        81 AA~~~V~~s~~~P~~~~~~Nv~gT~nlLe~a~~---------~~vk~~v~~STd~a--------------~~P~s~Yg~s  137 (280)
T pfam02719        81 AALKHVPLVEYNPMEAIKTNVLGTENVAEAAIE---------NGVEKFVLISTDKA--------------VNPTNVMGAT  137 (280)
T ss_pred             HHHCCCCCHHHCHHHHHHHHHHHHHHHHHHHHH---------CCCCEEECCCCCCC--------------CCCCCCCCCC
T ss_conf             031165327669999998872777999988885---------39624551476644--------------5699845423


Q ss_pred             CCCCEEEECCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECC
Q ss_conf             22100000012333222---222222222233322222222222222222222222222233221133222200000001
Q gi|254780920|r  161 KASSDYLVLAWGHTYGI---PVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVL  237 (358)
Q Consensus       161 K~~~E~~~~~~~~~~~l---~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~a~~i~~~~  237 (358)
                      |+++|.+++.|++.+++   +++++|+||||||++   +++|.|++++++|+|+.+ ++|+|+|||+||+|+|++++.++
T Consensus       138 K~~~E~l~~~y~~~~~~~~~~~~~lR~fNVyGprg---sVIp~Fi~~~~~~~pi~I-~dg~qtRdf~~V~D~v~~~l~a~  213 (280)
T pfam02719       138 KRLAEKLFQAANRESGSGKTRFSAVRFGNVLGSRG---SVIPLFKKQIAEGGPVTV-THPDMTRFFMTIPEAVQLVLQAG  213 (280)
T ss_pred             HHHHHHHHHHHHHHHCCCCCEEEEEEECCEECCCC---CCHHHHHHHHHCCCCEEE-CCCCCEEEEEEHHHHHHHHHHHH
T ss_conf             77789999999997199985489875445028997---709999999985998656-59984385587999999999999


Q ss_pred             CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCEEECCCCCCCC
Q ss_conf             222222211135786420268899998860342655568643023348899865
Q gi|254780920|r  238 KKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHD  291 (358)
Q Consensus       238 ~~~~~~~~fNigs~~~~s~~e~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~  291 (358)
                      +.+..|++||+|+|+++++.|+|+.|..            ...+++.+.|||+-
T Consensus       214 ~~~~~geifnig~g~~~sI~dLAk~i~~------------~~~i~~ig~r~Gek  255 (280)
T pfam02719       214 AMGKGGEIFVLDMGEPVKIVDLAKAMIG------------DIEIKITGLRPGEK  255 (280)
T ss_pred             HHCCCCCEEECCCCCCEEHHHHHHHHCC------------CCCEEEECCCCCCC
T ss_conf             7287786788889986699999997547------------99979957998623


No 15 
>KOG1371 consensus
Probab=100.00  E-value=0  Score=378.60  Aligned_cols=313  Identities=26%  Similarity=0.382  Sum_probs=267.9

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCC--CHHHHHHHHC-CCCEEEEECCCCCHHHHHHHHHHCCCCEE
Q ss_conf             94899767882779999999986898799994788765--8567776203-79749997638899999999862278717
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAG--NLNSLKEISQ-SNLFSFLQVDICDRECIRSALKEFQPDAI   77 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~--~~~~~~~~~~-~~~v~~i~~Di~d~~~l~~~~~~~~~d~V   77 (358)
                      ++||||||.||||||.+-+|+++ |+.|+++||+..+.  ...+.+.+.. ...+.|+++||+|.+.|+++|+..++|.|
T Consensus         3 ~~VLVtGgaGyiGsht~l~L~~~-gy~v~~vDNl~n~~~~sl~r~~~l~~~~~~v~f~~~Dl~D~~~L~kvF~~~~fd~V   81 (343)
T KOG1371           3 KHVLVTGGAGYIGSHTVLALLKR-GYGVVIVDNLNNSYLESLKRVRQLLGEGKSVFFVEGDLNDAEALEKLFSEVKFDAV   81 (343)
T ss_pred             CEEEEECCCCCEEHHHHHHHHHC-CCCEEEEECCCCCCHHHHHHHHHHCCCCCCEEEEEECCCCHHHHHHHHHHCCCCEE
T ss_conf             37999668763105999999867-98179982433212467788998627877438998156689999999863388657


Q ss_pred             EEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCC-CCCC
Q ss_conf             851234332222222222222222222024788865123221124784278630554311222222222222222-2222
Q gi|254780920|r   78 VNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYN-PSSP  156 (358)
Q Consensus        78 iHlAa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~-p~s~  156 (358)
                      +|+||+..++++.++|..++.+|+.||.|+||+|+.         ++++.+||+||+.|||.+...|++|++|.. |.++
T Consensus        82 ~Hfa~~~~vgeS~~~p~~Y~~nNi~gtlnlLe~~~~---------~~~~~~V~sssatvYG~p~~vp~te~~~t~~p~~p  152 (343)
T KOG1371          82 MHFAALAAVGESMENPLSYYHNNIAGTLNLLEVMKA---------HNVKALVFSSSATVYGLPTKVPITEEDPTDQPTNP  152 (343)
T ss_pred             EEEHHHHCCCHHHHCCHHHEEHHHHHHHHHHHHHHH---------CCCCEEEEECCEEEECCCCEECCCCCCCCCCCCCC
T ss_conf             762444133156628223100211468999999997---------59864888423046347643203576877888886


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCC--CCCC--------CCCCCCCCCCCCCCCC--CCCCC------CCCC
Q ss_conf             233322100000012333222222222222233--3222--------2222222222222222--22222------2223
Q gi|254780920|r  157 YSATKASSDYLVLAWGHTYGIPVLLSNCSNNYG--PYHF--------PEKLIPLAITRMIEGS--HVFLY------GDGQ  218 (358)
Q Consensus       157 Yg~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyG--p~~~--------~~~~i~~~i~~~~~g~--~~~i~------g~g~  218 (358)
                      ||.+|.+.|.++..+++.++...+.||.|+++|  |.+.        +.++.| .+.+...|.  .+.++      .+|+
T Consensus       153 yg~tK~~iE~i~~d~~~~~~~~~~~LRyfn~~ga~p~Gr~ge~p~~~~nnl~p-~v~~vaigr~~~l~v~g~d~~t~dgt  231 (343)
T KOG1371         153 YGKTKKAIEEIIHDYNKAYGWKVTGLRYFNVIGAHPSGRIGEAPLGIPNNLLP-YVFQVAIGRRPNLQVVGRDYTTIDGT  231 (343)
T ss_pred             CCHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCC-CCCCHHCCCCCCCEEECCCCCCCCCC
T ss_conf             40136779997676531456047998842556766546778887667565340-13300002324525404766021797


Q ss_pred             CCCCCCCCCCCCCCEEECCCCCC---CCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCEEECCCCCCCCCEEC
Q ss_conf             32211332222000000012222---222111357864202688999988603426555686430233488998653003
Q gi|254780920|r  219 NVRDWLYVEDHVRALYLVLKKGR---IGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYA  295 (358)
Q Consensus       219 ~~Rdfi~v~D~a~~i~~~~~~~~---~~~~fNigs~~~~s~~e~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  295 (358)
                      ++||++|+-|+|++...++++.+   ...+||+|++...++.+++..+++..+..++.        ++.+.|++|....+
T Consensus       232 ~vrdyi~v~Dla~~h~~al~k~~~~~~~~i~Nlgtg~g~~V~~lv~a~~k~~g~~~k~--------~~v~~R~gdv~~~y  303 (343)
T KOG1371         232 IVRDYIHVLDLADGHVAALGKLRGAAEFGVYNLGTGKGSSVLELVTAFEKALGVKIKK--------KVVPRRNGDVAFVY  303 (343)
T ss_pred             EEECCEEEEEHHHHHHHHHHCCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHCCCCCC--------CCCCCCCCCCEEEE
T ss_conf             1123220166477889876420000003457604788822999999999875579872--------00377899841465


Q ss_pred             CCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             1718999981896610899999999999988678655
Q gi|254780920|r  296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR  332 (358)
Q Consensus       296 ~d~~K~~~~Lgw~p~~~l~egi~~~i~w~~~n~~~~~  332 (358)
                      +++++++++|||+|+++++|+++++++|+.+|++++.
T Consensus       304 a~~~~a~~elgwk~~~~iee~c~dlw~W~~~np~gy~  340 (343)
T KOG1371         304 ANPSKAQRELGWKAKYGLQEMLKDLWRWQKQNPSGYD  340 (343)
T ss_pred             ECHHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCC
T ss_conf             1747899984886423899999999998751987677


No 16 
>pfam04321 RmlD_sub_bind RmlD substrate binding domain. L-rhamnose is a saccharide required for the virulence of some bacteria. Its precursor, dTDP-L-rhamnose, is synthesized by four different enzymes the final one of which is RmlD. The RmlD substrate binding domain is responsible for binding a sugar nucleotide.
Probab=100.00  E-value=0  Score=383.03  Aligned_cols=279  Identities=23%  Similarity=0.288  Sum_probs=236.3

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEECC
Q ss_conf             89976788277999999998689879999478876585677762037974999763889999999986227871785123
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNFAA   82 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~ViHlAa   82 (358)
                      ||||||+|||||||+++|++ .|++|+++|+.                     .+|++|++.+++++++.+||+||||||
T Consensus         1 ILVtG~~GfiGs~l~~~L~~-~g~~v~~~~r~---------------------~~D~~d~~~l~~~~~~~~pd~VihlAa   58 (284)
T pfam04321         1 ILVTGANGQLGRELTRLLAE-RGVEVVALDRP---------------------ELDLTDPEAVAALVREARPDVVVNAAA   58 (284)
T ss_pred             EEEECCCCHHHHHHHHHHHH-CCCEEEEECCC---------------------CCCCCCHHHHHHHHHHCCCCEEEECCC
T ss_conf             69964899899999999986-89989995486---------------------257889999999998649979997241


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             43322222222222222222220247888651232211247842786305543112222222222222222222233322
Q gi|254780920|r   83 ESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSATKA  162 (358)
Q Consensus        83 ~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~s~Yg~sK~  162 (358)
                      .+.++.+..+|..++++|+.+|.+++++|+..         +. +|||+||+.|||.....|++|++++.|.++||.||+
T Consensus        59 ~~~~~~~~~~~~~~~~~Nv~~t~~l~~~~~~~---------~~-~~i~~Ss~~Vy~g~~~~p~~E~~~~~P~~~Yg~sK~  128 (284)
T pfam04321        59 YTAVDKAESEPELAYAVNALGPGNLAEACAAR---------GA-PLIHISTDYVFDGAKGGPYREDDPTGPLNVYGRTKL  128 (284)
T ss_pred             CCCCHHHHHCHHHHHHHHHHHHHHHHHHHHHC---------CC-CEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHH
T ss_conf             35556777488889987599999999998744---------98-579841753000689988545777789880165758


Q ss_pred             CCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCC-
Q ss_conf             1000000123332222222222222333222222222222222222222222222332211332222000000012222-
Q gi|254780920|r  163 SSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKGR-  241 (358)
Q Consensus       163 ~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~a~~i~~~~~~~~-  241 (358)
                      ++|+++..+.    .+++|+|++++|||++.  ++++.+++++..++++.+++  +|.|+++|++|+|+++..++++.. 
T Consensus       129 ~~E~~~~~~~----~~~~IlR~~~vyG~~~~--~~~~~~~~~~~~~~~i~i~~--d~~~~~~~v~D~a~~~~~~~e~~~~  200 (284)
T pfam04321       129 AGEQAVLAAN----PRHLILRTAWVYGEYGN--NFVKTMLRLAAERDELRVVD--DQLGSPTSARDLADALLALIRKRLR  200 (284)
T ss_pred             HHHHHHHHHC----CCCEEEEEEEECCCCCC--CHHHHHHHHHHCCCCCEEEC--CCCCCCEEHHHHHHHHHHHHHHCCC
T ss_conf             9999999725----34607877344288887--88999999986289826853--7568969899999999999982033


Q ss_pred             ---CCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCC-CCCCCEEECCCCCCCCCEECCCHHHHHHHHCCCCCCCHHHHH
Q ss_conf             ---2221113578642026889999886034265556-864302334889986530031718999981896610899999
Q gi|254780920|r  242 ---IGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY-SHTELIRFIEDRPGHDRRYAIDSSKIKSEIGWFPQENMESGL  317 (358)
Q Consensus       242 ---~~~~fNigs~~~~s~~e~~~~i~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~d~~K~~~~Lgw~p~~~l~egi  317 (358)
                         .+++||+|+++++|+.|+++.|+++++....... ...........|   +.+..+|++|++++|||+|. +|+|||
T Consensus       201 ~~~~~giyNi~~~~~~s~~ela~~i~~~~g~~~~~i~~v~~~~~~~~~~r---P~~~~lD~sK~~~~lg~~p~-~~~egl  276 (284)
T pfam04321       201 GPALAGTYHLAGSGETSWYDFARAIFDEAGADGGRVRPIPTAEYPTPARR---PANSVLDTSKLEATFGIPLP-DWREAL  276 (284)
T ss_pred             CCCCCCCEEECCCCCEEHHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCC---CCCCCCCHHHHHHHHCCCCC-CHHHHH
T ss_conf             77777613741898440999999999996888774266118888878999---76001559999997687999-899999


Q ss_pred             HHHHHHHH
Q ss_conf             99999998
Q gi|254780920|r  318 NKTVCWYL  325 (358)
Q Consensus       318 ~~~i~w~~  325 (358)
                      ++|++++.
T Consensus       277 ~~~l~~~~  284 (284)
T pfam04321       277 AEVLDELL  284 (284)
T ss_pred             HHHHHHHC
T ss_conf             99999969


No 17 
>TIGR01472 gmd GDP-mannose 4,6-dehydratase; InterPro: IPR006368   This family represent GDP-mannose 4,6-dehydratase, also known as GDP-D-mannose dehydratase. This enzyme converts GDP-mannose to GDP-4-dehydro-6-deoxy-D-mannose, the first of three steps for the conversion of GDP-mannose to GDP-fucose in animals, plants, and bacteria. In bacteria, GDP-L-fucose acts as a precursor of surface antigens such as the extracellular polysaccharide colanic acid of Escherichia coli. Excluded from this family are members of the clade that are poorly related because of highly dervied (phylogenetically long-branch) sequences, e.g. Aneurinibacillus thermoaerophilus Gmd, described as a bifunctional GDP-mannose 4,6-dehydratase/GDP-6-deoxy-D-lyxo-4-hexulose reductase .; GO: 0008446 GDP-mannose 46-dehydratase activity, 0019673 GDP-mannose metabolic process, 0005622 intracellular.
Probab=100.00  E-value=0  Score=372.58  Aligned_cols=316  Identities=24%  Similarity=0.314  Sum_probs=274.5

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCC-----C-C--EEEEECCCCCHHHHHHHHHHCCC
Q ss_conf             89976788277999999998689879999478876585677762037-----9-7--49997638899999999862278
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQS-----N-L--FSFLQVDICDRECIRSALKEFQP   74 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~-----~-~--v~~i~~Di~d~~~l~~~~~~~~~   74 (358)
                      -||||.||+-||+|++.||++ ||+|.|+-|+|++-|..++.+++.+     + +  +.++-|||+|...|.+++...+|
T Consensus         3 ALiTGiTGQDGSYLAE~LL~~-GYeVHG~~RRSSSfNT~Ri~hiY~~~h~~~~r~A~~fLHYGDlTDs~~L~~~i~~~kP   81 (365)
T TIGR01472         3 ALITGITGQDGSYLAEFLLEK-GYEVHGLIRRSSSFNTQRIEHIYEDPHKEEKRRALMFLHYGDLTDSSNLVKLIDEIKP   81 (365)
T ss_pred             EEEECCCCCCHHHHHHHHHHC-CCEEEEEEECCCCCCHHHHHHHHCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCC
T ss_conf             688345557678999998726-9687645862554252245676405354101661354204421068999999740488


Q ss_pred             CEEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             71785123433222222222222222222202478886512322112478427863055431122222222222222222
Q gi|254780920|r   75 DAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPS  154 (358)
Q Consensus        75 d~ViHlAa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~  154 (358)
                      +-|++|||+|||.-|++-|+.+.++--.||++||||+|....+   --.+..||..+||++.||...+.|.+|++|+.|+
T Consensus        82 ~EiYNLAAQSHV~VSFe~PeYTa~~~g~GTLrlLEA~r~hni~---gl~~~~rFYQAStSElYG~v~~~PQ~E~TPF~PR  158 (365)
T TIGR01472        82 TEIYNLAAQSHVKVSFEIPEYTADVDGIGTLRLLEAVRSHNIL---GLIKEIRFYQASTSELYGEVQEIPQNETTPFYPR  158 (365)
T ss_pred             CEEECCCCCCCEEEECCCCCCHHCHHHHHHHHHHHHHHHHHHH---CCCCCEEEEECCCHHHCCCCCCCCCCCCCCCCCC
T ss_conf             6342020237103541652000012443177899987423341---4120302552452311365557888888876888


Q ss_pred             CCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCC
Q ss_conf             22233322100000012333222222222222233322---2222222222222222222-2222223322113322220
Q gi|254780920|r  155 SPYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYH---FPEKLIPLAITRMIEGSHV-FLYGDGQNVRDWLYVEDHV  230 (358)
Q Consensus       155 s~Yg~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~---~~~~~i~~~i~~~~~g~~~-~i~g~g~~~Rdfi~v~D~a  230 (358)
                      ||||+||..|..++.+|++.|||-.+--.+||.-.|..   +.+|.|+.-+.++..|..- ...|+.+.+|||-|+.|.|
T Consensus       159 SPYAaAK~yA~w~tvNYREAYgL~A~nGILFNHESP~RGetFVTRKITra~a~I~~G~~~~lyLGNLdA~RDWGhAkDYV  238 (365)
T TIGR01472       159 SPYAAAKLYAYWITVNYREAYGLFAVNGILFNHESPRRGETFVTRKITRAAAKIKLGLQEKLYLGNLDAKRDWGHAKDYV  238 (365)
T ss_pred             CHHHHHHHHHHHHEEEEECCCCCCHHCCEEECCCCCCCCCCCCHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCHHHHH
T ss_conf             76899988454310212100341000352104678877885322589999999861563111202754410665056699


Q ss_pred             CCEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCC----------------------------CCCCCEE
Q ss_conf             000000122222221113578642026889999886034265556----------------------------8643023
Q gi|254780920|r  231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY----------------------------SHTELIR  282 (358)
Q Consensus       231 ~~i~~~~~~~~~~~~fNigs~~~~s~~e~~~~i~~~~~~~~~~~~----------------------------~~~~~~~  282 (358)
                      ++++++++++.++ -|.|++|+..|++|+++.-.+.+|..+....                            .....+.
T Consensus       239 ~aMWLMLQ~d~P~-DYViATG~t~SVrefve~SF~~~G~~l~W~~~g~~E~G~~~~~dekranalklnlshlkkGk~~V~  317 (365)
T TIGR01472       239 EAMWLMLQQDKPD-DYVIATGETHSVREFVEVSFELVGITLEWKDKGIEEVGLIKETDEKRANALKLNLSHLKKGKVVVE  317 (365)
T ss_pred             HHHHHHCCCCCCC-CEEEECCCEEEHHHHHHHHHHHCCCEEEECCCCCCEECCCHHHHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             9988752786889-768875733338889999887409736862688202113012335557777653444137707999


Q ss_pred             ECC--CCCCCCCEECCCHHHHHHHHCCCCCCCHHHHHHHHHHH
Q ss_conf             348--89986530031718999981896610899999999999
Q gi|254780920|r  283 FIE--DRPGHDRRYAIDSSKIKSEIGWFPQENMESGLNKTVCW  323 (358)
Q Consensus       283 ~~~--~~~~~~~~~~~d~~K~~~~Lgw~p~~~l~egi~~~i~w  323 (358)
                      +++  .||.++..+.+|++||++.|||+|+++|++-+++|++.
T Consensus       318 iD~rYfRPTEVDlL~GD~~KAk~~LgW~~~~~f~~Lvk~Mv~~  360 (365)
T TIGR01472       318 IDPRYFRPTEVDLLLGDATKAKEKLGWKPEVSFEELVKEMVEE  360 (365)
T ss_pred             ECCCCCCCHHHHHCCCCCHHHHHHCCCCCCCCHHHHHHHHHHH
T ss_conf             6486578514230178834889736882455778999999999


No 18 
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase; InterPro: IPR011912   Lipopolysaccharides (LPS) are glycolipids that consitutes the outer monolayer of the outer membranes of most Gram-negative bacteria . They consist of lipid A (endotoxin) which anchors LPS to the outer membrane, a non-repeating core oligosachharide, and an immunogenic O-antigen repeat polymer, which is an oligosaccharide of 1-40 units that variesbetween different strains of bacteria. Although the O-antigen and most of the core domain are not necessary for growth in the lab, they appear to help bacteria resist environmental stresses including the complement system and antibiotics.   This family consists of examples of ADP-L-glycero-D-mannoheptose-6-epimerase, an enzyme involved in biosynthesis of the inner core of LPS in Gram-negative bacteria . This enzyme is homologous to UDP-glucose 4-epimerase (IPR005886 from INTERPRO) and belongs to the NAD dependent epimerase/dehydratase family. It participates in the biosynthetic pathway leading to incorporation of heptose, a conserved sugar, into the core region of LPS, performing the reaction shown below: ADP-D-glycero-D-manno-heptose = ADP-L-glycero-D-manno-heptose It is a homopentameric enzyme with each monomer composed of two domains: an N-terminal modified Rossman fold domain for NADP binding, and a C-terminal substrate binding domain.; GO: 0008712 ADP-glyceromanno-heptose 6-epimerase activity, 0050661 NADP binding, 0005975 carbohydrate metabolic process.
Probab=100.00  E-value=0  Score=362.73  Aligned_cols=311  Identities=24%  Similarity=0.283  Sum_probs=242.3

Q ss_pred             EEEECCCCHHHHHHHHHHHHHC-CCEEEEEECCCC-----CCCHHHHHHHHCCCCE--EEEECCCCCHHHHHHHHHH---
Q ss_conf             8997678827799999999868-987999947887-----6585677762037974--9997638899999999862---
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDL-KIQVLVIDKLTY-----AGNLNSLKEISQSNLF--SFLQVDICDRECIRSALKE---   71 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~-~~~V~~~d~~~~-----~~~~~~~~~~~~~~~v--~~i~~Di~d~~~l~~~~~~---   71 (358)
                      ||||||.|||||+||..|=+++ ..+|+++|++..     +++...+.+..+..++  .-|..+|.+.+.++.+-++   
T Consensus         1 IiVTGGAGFIGSNlv~~LN~~gP~~dI~vvD~L~~~~~F~ng~~~slg~~kk~~Nl~~~~I~d~i~k~~~~~~l~~~~~~   80 (353)
T TIGR02197         1 IIVTGGAGFIGSNLVKALNERGPETDILVVDNLRDDATFENGNPQSLGHFKKFLNLADLEIADYIDKDDLLDRLEKGSEA   80 (353)
T ss_pred             CEECCCCCHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCCCCCCHHHCCCCCCCCCCHHHCCCCCHHHHHHHHHCCCC
T ss_conf             95506763689999999964389542888740787552467774322342443255541121335885469999830201


Q ss_pred             -CCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCC-C
Q ss_conf             -27871785123433222222222222222222202478886512322112478427863055431122222222222-2
Q gi|254780920|r   72 -FQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSED-M  149 (358)
Q Consensus        72 -~~~d~ViHlAa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~-~  149 (358)
                       .++|+|||.||.|..-  ..|-...+++|..-|+.||+.|..          ...+|||+||++|||+... +++|+ .
T Consensus        81 ~~~~~avfH~GAcS~TT--e~D~~~~m~nN~~ys~~Ll~~c~~----------~~~~~IYASSAatYG~~~~-~f~~~~~  147 (353)
T TIGR02197        81 LGKIEAVFHQGACSDTT--ETDGEYMMENNYQYSKRLLDWCAE----------KGVPFIYASSAATYGDGEA-GFREDRE  147 (353)
T ss_pred             CCCCCEEEECCHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHH----------CCCCEEEECCHHHCCCCCC-CCCCCCC
T ss_conf             38833799733125358--862799998899999999999996----------4898688503121076877-7776656


Q ss_pred             -----CCCCCCCCCCCCCCCEEEECCCC---CCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCC--
Q ss_conf             -----22222222333221000000123---332222222222222333222222----2222222222222222222--
Q gi|254780920|r  150 -----PYNPSSPYSATKASSDYLVLAWG---HTYGIPVLLSNCSNNYGPYHFPEK----LIPLAITRMIEGSHVFLYG--  215 (358)
Q Consensus       150 -----~~~p~s~Yg~sK~~~E~~~~~~~---~~~~l~~~ilR~~~vyGp~~~~~~----~i~~~i~~~~~g~~~~i~g--  215 (358)
                           .++|.|+||.||.+.+++++...   +...-.++-||+||||||++...+    ++-++..++..++.+.+|+  
T Consensus       148 ~e~L~kLrPlN~YGySK~lFD~~v~~~~~~~~~~~~q~~GLrYFNVYGP~E~HKG~MASv~f~~~~q~~~~~~v~LF~~~  227 (353)
T TIGR02197       148 LEELQKLRPLNVYGYSKFLFDQYVRRRVLPGEALSAQVVGLRYFNVYGPREYHKGKMASVAFHLFNQIKAGGNVKLFKSH  227 (353)
T ss_pred             HHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCC
T ss_conf             58897518788612216789899999860124798642410211346888675443699999988899737882023566


Q ss_pred             -----CCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCC-CCC----CCCCCCCCEEECC
Q ss_conf             -----223322113322220000000122222221113578642026889999886034-265----5568643023348
Q gi|254780920|r  216 -----DGQNVRDWLYVEDHVRALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDA-LIP----KSYSHTELIRFIE  285 (358)
Q Consensus       216 -----~g~~~Rdfi~v~D~a~~i~~~~~~~~~~~~fNigs~~~~s~~e~~~~i~~~~~~-~~~----~~~~~~~~~~~~~  285 (358)
                           +|+|.|||+||+||+++.+.+++++..+++||||+|++.|..|++.++.+.++. .-+    ........+++.+
T Consensus       228 ~~~~~dGeQ~RDFVYV~DV~~~n~~~~~~~~~SGifN~GtG~ArsF~dla~a~~~~~~~~~~~~LSl~~lv~~~~i~Yi~  307 (353)
T TIGR02197       228 KEGFKDGEQLRDFVYVKDVVKVNLWLLENPSKSGIFNVGTGKARSFNDLADAVFKALGTNKGEPLSLKELVEDFKIEYID  307 (353)
T ss_pred             CCCCCCCCCCCCCEEHHHHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHHHHHHHCCCCCCCCHHHHHHCCCCCEEC
T ss_conf             85898878110115527699999999848898415644778886689999999998731468885779887306720102


Q ss_pred             C----CCCCCCEECCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             8----9986530031718999981896610899999999999988
Q gi|254780920|r  286 D----RPGHDRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLD  326 (358)
Q Consensus       286 ~----~~~~~~~~~~d~~K~~~~Lgw~p~~~l~egi~~~i~w~~~  326 (358)
                      .    |-.++....+|++++++.....|.++|||||++.+.|++.
T Consensus       308 ~Pe~lrg~YQ~fTqAd~~~lr~aGy~~~~~~LeeGV~dY~~~~~~  352 (353)
T TIGR02197       308 MPEALRGKYQYFTQADIDKLREAGYYKPFTTLEEGVKDYVQWLLA  352 (353)
T ss_pred             CCHHHHHCCCCCCHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             835740005740166489999732787673488999999999860


No 19 
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated
Probab=100.00  E-value=0  Score=352.71  Aligned_cols=311  Identities=21%  Similarity=0.267  Sum_probs=260.1

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCC-HHHHHHHHHHCCCCEEEEE
Q ss_conf             489976788277999999998689879999478876585677762037974999763889-9999999862278717851
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD-RECIRSALKEFQPDAIVNF   80 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d-~~~l~~~~~~~~~d~ViHl   80 (358)
                      ||||.|.+||||+||+++||++.+++|+++|..+.     ++..+..++++.|++||++- .+=++.-+++|  |+|+-|
T Consensus       317 ~vlilgvngfig~hl~~~~l~~~~~~v~g~d~~~~-----~i~~~~~~p~~~f~~gdi~~~~~wie~~ikkc--dvvlpl  389 (660)
T PRK08125        317 RVLILGVNGFIGNHLTERLLRDDNYEVYGLDIGSD-----AISRFLGHPRFHFVEGDISIHSEWIEYHIKKC--DVVLPL  389 (660)
T ss_pred             EEEEEECCCHHHHHHHHHHHCCCCEEEEEEECCCC-----HHHHHHCCCCEEEEECCCHHHHHHHHHHHHHC--CEEEEE
T ss_conf             79998344136789999985038858998865753-----45575349954888156146689999887545--767320


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCC-C--C----CC
Q ss_conf             234332222222222222222222024788865123221124784278630554311222222222222-2--2----22
Q gi|254780920|r   81 AAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDM-P--Y----NP  153 (358)
Q Consensus        81 Aa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~-~--~----~p  153 (358)
                      +|.+.+-.+..||...++-..+-.+.++..|-          +..+++||+||++|||++.+..++|++ .  .    ++
T Consensus       390 vaiatp~~y~~~pl~vfeldfe~nl~ivr~c~----------ky~kriifpstsevygm~~d~~f~ed~s~li~gpi~~~  459 (660)
T PRK08125        390 VAIATPIEYTRNPLRVFELDFEENLKIIRYCV----------KYRKRIIFPSTSEVYGMCTDKYFDEDHSNLIVGPINKQ  459 (660)
T ss_pred             HHHCCHHHHHCCCCEEEEECHHHCCHHHHHHH----------HHCCEEEECCHHHHCCCCCCCCCCCCCCCCEECCCCCC
T ss_conf             55347477634860478732675528999999----------74877896560551014788676855566156775554


Q ss_pred             CCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCC--------CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222333221000000123332222222222222333222--------22222222222222222222222233221133
Q gi|254780920|r  154 SSPYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHF--------PEKLIPLAITRMIEGSHVFLYGDGQNVRDWLY  225 (358)
Q Consensus       154 ~s~Yg~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~--------~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~  225 (358)
                      +..|+.||++.|.++.+|.++.|++++++||||.+||+..        .++++++||..+.+|+|+.+..+|.|+|+|+|
T Consensus       460 RWiYs~sKqlldrvi~Ayg~~~gL~ftlfRpFNw~GPrld~~~~~~~gs~r~itq~i~nl~~g~pi~lvdgG~QkR~Ft~  539 (660)
T PRK08125        460 RWIYSVSKQLLDRVIWAYGEKEGLRFTLFRPFNWMGPRLDNLNAARIGSSRAITQLILNLVEGSPIKLIDGGAQKRCFTD  539 (660)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCEEECCCCEEEEEEE
T ss_conf             35787789998899998776539946998014555888775555334775419999999976998568548730588876


Q ss_pred             CCCCCCCEEECCCCC---CCCCCCCCCCC-CCCCHHHHHHHHHHHHCCCCCCC-CCC-CCC-----EEECCCCCCCCCEE
Q ss_conf             222200000001222---22221113578-64202688999988603426555-686-430-----23348899865300
Q gi|254780920|r  226 VEDHVRALYLVLKKG---RIGERYNIGGN-NERKNIDIVFEIGFLLDALIPKS-YSH-TEL-----IRFIEDRPGHDRRY  294 (358)
Q Consensus       226 v~D~a~~i~~~~~~~---~~~~~fNigs~-~~~s~~e~~~~i~~~~~~~~~~~-~~~-~~~-----~~~~~~~~~~~~~~  294 (358)
                      |+|.++|++.++++.   ..|++||||++ ++.|++|+++.+.+.+....... +.. ...     ..+...---|+.++
T Consensus       540 I~Dgieal~~ii~n~~~~~~g~I~NiGnp~n~~Si~~la~~l~~~~~~~~~~~~~~~~~~~~~~~s~~~YG~gYqDv~~R  619 (660)
T PRK08125        540 IRDGIEALFRIIENRGNRCDGQIINIGNPDNEASIRELAEMLLASFEKHPLRDHFPPFAGFRVVESSSYYGKGYQDVEHR  619 (660)
T ss_pred             HHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCEEHHHHHHHHHHHHHHCCCCCCCCCCCCEEEECCCCCCCCCHHHHHHC
T ss_conf             67799999999849455556606875899865239999999999997385300065445536603301237742556634


Q ss_pred             CCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             31718999981896610899999999999988678
Q gi|254780920|r  295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNW  329 (358)
Q Consensus       295 ~~d~~K~~~~Lgw~p~~~l~egi~~~i~w~~~n~~  329 (358)
                      .+|+++|++.|||+|+++++++|++|+++|+.+..
T Consensus       620 ~P~i~~a~~~l~w~P~~~~~~~i~~tl~~~l~~~~  654 (660)
T PRK08125        620 KPSIRNARRLLDWEPKIAMQETIDETLDFFLRTVD  654 (660)
T ss_pred             CCCHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHCC
T ss_conf             88777898754998777289999999999964120


No 20 
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane]
Probab=100.00  E-value=0  Score=348.89  Aligned_cols=318  Identities=25%  Similarity=0.333  Sum_probs=272.9

Q ss_pred             CE-EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHH--HH--HHCCCCEEEEECCCCCHHHHHHHHHHCCCC
Q ss_conf             94-89976788277999999998689879999478876585677--76--203797499976388999999998622787
Q gi|254780920|r    1 MR-LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSL--KE--ISQSNLFSFLQVDICDRECIRSALKEFQPD   75 (358)
Q Consensus         1 Mk-ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~--~~--~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d   75 (358)
                      || .||||.||+.|++|++.||++ ||.|.++.|++++.+..++  .+  ...++++.++.+|++|...+.++++..+||
T Consensus         2 ~K~ALITGITGQDGsYLa~lLLek-GY~VhGi~Rrss~~n~~ri~L~~~~~~~~~~l~l~~gDLtD~~~l~r~l~~v~Pd   80 (345)
T COG1089           2 GKVALITGITGQDGSYLAELLLEK-GYEVHGIKRRSSSFNTPRIHLYEDPHLNDPRLHLHYGDLTDSSNLLRILEEVQPD   80 (345)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHC-CCEEEEEEECCCCCCCCCCHHHCCCCCCCCEEEEEECCCCCHHHHHHHHHHCCCH
T ss_conf             726999544587538999999856-9489878603355776530111165557861799965543568899999860944


Q ss_pred             EEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             17851234332222222222222222222024788865123221124784278630554311222222222222222222
Q gi|254780920|r   76 AIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSS  155 (358)
Q Consensus        76 ~ViHlAa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~s  155 (358)
                      .|+||||+|+|+.|++.|..+.+++..||+++||+.|...       ....||.++||++.||.....|.+|++|+.|+|
T Consensus        81 EIYNLaAQS~V~vSFe~P~~T~~~~~iGtlrlLEaiR~~~-------~~~~rfYQAStSE~fG~v~~~pq~E~TPFyPrS  153 (345)
T COG1089          81 EIYNLAAQSHVGVSFEQPEYTADVDAIGTLRLLEAIRILG-------EKKTRFYQASTSELYGLVQEIPQKETTPFYPRS  153 (345)
T ss_pred             HHEECCCCCCCCCCCCCCCEEEEECHHHHHHHHHHHHHHC-------CCCCEEEECCCHHHHCCCCCCCCCCCCCCCCCC
T ss_conf             5330343234553035864025310067889999999748-------766079965617760676667544689998897


Q ss_pred             CCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCC
Q ss_conf             2233322100000012333222222222222233322---222222222222222222222-222233221133222200
Q gi|254780920|r  156 PYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYH---FPEKLIPLAITRMIEGSHVFL-YGDGQNVRDWLYVEDHVR  231 (358)
Q Consensus       156 ~Yg~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~---~~~~~i~~~i~~~~~g~~~~i-~g~g~~~Rdfi~v~D~a~  231 (358)
                      ||+++|+.+..+...|++.||+-.|.-++||.-+|..   +..+.|...+.++..|..-.+ .|+-+.+|||.|+.|.++
T Consensus       154 PYAvAKlYa~W~tvNYResYgl~AcnGILFNHESP~Rge~FVTRKIt~ava~Ik~G~q~~l~lGNldAkRDWG~A~DYVe  233 (345)
T COG1089         154 PYAVAKLYAYWITVNYRESYGLFACNGILFNHESPLRGETFVTRKITRAVARIKLGLQDKLYLGNLDAKRDWGHAKDYVE  233 (345)
T ss_pred             HHHHHHHHHHHEEEEHHHHCCCEEECCEEECCCCCCCCCCEEHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCHHHHHH
T ss_conf             78899987776030147634733431144337898775310338999999998706612687436331023431678999


Q ss_pred             CEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCC-----------CCCCCCEEECCC--CCCCCCEECCCH
Q ss_conf             0000012222222111357864202688999988603426555-----------686430233488--998653003171
Q gi|254780920|r  232 ALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS-----------YSHTELIRFIED--RPGHDRRYAIDS  298 (358)
Q Consensus       232 ~i~~~~~~~~~~~~fNigs~~~~s~~e~~~~i~~~~~~~~~~~-----------~~~~~~~~~~~~--~~~~~~~~~~d~  298 (358)
                      +.++++++++. +.|+|++|+..|++|+++.-.+.+|..+...           -.....+.+.+.  ||.++..+..|.
T Consensus       234 ~mwlmLQq~~P-ddyViATg~t~sVrefv~~Af~~~g~~l~w~g~g~~e~g~da~tG~~~V~idp~~fRPaEVd~Llgdp  312 (345)
T COG1089         234 AMWLMLQQEEP-DDYVIATGETHSVREFVELAFEMVGIDLEWEGTGVDEKGVDAKTGKIIVEIDPRYFRPAEVDLLLGDP  312 (345)
T ss_pred             HHHHHHCCCCC-CCEEEECCCEEEHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCEEEEECCCCCCCHHHHHHCCCH
T ss_conf             99999744799-84488527522399999999997085588730355311312456752699870106831255652887


Q ss_pred             HHHHHHHCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             89999818966108999999999999886
Q gi|254780920|r  299 SKIKSEIGWFPQENMESGLNKTVCWYLDN  327 (358)
Q Consensus       299 ~K~~~~Lgw~p~~~l~egi~~~i~w~~~n  327 (358)
                      +||++.|||+|+++|+|.+++|+++.++.
T Consensus       313 ~KA~~~LGW~~~~~~~elv~~Mv~~dl~~  341 (345)
T COG1089         313 TKAKEKLGWRPEVSLEELVREMVEADLEA  341 (345)
T ss_pred             HHHHHHCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             89899709966667999999999999998


No 21 
>pfam01370 Epimerase NAD dependent epimerase/dehydratase family. This family of proteins utilize NAD as a cofactor. The proteins in this family use nucleotide-sugar substrates for a variety of chemical reactions.
Probab=100.00  E-value=0  Score=357.39  Aligned_cols=231  Identities=39%  Similarity=0.652  Sum_probs=207.0

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEECC
Q ss_conf             89976788277999999998689879999478876585677762037974999763889999999986227871785123
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNFAA   82 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~ViHlAa   82 (358)
                      ||||||+||||++|+++|+++ |++|+++++......     ........+++.+|++|.+.+++++++.+||+||||||
T Consensus         1 ILItGasGfiG~~l~~~L~~~-g~~v~~~~r~~~~~~-----~~~~~~~~~~~~~dl~~~~~~~~~~~~~~~D~VihlAa   74 (235)
T pfam01370         1 ILVTGGTGFIGSALVRRLLQE-GYEVIVLGRRRRSES-----LNTGRIRFRFHEGDLTDPDALERLLAEVQPDAVIHLAA   74 (235)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCCCHHH-----HHHCCCCCEEEEEECCCHHHHHHHHHHCCCCEEEECCC
T ss_conf             799728979999999999978-798999989973012-----22114676599965889999999985389989998977


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             43322222222222222222220247888651232211247842786305543112222222222222222222233322
Q gi|254780920|r   83 ESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSATKA  162 (358)
Q Consensus        83 ~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~s~Yg~sK~  162 (358)
                      .++++.+..+|..++++|+.||.+++++|+.         .++++|||+||++|||.....|++|++++.|.++||.+|+
T Consensus        75 ~~~~~~~~~~~~~~~~~N~~~t~~ll~~~~~---------~~~~~~I~~SS~~vYg~~~~~~~~E~~~~~p~~~Y~~sK~  145 (235)
T pfam01370        75 QSGVGASFEDPAEFIRANVLGTLNLLEAARR---------AGVKRFVFASSSEVYGDVADPPITEDTPLGPLSPYAAAKL  145 (235)
T ss_pred             CCCCHHHHCCHHHHHHHHHHHHHHHHHHHHH---------CCCCEEEEECCCEEECCCCCCCCCCCCCCCCCCHHHHHHH
T ss_conf             4783265519999999999999999999998---------3999899925635747999999777778898507999999


Q ss_pred             CCEEEECCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCEEECCC
Q ss_conf             10000001233322222222222223332222---2222222222222222-2222222332211332222000000012
Q gi|254780920|r  163 SSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFP---EKLIPLAITRMIEGSH-VFLYGDGQNVRDWLYVEDHVRALYLVLK  238 (358)
Q Consensus       163 ~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~~---~~~i~~~i~~~~~g~~-~~i~g~g~~~Rdfi~v~D~a~~i~~~~~  238 (358)
                      ++|.+++.++++++++++++||+++|||++..   .++++.++.++..|++ +.++|+|++.|||+||+|+|+|++++++
T Consensus       146 ~~E~~~~~~~~~~~~~~~ilR~~~vyGp~~~~~~~~~~i~~~i~~~~~~~~~~~~~g~g~~~r~~i~v~D~~~ai~~~~~  225 (235)
T pfam01370       146 AGERLVLAYARAYGLRAVILRLFNVYGPGDNDTFVTHVIPALIRRILEGKPEILLLGDGTQRRDFLYVDDVARAILLALE  225 (235)
T ss_pred             HHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCEEECCCCEEECCCCHHHHHHHHHHHHC
T ss_conf             99999999999848898650012598899887762148999999998289972770899978917949999999999981


Q ss_pred             CCCCCCCCCC
Q ss_conf             2222221113
Q gi|254780920|r  239 KGRIGERYNI  248 (358)
Q Consensus       239 ~~~~~~~fNi  248 (358)
                      ++..+++|||
T Consensus       226 ~~~~g~iyNI  235 (235)
T pfam01370       226 HPDGGEVYNI  235 (235)
T ss_pred             CCCCCCCEEC
T ss_conf             8999992429


No 22 
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]
Probab=100.00  E-value=0  Score=335.66  Aligned_cols=303  Identities=31%  Similarity=0.484  Sum_probs=248.9

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEE
Q ss_conf             94899767882779999999986898799994788765856777620379749997638899999999862278717851
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNF   80 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~ViHl   80 (358)
                      |+||||||+||||++|+++|++. |++|+++|+.........       ..++++.+|+++.+....+..... |+|||+
T Consensus         1 ~~iLVtG~tGfiG~~l~~~L~~~-g~~V~~~~r~~~~~~~~~-------~~~~~~~~d~~~~~~~~~~~~~~~-d~vih~   71 (314)
T COG0451           1 MRILVTGGAGFIGSHLVERLLAA-GHDVRGLDRLRDGLDPLL-------SGVEFVVLDLTDRDLVDELAKGVP-DAVIHL   71 (314)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCCCCCCCCC-------CCCCEEECCCCCHHHHHHHHCCCC-CEEEEC
T ss_conf             96999928877799999999858-997999917875431124-------676434225335678998854588-789988


Q ss_pred             CCCCCCCCCCC-CCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCC-CCCCCCCC-CCCCCCCCC
Q ss_conf             23433222222-2222222222222024788865123221124784278630554311222-22222222-222222222
Q gi|254780920|r   81 AAESHVDRSIL-GADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSL-DKGLFSED-MPYNPSSPY  157 (358)
Q Consensus        81 Aa~~~~~~~~~-~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~-~~~~~~E~-~~~~p~s~Y  157 (358)
                      ||.+....... +|..+++.|+.||.|++++|+.         .++++|||+||..+|+.. ...+++|+ .+..|.++|
T Consensus        72 aa~~~~~~~~~~~~~~~~~~nv~gt~~ll~aa~~---------~~~~~~v~~ss~~~~~~~~~~~~~~E~~~~~~p~~~Y  142 (314)
T COG0451          72 AAQSSVPDSNASDPAEFLDVNVDGTLNLLEAARA---------AGVKRFVFASSVSVVYGDPPPLPIDEDLGPPRPLNPY  142 (314)
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH---------CCCCEEEEECCCCEECCCCCCCCCCCCCCCCCCCCHH
T ss_conf             8646775333214788999999999999999986---------7998799978750127887888878655788887677


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCE
Q ss_conf             33322100000012333222222222222233322222---222222222222222-22222223322113322220000
Q gi|254780920|r  158 SATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPE---KLIPLAITRMIEGSH-VFLYGDGQNVRDWLYVEDHVRAL  233 (358)
Q Consensus       158 g~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~~~---~~i~~~i~~~~~g~~-~~i~g~g~~~Rdfi~v~D~a~~i  233 (358)
                      |.+|+++|.++..+...++++++++||+++|||++...   .+++.++.++..+.+ +...++|.+.|+|+|++|+++++
T Consensus       143 g~sK~~~E~~~~~~~~~~~~~~~ilR~~~vyGp~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~v~D~~~~~  222 (314)
T COG0451         143 GVSKLAAEQLLRAYARLYGLPVVILRPFNVYGPGDKPDLSSGVVSAFIRQLLKGEPIIVIGGDGSQTRDFVYVDDVADAL  222 (314)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEEEECEEECCCCCCCCCHHHHHHHHHHHHHCCCCEEECCCCCCEEEEEEHHHHHHHH
T ss_conf             99999999999997663399579998463788898777420789999999870788503507886224257799999999


Q ss_pred             EECCCCCCCCCCCCCCCCC-CCCHHHHHHHHHHHHCCCCCC-CCCCCCCEEECCCCCCCCCEECCCHHHHHHHHCCCCCC
Q ss_conf             0001222222211135786-420268899998860342655-56864302334889986530031718999981896610
Q gi|254780920|r  234 YLVLKKGRIGERYNIGGNN-ERKNIDIVFEIGFLLDALIPK-SYSHTELIRFIEDRPGHDRRYAIDSSKIKSEIGWFPQE  311 (358)
Q Consensus       234 ~~~~~~~~~~~~fNigs~~-~~s~~e~~~~i~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~d~~K~~~~Lgw~p~~  311 (358)
                      ..+++++..+ +||++++. ..++.|+++.+.+.++..... .....      ..++.......+|++|++++|||+|++
T Consensus       223 ~~~~~~~~~~-~~ni~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~~~lg~~p~~  295 (314)
T COG0451         223 LLALENPDGG-VFNIGSGTAEITVRELAEAVAEAVGSKAPLIVYIPL------GRRGDLREGKLLDISKARAALGWEPKV  295 (314)
T ss_pred             HHHHHCCCCC-EEEECCCCCCCCHHHHHHHHHHHHCCCCCCCEECCC------CCHHHHCCCCCCCHHHHHHHHCCCCCC
T ss_conf             9997388871-899469877768999999999984887542010343------220010134326879999971997889


Q ss_pred             CHHHHHHHHHHHHHHHH
Q ss_conf             89999999999998867
Q gi|254780920|r  312 NMESGLNKTVCWYLDNN  328 (358)
Q Consensus       312 ~l~egi~~~i~w~~~n~  328 (358)
                      ++++++.++++|+..+.
T Consensus       296 ~~~~~i~~~~~~~~~~~  312 (314)
T COG0451         296 SLEEGLADTLEWLLKKL  312 (314)
T ss_pred             CHHHHHHHHHHHHHHHC
T ss_conf             98999999999998631


No 23 
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This enzyme catalyzes the first step in the biosynthesis of pseudaminic acid, the conversion of UDP-N-acetylglucosamine to UDP-4-keto-6-deoxy-N-acetylglucosamine. These sequences are members of the broader pfam01073 (3-beta hydroxysteroid dehydrogenase/isomerase family) family.
Probab=100.00  E-value=0  Score=336.51  Aligned_cols=246  Identities=23%  Similarity=0.288  Sum_probs=207.9

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHC-CCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEE
Q ss_conf             48997678827799999999868-98799994788765856777620379749997638899999999862278717851
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDL-KIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNF   80 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~-~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~ViHl   80 (358)
                      +||||||+||||||||++|+++. ...++.+|+...  ....++.....++++|+.+||+|.+.+.+++++  +|+|||+
T Consensus         6 ~ILVTGGaGfIGS~lv~~Ll~~~~~~~iii~~~de~--~~~~l~~~~~~~~i~f~~gDIrD~~~l~~~~~~--vD~VfHa   81 (324)
T TIGR03589         6 SILITGGTGSFGKAFISRLLENYNPKKIIIYSRDEL--KQWEMQQKFPAPCLRFFIGDVRDKERLTRALRG--VDYVVHA   81 (324)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCCEEEEECCCCC--CHHHHHHHCCCCCEEEEECCCCCHHHHHHHHCC--CCEEEEC
T ss_conf             999907977999999999997299828999668640--328898516898759996777788999976348--8899994


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             23433222222222222222222202478886512322112478427863055431122222222222222222222333
Q gi|254780920|r   81 AAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSAT  160 (358)
Q Consensus        81 Aa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~s~Yg~s  160 (358)
                      ||+.+++.+..+|.+++++|+.||.|||++|+         ++++++||++||+.+              ..|.|+||+|
T Consensus        82 AA~khVp~se~nP~e~i~tNV~Gt~nlleaa~---------~~~Vkk~V~iSTDka--------------~~P~n~yGas  138 (324)
T TIGR03589        82 AALKQVPAAEYNPFECIRTNINGAQNVIDAAI---------DNGVKRVVALSTDKA--------------ANPINLYGAT  138 (324)
T ss_pred             CCCCCCCHHHHCHHHHHHHHHHHHHHHHHHHH---------HCCCCEEEEECCCCC--------------CCCCCCCCCC
T ss_conf             62776726776989999999799999999988---------555431786226888--------------8996743123


Q ss_pred             CCCCEEEEC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCEEEC
Q ss_conf             221000000---1233322222222222223332222222222222222222-222222223322113322220000000
Q gi|254780920|r  161 KASSDYLVL---AWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGS-HVFLYGDGQNVRDWLYVEDHVRALYLV  236 (358)
Q Consensus       161 K~~~E~~~~---~~~~~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~-~~~i~g~g~~~Rdfi~v~D~a~~i~~~  236 (358)
                      |+++|+++.   .|...++++++++|++|||||++.   ++|.|+.++.+|+ |+++ ++|+++|+|++++|+|++++.+
T Consensus       139 K~~~E~l~~~~~~~~~~~~~~~~~vRygNV~gsrgS---ViP~F~~qi~~g~~~~~i-td~~mtRf~mtv~dav~lV~~a  214 (324)
T TIGR03589       139 KLASDKLFVAANNISGSKGTRFSVVRYGNVVGSRGS---VVPFFKSLKEEGVTELPI-TDPRMTRFWITLEQGVNFVLKS  214 (324)
T ss_pred             HHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCC---CHHHHHHHHHCCCCCCCC-CCCCEEEEEEEHHHHHHHHHHH
T ss_conf             676799999999850788863788633275188866---399999999839997444-9998079988899999999999


Q ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCEEECCCCCCCC
Q ss_conf             1222222211135786420268899998860342655568643023348899865
Q gi|254780920|r  237 LKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHD  291 (358)
Q Consensus       237 ~~~~~~~~~fNigs~~~~s~~e~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~  291 (358)
                      ++....|++|..- -.++.+.|+++.+..            ...+++...|||+-
T Consensus       215 ~~~~~~GEifv~k-~~s~~i~dla~~~~~------------~~~~k~iG~RpGEK  256 (324)
T TIGR03589       215 LERMLGGEIFVPK-IPSMKITDLAEAMAP------------ECPHKIVGIRPGEK  256 (324)
T ss_pred             HHHCCCCEEEECC-CCCCHHHHHHHHHHC------------CCCEEECCCCCCHH
T ss_conf             9828898499836-970259999998604------------69861457888602


No 24 
>pfam01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family. The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones.
Probab=100.00  E-value=0  Score=335.39  Aligned_cols=252  Identities=23%  Similarity=0.302  Sum_probs=205.5

Q ss_pred             EEECCCCHHHHHHHHHHHHHCC-CEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEECC
Q ss_conf             9976788277999999998689-879999478876585677762037974999763889999999986227871785123
Q gi|254780920|r    4 IVTGGAGFIGSALCRYLVNDLK-IQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNFAA   82 (358)
Q Consensus         4 LItG~tGfIGs~l~~~Ll~~~~-~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~ViHlAa   82 (358)
                      |||||+|||||||+++|++.+. ++|.++|+....   .........+.++++++||+|.+.+++++++  +|+|||+||
T Consensus         1 LVTGg~GFIGs~lv~~Ll~~g~~~~V~~~d~~~~~---~~~~~~~~~~~~~~v~gDl~d~~~l~~~~~~--~D~V~H~Aa   75 (280)
T pfam01073         1 LVTGGGGFLGRHIVRLLLREGELQEVRVFDLRFSP---ELLEDFSKLQVITYIEGDVTDKQDLRRALQG--SDVVIHTAA   75 (280)
T ss_pred             CCCCCCCHHHHHHHHHHHHCCCCCEEEEEECCCCH---HHHHHHCCCCCCEEEECCCCCHHHHHHHHHC--CCEEEEECC
T ss_conf             90586759999999999977997579998788986---7888732258875999128999999999847--998997212


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCC-CCC---CCCCC--CCCCCC
Q ss_conf             433222222222222222222202478886512322112478427863055431122222-222---22222--222222
Q gi|254780920|r   83 ESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDK-GLF---SEDMP--YNPSSP  156 (358)
Q Consensus        83 ~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~-~~~---~E~~~--~~p~s~  156 (358)
                      ...+. +..+|..++++|+.||.|||++|+.         .++++|||+||++|||.... .++   +|+++  ..|.++
T Consensus        76 ~~~~~-~~~~~~~~~~~Nv~gt~~ll~aa~~---------~gvkr~V~~SS~~v~g~~~~~~~~~~~~e~~p~~~~~~~~  145 (280)
T pfam01073        76 IIDVF-GKAYRDTIMKVNVKGTQNVLDACVK---------AGVRVLVYTSSMEVVGPNSYGQPIVNGDETTPYESTHQDP  145 (280)
T ss_pred             CCCCC-CCCCHHHHHHHHHHHHHHHHHHHHH---------CCCCEEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             23555-6679999999999999999999996---------4777079970047876777788756788888788888980


Q ss_pred             CCCCCCCCEEEECC-----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             23332210000001-----2333222222222222233322222222222222222222222222233221133222200
Q gi|254780920|r  157 YSATKASSDYLVLA-----WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVR  231 (358)
Q Consensus       157 Yg~sK~~~E~~~~~-----~~~~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~a~  231 (358)
                      |+.||.++|+++..     +.....+.++++||++||||++  ..+++.+++.+.+|+.+.++|+|+++|||+||+|+|+
T Consensus       146 Y~~SK~~aE~~vl~a~~~~~~~~~~~~~v~lRp~~vyGp~~--~~~~~~~~~~~~~g~~~~~~g~g~~~~~~v~V~Dva~  223 (280)
T pfam01073       146 YPESKALAEKLVLKANGSTLKNGGRLYTCALRPAGIFGEGD--PFLFPFLVRLLKNGLAKFRTGDKNVLSDRVYVGNVAW  223 (280)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCC--HHHHHHHHHHHHCCCCCCCCCCCCEEECCCHHHHHHH
T ss_conf             28899999999998503344314553168854666538995--1599999999975999736799998889727876999


Q ss_pred             CEEECCCC--------CCCCCCCCCCCCCCC-CHHHHHHHHHHHHCCCCC
Q ss_conf             00000122--------222221113578642-026889999886034265
Q gi|254780920|r  232 ALYLVLKK--------GRIGERYNIGGNNER-KNIDIVFEIGFLLDALIP  272 (358)
Q Consensus       232 ~i~~~~~~--------~~~~~~fNigs~~~~-s~~e~~~~i~~~~~~~~~  272 (358)
                      |++++++.        ...|++|||++++++ |+.|+++.+++.+|...+
T Consensus       224 A~vlA~~~l~~~~~~~~~~Ge~y~i~~~~p~~s~~e~~~~~~~alG~~~p  273 (280)
T pfam01073       224 AHILAARALQDPKKASSIAGQFYFISDDTPHNSYDDFNRTLLKALGLRLP  273 (280)
T ss_pred             HHHHHHHHHCCCCCCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHCCCCC
T ss_conf             99999986014566778897489977999167799999999998099998


No 25 
>KOG1431 consensus
Probab=100.00  E-value=1.4e-45  Score=299.55  Aligned_cols=292  Identities=20%  Similarity=0.250  Sum_probs=248.9

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCC--EEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEE
Q ss_conf             94899767882779999999986898--7999947887658567776203797499976388999999998622787178
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLKI--QVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIV   78 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~~--~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~Vi   78 (358)
                      ||||||||+|.+||.+++.+. +.+.  +-.++                    +..-.+||++..+.+.+|+..+|.+||
T Consensus         2 ~kIlVtGg~GLVGsAi~~vv~-~q~~~~e~wvf--------------------~~skd~DLt~~a~t~~lF~~ekPthVI   60 (315)
T KOG1431           2 KKILVTGGTGLVGSAIVKVVQ-EQGFDDENWVF--------------------IGSKDADLTNLADTRALFESEKPTHVI   60 (315)
T ss_pred             CEEEEECCCCHHHHHHHHHHH-HCCCCCCCEEE--------------------ECCCCCCCCCHHHHHHHHHCCCCCEEE
T ss_conf             559993687417899999998-53888765699--------------------515544531368899998404870001


Q ss_pred             EECCCCCCC-CCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCC----CCCC
Q ss_conf             512343322-22222222222222222024788865123221124784278630554311222222222222----2222
Q gi|254780920|r   79 NFAAESHVD-RSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDM----PYNP  153 (358)
Q Consensus        79 HlAa~~~~~-~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~----~~~p  153 (358)
                      |+||.++.- .-...+.++++.|+....|+|..|         ..+++++++++.|..+|.+....|++|++    |+.|
T Consensus        61 hlAAmVGGlf~N~~ynldF~r~Nl~indNVlhsa---------~e~gv~K~vsclStCIfPdkt~yPIdEtmvh~gpphp  131 (315)
T KOG1431          61 HLAAMVGGLFHNNTYNLDFIRKNLQINDNVLHSA---------HEHGVKKVVSCLSTCIFPDKTSYPIDETMVHNGPPHP  131 (315)
T ss_pred             EHHHHHCCHHHCCCCCHHHHHHCCEECHHHHHHH---------HHHCHHHHHHHCCEEECCCCCCCCCCHHHHCCCCCCC
T ss_conf             0676643044147785677764014140587888---------8706056444135344688888888778861599998


Q ss_pred             CC-CCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCC----CCCC-CCCCCCCCCCCCCC
Q ss_conf             22-223332210000001233322222222222223332222----22222222222----2222-22222222332211
Q gi|254780920|r  154 SS-PYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFP----EKLIPLAITRM----IEGS-HVFLYGDGQNVRDW  223 (358)
Q Consensus       154 ~s-~Yg~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~~----~~~i~~~i~~~----~~g~-~~~i~g~g~~~Rdf  223 (358)
                      .+ .|+.+|+++....+.|+.+||.+++++.|.|+|||+|..    ++++|.+|+++    .+|. ++.+||+|...|.|
T Consensus       132 sN~gYsyAKr~idv~n~aY~~qhg~~~tsviPtNvfGphDNfnpe~sHVlPali~r~h~ak~~gtd~~~VwGsG~PlRqF  211 (315)
T KOG1431         132 SNFGYSYAKRMIDVQNQAYRQQHGRDYTSVIPTNVFGPHDNFNPENSHVLPALIHRFHEAKRNGTDELTVWGSGSPLRQF  211 (315)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCHHHHH
T ss_conf             73089999999877778999983871230023445388777883435312999999999874588448995389807887


Q ss_pred             CCCCCCCCCEEECCCCCCCCCCCCCCCCC--CCCHHHHHHHHHHHHCCCCCCCCCCCCCEEECCCCCCCCCEECCCHHHH
Q ss_conf             33222200000001222222211135786--4202688999988603426555686430233488998653003171899
Q gi|254780920|r  224 LYVEDHVRALYLVLKKGRIGERYNIGGNN--ERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSSKI  301 (358)
Q Consensus       224 i~v~D~a~~i~~~~~~~~~~~~fNigs~~--~~s~~e~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~K~  301 (358)
                      +|++|+|+++..++.....-|..|+++|+  ++++.|.++.+.+.++        ..+...+...++++..+..+|++|+
T Consensus       212 iys~DLA~l~i~vlr~Y~~vEpiils~ge~~EVtI~e~aeaV~ea~~--------F~G~l~~DttK~DGq~kKtasnsKL  283 (315)
T KOG1431         212 IYSDDLADLFIWVLREYEGVEPIILSVGESDEVTIREAAEAVVEAVD--------FTGKLVWDTTKSDGQFKKTASNSKL  283 (315)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCEEECCCCCCEEEHHHHHHHHHHHHC--------CCCEEEEECCCCCCCCCCCCCHHHH
T ss_conf             56767999999999863575545731686533679999999999828--------7752786335889871001355779


Q ss_pred             HHHHCCCCCCC-HHHHHHHHHHHHHHHHHHH
Q ss_conf             99818966108-9999999999998867865
Q gi|254780920|r  302 KSEIGWFPQEN-MESGLNKTVCWYLDNNWWW  331 (358)
Q Consensus       302 ~~~Lgw~p~~~-l~egi~~~i~w~~~n~~~~  331 (358)
                      ++ |+|.|+++ |+++|.+|++||.+|..-.
T Consensus       284 ~s-l~pd~~ft~l~~ai~~t~~Wy~~Ny~qa  313 (315)
T KOG1431         284 RS-LLPDFKFTPLEQAISETVQWYLDNYEQA  313 (315)
T ss_pred             HH-HCCCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             98-4898666838999999999999868862


No 26 
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]
Probab=100.00  E-value=4.2e-45  Score=295.13  Aligned_cols=258  Identities=26%  Similarity=0.314  Sum_probs=222.5

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCC--HHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEE
Q ss_conf             48997678827799999999868987999947887658--5677762037974999763889999999986227871785
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGN--LNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVN   79 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~--~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~ViH   79 (358)
                      +||||||+|-|||.||+++++....+++.+++-.....  ...+........+.++-||++|.+.++.++++++||+|||
T Consensus       252 ~vLVTGagGSiGsel~~qil~~~p~~i~l~~~~E~~~~~i~~el~~~~~~~~~~~~igdVrD~~~~~~~~~~~kvd~VfH  331 (588)
T COG1086         252 TVLVTGGGGSIGSELCRQILKFNPKEIILFSRDEYKLYLIDMELREKFPELKLRFYIGDVRDRDRVERAMEGHKVDIVFH  331 (588)
T ss_pred             EEEEECCCCCHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHCCCCCEEEE
T ss_conf             89996898736799999998549878999617637799999999862787516899635346899999986388866887


Q ss_pred             ECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             12343322222222222222222220247888651232211247842786305543112222222222222222222233
Q gi|254780920|r   80 FAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSA  159 (358)
Q Consensus        80 lAa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~s~Yg~  159 (358)
                      .||+.|++.++.||.+.+++||.||.|++++|.         .+++++||.+||+.              ..+|.|.||+
T Consensus       332 AAA~KHVPl~E~nP~Eai~tNV~GT~nv~~aa~---------~~~V~~~V~iSTDK--------------AV~PtNvmGa  388 (588)
T COG1086         332 AAALKHVPLVEYNPEEAIKTNVLGTENVAEAAI---------KNGVKKFVLISTDK--------------AVNPTNVMGA  388 (588)
T ss_pred             HHHHCCCCCHHCCHHHHHHHHHHHHHHHHHHHH---------HHCCCEEEEEECCC--------------CCCCCHHHHH
T ss_conf             555536863101889999872173899999999---------83977899970586--------------6688417668


Q ss_pred             CCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEC
Q ss_conf             3221000000123332---2222222222223332222222222222222222222222223322113322220000000
Q gi|254780920|r  160 TKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLV  236 (358)
Q Consensus       160 sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~a~~i~~~  236 (358)
                      ||+++|++++++++..   +..++++|++||.|.++.   ++|.|.+|+.+|+|+++ .+++.+|-|+-++|+|+.++++
T Consensus       389 TKr~aE~~~~a~~~~~~~~~T~f~~VRFGNVlGSrGS---ViPlFk~QI~~GgplTv-Tdp~mtRyfMTI~EAv~LVlqA  464 (588)
T COG1086         389 TKRLAEKLFQAANRNVSGTGTRFCVVRFGNVLGSRGS---VIPLFKKQIAEGGPLTV-TDPDMTRFFMTIPEAVQLVLQA  464 (588)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCEEEEEEECCEECCCCC---CHHHHHHHHHCCCCCCC-CCCCCEEEEEEHHHHHHHHHHH
T ss_conf             8999999999974104888857999982545458877---77889999975998454-6867056788899999999998


Q ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCEEECCCCCCC
Q ss_conf             122222221113578642026889999886034265556864302334889986
Q gi|254780920|r  237 LKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH  290 (358)
Q Consensus       237 ~~~~~~~~~fNigs~~~~s~~e~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~  290 (358)
                      ......|++|.+-.|+++++.|+++.+.++.|.    .......+++..-|||+
T Consensus       465 ~a~~~gGeifvldMGepvkI~dLAk~mi~l~g~----~~~~dI~I~~~GlRpGE  514 (588)
T COG1086         465 GAIAKGGEIFVLDMGEPVKIIDLAKAMIELAGQ----TPPGDIAIKIIGLRPGE  514 (588)
T ss_pred             HHHCCCCCEEEECCCCCEEHHHHHHHHHHHHCC----CCCCCCCEEEEECCCCH
T ss_conf             750689858998189972799999999998177----99888776998558753


No 27 
>KOG1372 consensus
Probab=100.00  E-value=3.5e-43  Score=283.30  Aligned_cols=312  Identities=22%  Similarity=0.323  Sum_probs=262.7

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCC------CCEEEEECCCCCHHHHHHHHHHCCCCE
Q ss_conf             89976788277999999998689879999478876585677762037------974999763889999999986227871
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQS------NLFSFLQVDICDRECIRSALKEFQPDA   76 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~------~~v~~i~~Di~d~~~l~~~~~~~~~d~   76 (358)
                      -||||.||+-||+|+..||.+ ||+|.++-|++++-+..++.++..+      ..+.++.+|++|...|.+++...+|+-
T Consensus        31 ALITGItGQDGSYLaEfLL~K-gYeVHGiiRRsSsFNT~RIeHlY~nP~~h~~~~mkLHYgDmTDss~L~k~I~~ikPtE  109 (376)
T KOG1372          31 ALITGITGQDGSYLAEFLLSK-GYEVHGIIRRSSSFNTARIEHLYSNPHTHNGASMKLHYGDMTDSSCLIKLISTIKPTE  109 (376)
T ss_pred             EEEECCCCCCCHHHHHHHHCC-CCEEEEEEEECCCCCHHHHHHHHCCCCCCCCCEEEEEECCCCCHHHHHHHHHCCCCHH
T ss_conf             999623688726999998708-8567678860466534557776458400256404785345554388999986058255


Q ss_pred             EEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             78512343322222222222222222220247888651232211247842786305543112222222222222222222
Q gi|254780920|r   77 IVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSP  156 (358)
Q Consensus        77 ViHlAa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~s~  156 (358)
                      |+||||++++..|++-|+.+.++...||+++|||.+....      ....+|..+||++.||...+.|.+|++|+.|+||
T Consensus       110 iYnLaAQSHVkvSFdlpeYTAeVdavGtLRlLdAi~~c~l------~~~VrfYQAstSElyGkv~e~PQsE~TPFyPRSP  183 (376)
T KOG1372         110 VYNLAAQSHVKVSFDLPEYTAEVDAVGTLRLLDAIRACRL------TEKVRFYQASTSELYGKVQEIPQSETTPFYPRSP  183 (376)
T ss_pred             HHHHHHHCCEEEEECCCHHHEECCCCCHHHHHHHHHHCCC------CCCEEEEECCCHHHCCCCCCCCCCCCCCCCCCCH
T ss_conf             4112000326798514221000102004358989986164------5452688525276546654687556888888985


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2333221000000123332222222222222333222---2222222222222222--2222222233221133222200
Q gi|254780920|r  157 YSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHF---PEKLIPLAITRMIEGS--HVFLYGDGQNVRDWLYVEDHVR  231 (358)
Q Consensus       157 Yg~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~---~~~~i~~~i~~~~~g~--~~~i~g~g~~~Rdfi~v~D~a~  231 (358)
                      |+++|..+-.++-.|++.|++-.|--.+||.-.|+..   ..+.|+.-+.++..|.  .+. .|+.+..|||-|+.|.++
T Consensus       184 Ya~aKmy~~WivvNyREAYnmfAcNGILFNHESPRRGenFVTRKItRsvakI~~gqqe~~~-LGNL~a~RDWGhA~dYVE  262 (376)
T KOG1372         184 YAAAKMYGYWIVVNYREAYNMFACNGILFNHESPRRGENFVTRKITRSVAKISLGQQEKIE-LGNLSALRDWGHAGDYVE  262 (376)
T ss_pred             HHHHHHEEEEEEEEHHHHHCCEEECCEEECCCCCCCCCCHHHHHHHHHHHHHHHCCEEEEE-ECCHHHHCCCCHHHHHHH
T ss_conf             5776441058998848841201313176547787666531357888888785213222576-347034202330677999


Q ss_pred             CEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCC------CCCCC----CEEEC--CCCCCCCCEECCCHH
Q ss_conf             0000012222222111357864202688999988603426555------68643----02334--889986530031718
Q gi|254780920|r  232 ALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS------YSHTE----LIRFI--EDRPGHDRRYAIDSS  299 (358)
Q Consensus       232 ~i~~~~~~~~~~~~fNigs~~~~s~~e~~~~i~~~~~~~~~~~------~~~~~----~~~~~--~~~~~~~~~~~~d~~  299 (358)
                      |++++++++... .|.|++|+..|+.|++..-...+|..+...      .+.+.    -.+..  -.||.++..+..|++
T Consensus       263 AMW~mLQ~d~Pd-DfViATge~hsVrEF~~~aF~~ig~~l~Weg~gv~~~~~n~~g~v~V~v~~kYyRPtEVd~LqGdas  341 (376)
T KOG1372         263 AMWLMLQQDSPD-DFVIATGEQHSVREFCNLAFAEIGEVLNWEGEGVDEVGKNDDGVVRVKVDPKYYRPTEVDTLQGDAS  341 (376)
T ss_pred             HHHHHHHCCCCC-CEEEECCCCCCHHHHHHHHHHHHCCEEEECCCCCCCCCCCCCCEEEEEECCCCCCCHHHHHHCCCHH
T ss_conf             999997137987-6588627754199999999986371777435554233336785599996644267302232137767


Q ss_pred             HHHHHHCCCCCCCHHHHHHHHHHH
Q ss_conf             999981896610899999999999
Q gi|254780920|r  300 KIKSEIGWFPQENMESGLNKTVCW  323 (358)
Q Consensus       300 K~~~~Lgw~p~~~l~egi~~~i~w  323 (358)
                      ||++.|||+|++.+.|-+++|+.-
T Consensus       342 KAk~~LgW~pkv~f~eLVkeMv~~  365 (376)
T KOG1372         342 KAKKTLGWKPKVTFPELVKEMVAS  365 (376)
T ss_pred             HHHHHCCCCCCCCHHHHHHHHHHH
T ss_conf             766640998757689999999986


No 28 
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase; InterPro: IPR005913    dTDP-4-dehydrorhamnose reductase (1.1.1.133 from EC) catalyzes the last of 4 steps in making dTDP-rhamnose, a precursor of LPS molecules such as core antigen and O-antigen.  dTDP-6-deoxy-L-mannose + NADP+ = dTDP-4-dehydro-6-deoxy-L-mannose + NADPH  ; GO: 0008831 dTDP-4-dehydrorhamnose reductase activity, 0045226 extracellular polysaccharide biosynthetic process.
Probab=100.00  E-value=1.6e-43  Score=285.41  Aligned_cols=291  Identities=21%  Similarity=0.244  Sum_probs=242.9

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEEC
Q ss_conf             48997678827799999999868987999947887658567776203797499976388999999998622787178512
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNFA   81 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~ViHlA   81 (358)
                      |||||||+|++|++|++.|.+ .|..+.++++   ++++..        .-++.+.||+|++.|.+++++.+||+|||+|
T Consensus         1 rilitGa~GQlG~~L~~~l~~-~g~~~~~~~~---~~~~~~--------~~~~~~~Dl~dP~~l~~~~r~~~Pd~vvntA   68 (317)
T TIGR01214         1 RILITGANGQLGRELVQQLSK-PGRVVVALTR---STRLKL--------AARWSQLDLTDPEALEELLRAIRPDAVVNTA   68 (317)
T ss_pred             CEEEECCCCHHHHHHHHHCCC-CCCEEEEECC---CCCCCH--------HHHHHHHCCCCHHHHHHHHHHHCCCEEEECC
T ss_conf             978873875679999997078-8827864368---777611--------3365440622468899999852875376230


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCC----CCCCCCCCCCCCCCCCCC
Q ss_conf             3433222222222222222222202478886512322112478427863055431122----222222222222222222
Q gi|254780920|r   82 AESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGS----LDKGLFSEDMPYNPSSPY  157 (358)
Q Consensus        82 a~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~----~~~~~~~E~~~~~p~s~Y  157 (358)
                      |++.||.++.+|+..+.+|..|+.+|..+|....          -.+||+||+-||..    ..+.|+.|+++++|.|.|
T Consensus        69 AYT~VD~AE~~~~~AyavNa~A~~~lA~~A~~~G----------a~~vh~STDYVFDGdfGG~~~~PY~e~D~~nPlnvY  138 (317)
T TIGR01214        69 AYTDVDGAESDPEKAYAVNALAPQNLARAAARVG----------ARLVHISTDYVFDGDFGGEGKRPYREDDETNPLNVY  138 (317)
T ss_pred             HHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCC----------CEEEEEEECEEECCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             1101000037777876574078999999998669----------159998634234475578886688764687984312


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCEEE
Q ss_conf             333221000000123332222222222222333222-222222222222-222222222222332211332222000000
Q gi|254780920|r  158 SATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHF-PEKLIPLAITRM-IEGSHVFLYGDGQNVRDWLYVEDHVRALYL  235 (358)
Q Consensus       158 g~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~-~~~~i~~~i~~~-~~g~~~~i~g~g~~~Rdfi~v~D~a~~i~~  235 (358)
                      |.||+++|..++....+  =+..|||-+++||.+.. ..+++..|++.+ ..++++.+.-  +|.-+-+|.+|+|+++..
T Consensus       139 G~SK~~GE~a~~~~~~~--e~~lIvRTsWlY~~~g~~g~NF~~tMlrLaG~~~~~l~vV~--DQ~GsPTy~~dLA~~~~~  214 (317)
T TIGR01214       139 GQSKLAGEQAVRAAGPD--ENALIVRTSWLYGAGGGSGRNFVKTMLRLAGKEREELRVVD--DQIGSPTYAKDLARAIAA  214 (317)
T ss_pred             CHHHHHHHHHHHHHCCC--CCEEEEEEEEEECCCCCCCCCHHHHHHHHCCCCCCCEEEEE--CCCCCHHHHHHHHHHHHH
T ss_conf             11156899999983799--85788985213448998842179999985378998403785--576873589999999999


Q ss_pred             CCCCC--------CCCCCCCCCCCCCCCHHHHHHHHHHHHCCCC-------CCCCCCCCCEEECCCCCCCCCEECCCHHH
Q ss_conf             01222--------2222111357864202688999988603426-------55568643023348899865300317189
Q gi|254780920|r  236 VLKKG--------RIGERYNIGGNNERKNIDIVFEIGFLLDALI-------PKSYSHTELIRFIEDRPGHDRRYAIDSSK  300 (358)
Q Consensus       236 ~~~~~--------~~~~~fNigs~~~~s~~e~~~~i~~~~~~~~-------~~~~~~~~~~~~~~~~~~~~~~~~~d~~K  300 (358)
                      +++.-        ...++||+++....|.-|+++.|.+.++...       ..........+....||.   .+.+|++|
T Consensus       215 ll~~~~Wdv~~~a~~~GvYH~~~~G~~SWyeFA~~If~~~~~~g~~~~~~~~v~Pis~~~yp~pA~RPa---yS~Ld~~~  291 (317)
T TIGR01214       215 LLERLNWDVEDAARARGVYHLANSGQVSWYEFAQAIFEVAGECGLLLKVPEEVKPISSKEYPTPARRPA---YSVLDNTK  291 (317)
T ss_pred             HHHHHCCCHHCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCEECHHCCCCCCCCCC---CHHHHHHH
T ss_conf             997613340010136734677505431368899999999985471048720001011320778998864---30445689


Q ss_pred             HHHHHC---CCCCCCHHHHHHHHHH
Q ss_conf             999818---9661089999999999
Q gi|254780920|r  301 IKSEIG---WFPQENMESGLNKTVC  322 (358)
Q Consensus       301 ~~~~Lg---w~p~~~l~egi~~~i~  322 (358)
                      +++.||   -+| -+++++++++++
T Consensus       292 ~~~~~g~P~~~l-p~Wr~al~~~l~  315 (317)
T TIGR01214       292 LVKTLGKPLLVL-PDWREALRAVLK  315 (317)
T ss_pred             HHHHHCCCCCCC-CCHHHHHHHHHH
T ss_conf             999608666799-878999999974


No 29 
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional
Probab=100.00  E-value=3.1e-43  Score=283.63  Aligned_cols=283  Identities=15%  Similarity=0.113  Sum_probs=225.4

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEE
Q ss_conf             94899767882779999999986898799994788765856777620379749997638899999999862278717851
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNF   80 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~ViHl   80 (358)
                      |||||||++|++|++|.+.|... + ++.+++..+.                + ..+|++|++.+.+++.+.+||+||||
T Consensus         1 MkILvtGa~GqLG~~l~~~l~~~-~-~~~~~~~~~~----------------~-~~~Dit~~~~v~~~~~~~~Pd~IIN~   61 (299)
T PRK09987          1 MNILLFGKTGQVGWELQRALAPL-G-NLIALDVHST----------------D-YCGDFSNPEGVAETVRKIRPDVIVNA   61 (299)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHC-C-CEEEEECCCC----------------C-CCCCCCCHHHHHHHHHHCCCCEEEEC
T ss_conf             97999899997899999986650-9-8899852630----------------0-13678999999999996599999988


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             23433222222222222222222202478886512322112478427863055431122222222222222222222333
Q gi|254780920|r   81 AAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSAT  160 (358)
Q Consensus        81 Aa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~s~Yg~s  160 (358)
                      ||++.++.++.+|+..+..|+.++.+|.++|+..          ..++||+||+.||+.....|+.|+++++|.+.||.|
T Consensus        62 aA~T~VD~~E~~~~~a~~vN~~~~~~La~~~~~~----------~~~lIhiSTD~VFdG~~~~pY~E~d~~~P~n~YG~s  131 (299)
T PRK09987         62 AAHTAVDKAESEPEFAQLLNATSVEAIAKAANEV----------GAWVVHYSTDYVFPGTGDIPWQETDATAPLNVYGET  131 (299)
T ss_pred             HHHCCHHHHHCCHHHHHHHHHHHHHHHHHHHHHC----------CCEEEEECCCEEECCCCCCCCCCCCCCCCCHHHHHH
T ss_conf             3101636652489999998889999999999973----------985999632116068999899999988963689899


Q ss_pred             CCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCC--
Q ss_conf             221000000123332222222222222333222222222222222222222222222332211332222000000012--
Q gi|254780920|r  161 KASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK--  238 (358)
Q Consensus       161 K~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~a~~i~~~~~--  238 (358)
                      |+++|+.+...+.++    .|+|.+++||+++  ..++..+++.+..++++.+..  +|...-++++|+|+++..+++  
T Consensus       132 Kl~GE~~v~~~~~~~----~IlRtswl~~~~g--~nFv~~il~~~~~~~~l~vv~--Dq~gsPT~~~~la~~~~~~i~~~  203 (299)
T PRK09987        132 KLAGEKALQDNCAKH----LIFRTSWVYAGKG--NNFAKTMLRLAKEREELSVIN--DQFGAPTGAELLADCTAHAIRVA  203 (299)
T ss_pred             HHHHHHHHHHCCCCE----EEEEEEEEECCCC--CCHHHHHHHHHHCCCCCEEEC--CEECCCCCHHHHHHHHHHHHHHH
T ss_conf             999899999628740----8851478864789--879999999987399871355--74589746999999999999997


Q ss_pred             --CCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCC------CCCCCCCCCEEECCCCCCCCCEECCCHHHHHHHHCCCCC
Q ss_conf             --222222111357864202688999988603426------555686430233488998653003171899998189661
Q gi|254780920|r  239 --KGRIGERYNIGGNNERKNIDIVFEIGFLLDALI------PKSYSHTELIRFIEDRPGHDRRYAIDSSKIKSEIGWFPQ  310 (358)
Q Consensus       239 --~~~~~~~fNigs~~~~s~~e~~~~i~~~~~~~~------~~~~~~~~~~~~~~~~~~~~~~~~~d~~K~~~~Lgw~p~  310 (358)
                        +....++||+++.+..|..|+++.|.+.+....      +.........+....||   ....+|++|+++.||.++ 
T Consensus       204 ~~~~~~~GiyH~~~~g~~S~yefA~~I~~~a~~~~~~~~~~~i~~i~s~~~~~~A~RP---~~s~Ld~~Ki~~~~gi~~-  279 (299)
T PRK09987        204 LNKPEVAGLYHLVAGGTTTWHDYAALVFEEARKAGITLALTKLNAVPTSAYPTPARRP---HNSRLNTEKFQRNFALVL-  279 (299)
T ss_pred             HCCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEEHHHCCCCCCCC---CCCCCCHHHHHHHHCCCC-
T ss_conf             3587556715604998848999999999999973997565704786665458889998---734267899998729999-


Q ss_pred             CCHHHHHHHHHHHH
Q ss_conf             08999999999999
Q gi|254780920|r  311 ENMESGLNKTVCWY  324 (358)
Q Consensus       311 ~~l~egi~~~i~w~  324 (358)
                      -+|+++|+++++-+
T Consensus       280 p~W~~~L~~~l~el  293 (299)
T PRK09987        280 PDWQVGVKRMLTEL  293 (299)
T ss_pred             CCHHHHHHHHHHHH
T ss_conf             67899999999998


No 30 
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane]
Probab=100.00  E-value=1.7e-42  Score=279.16  Aligned_cols=277  Identities=22%  Similarity=0.276  Sum_probs=234.6

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEE
Q ss_conf             94899767882779999999986898799994788765856777620379749997638899999999862278717851
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNF   80 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~ViHl   80 (358)
                      |||||||++|++|+.|++.|.  .+++|+++++.                     ..||+|++.+.++++..+||+|||+
T Consensus         1 M~iLi~G~~GqLG~~L~~~l~--~~~~v~a~~~~---------------------~~Ditd~~~v~~~i~~~~PDvVIn~   57 (281)
T COG1091           1 MKILITGANGQLGTELRRALP--GEFEVIATDRA---------------------ELDITDPDAVLEVIRETRPDVVINA   57 (281)
T ss_pred             CCEEEECCCCHHHHHHHHHHC--CCCEEEECCCC---------------------CCCCCCHHHHHHHHHHHCCCEEEEC
T ss_conf             958997698767999999717--78439951576---------------------5555685899999986199989987


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             23433222222222222222222202478886512322112478427863055431122222222222222222222333
Q gi|254780920|r   81 AAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSAT  160 (358)
Q Consensus        81 Aa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~s~Yg~s  160 (358)
                      ||++.++.+..+|+..+..|..|+.|+.++|+...          -++||+||+-||......|+.|++++.|.+.||.|
T Consensus        58 AAyt~vD~aE~~~e~A~~vNa~~~~~lA~aa~~~g----------a~lVhiSTDyVFDG~~~~~Y~E~D~~~P~nvYG~s  127 (281)
T COG1091          58 AAYTAVDKAESEPELAFAVNATGAENLARAAAEVG----------ARLVHISTDYVFDGEKGGPYKETDTPNPLNVYGRS  127 (281)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHC----------CEEEEEECCEEECCCCCCCCCCCCCCCCHHHHHHH
T ss_conf             32036541338989977767799999999999719----------76999634457438989888778999970245477


Q ss_pred             CCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCC
Q ss_conf             22100000012333222222222222233322222222222222222222222222233221133222200000001222
Q gi|254780920|r  161 KASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG  240 (358)
Q Consensus       161 K~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~a~~i~~~~~~~  240 (358)
                      |+++|..++.+...    .+|+|.+++||.+.  .+++-.|++.+..|+++.+..  +|..+-+|+.|+|+++..++...
T Consensus       128 Kl~GE~~v~~~~~~----~~I~Rtswv~g~~g--~nFv~tml~la~~~~~l~vv~--Dq~gsPt~~~dlA~~i~~ll~~~  199 (281)
T COG1091         128 KLAGEEAVRAAGPR----HLILRTSWVYGEYG--NNFVKTMLRLAKEGKELKVVD--DQYGSPTYTEDLADAILELLEKE  199 (281)
T ss_pred             HHHHHHHHHHHCCC----EEEEEEEEEECCCC--CCHHHHHHHHHHCCCCEEEEC--CEEECCCCHHHHHHHHHHHHHCC
T ss_conf             89789999973998----79998565545888--778999999850599269979--84538746999999999998345


Q ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCC-CCCCCCEEECCCCCCCCCEECCCHHHHHHHHCCCCCCCHHHHHHH
Q ss_conf             2222111357864202688999988603426555-686430233488998653003171899998189661089999999
Q gi|254780920|r  241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS-YSHTELIRFIEDRPGHDRRYAIDSSKIKSEIGWFPQENMESGLNK  319 (358)
Q Consensus       241 ~~~~~fNigs~~~~s~~e~~~~i~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~d~~K~~~~Lgw~p~~~l~egi~~  319 (358)
                      ..+.+||+++....|+.|+++.|.+.++...... .......+....||.   ...+|+.|+++.+|+.| .+|++++++
T Consensus       200 ~~~~~yH~~~~g~~Swydfa~~I~~~~~~~~~v~~~~~~~~~~~~a~RP~---~S~L~~~k~~~~~~~~~-~~w~~~l~~  275 (281)
T COG1091         200 KEGGVYHLVNSGECSWYEFAKAIFEEAGVDGEVIEPIASAEYPTPAKRPA---NSSLDTKKLEKAFGLSL-PEWREALKA  275 (281)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCC---CCCCCHHHHHHHHCCCC-CCHHHHHHH
T ss_conf             55867998079741199999999998388864145556223676678975---55425288999748898-259999999


Q ss_pred             HHH
Q ss_conf             999
Q gi|254780920|r  320 TVC  322 (358)
Q Consensus       320 ~i~  322 (358)
                      +++
T Consensus       276 ~~~  278 (281)
T COG1091         276 LLD  278 (281)
T ss_pred             HHH
T ss_conf             973


No 31 
>KOG1430 consensus
Probab=100.00  E-value=4.3e-42  Score=276.61  Aligned_cols=313  Identities=23%  Similarity=0.315  Sum_probs=242.1

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHC-CCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEE
Q ss_conf             48997678827799999999868-98799994788765856777620379749997638899999999862278717851
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDL-KIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNF   80 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~-~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~ViHl   80 (358)
                      .+|||||+||+|.||+.+|+++. ..+|.++|................+.+++++++|+++...+.+++.+  + .|+||
T Consensus         6 ~vlVtGG~GflG~hlv~~L~~~~~~~~irv~D~~~~~~~~~~e~~~~~~~~v~~~~~D~~~~~~i~~a~~~--~-~Vvh~   82 (361)
T KOG1430           6 SVLVTGGSGFLGQHLVQALLENELKLEIRVVDKTPTQSNLPAELTGFRSGRVTVILGDLLDANSISNAFQG--A-VVVHC   82 (361)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCHHHHCCCCCCEEEEECCHHHHHHHHHHCCC--C-EEEEE
T ss_conf             79998983378999999998456661799953677555651455334677436872230000556652157--6-07875


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCC-CCCCCC--CCCCCCCC
Q ss_conf             234332222222222222222222024788865123221124784278630554311222222-222222--22222222
Q gi|254780920|r   81 AAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKG-LFSEDM--PYNPSSPY  157 (358)
Q Consensus        81 Aa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~-~~~E~~--~~~p~s~Y  157 (358)
                      ||.+.++....++...+++||.||.|++++|+.         .+++++||+||..|....... .-+|+.  |..+.++|
T Consensus        83 aa~~~~~~~~~~~~~~~~vNV~gT~nvi~~c~~---------~~v~~lIYtSs~~Vvf~g~~~~n~~E~~p~p~~~~d~Y  153 (361)
T KOG1430          83 AASPVPDFVENDRDLAMRVNVNGTLNVIEACKE---------LGVKRLIYTSSAYVVFGGEPIINGDESLPYPLKHIDPY  153 (361)
T ss_pred             CCCCCCCCCCCCHHHHEEECCHHHHHHHHHHHH---------HCCCEEEEECCCEEEECCEECCCCCCCCCCCCCCCCCC
T ss_conf             165675202356125214140508999999998---------29878999467428868835455777878755455433


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECC
Q ss_conf             33322100000012333222222222222233322222222222222222222222222233221133222200000001
Q gi|254780920|r  158 SATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVL  237 (358)
Q Consensus       158 g~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~a~~i~~~~  237 (358)
                      +.||..+|++++..+...++.++++||+.+|||++  .+++|..+.-+.+|+-+...|+++..-||+|++.++.|+.++.
T Consensus       154 ~~sKa~aE~~Vl~an~~~~l~T~aLR~~~IYGpgd--~~~~~~i~~~~~~g~~~f~~g~~~~~~~~~~~~Nva~ahilA~  231 (361)
T KOG1430         154 GESKALAEKLVLEANGSDDLYTCALRPPGIYGPGD--KRLLPKIVEALKNGGFLFKIGDGENLNDFTYGENVAWAHILAA  231 (361)
T ss_pred             CHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCC--CCCCHHHHHHHHHCCCEEEEECCCCCCCEEEECHHHHHHHHHH
T ss_conf             25899999999985699871589970341117997--5204789999980685178605664102288023279999889


Q ss_pred             C-----C-CCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCC-CCCCCCCEE-----------EC-CCCCCCC-------
Q ss_conf             2-----2-2222211135786420268899998860342655-568643023-----------34-8899865-------
Q gi|254780920|r  238 K-----K-GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPK-SYSHTELIR-----------FI-EDRPGHD-------  291 (358)
Q Consensus       238 ~-----~-~~~~~~fNigs~~~~s~~e~~~~i~~~~~~~~~~-~~~~~~~~~-----------~~-~~~~~~~-------  291 (358)
                      .     . ...|++|+|+.++++...++...+...+|...+. ...+.....           .. +.+|...       
T Consensus       232 ~aL~~~~~~~~Gq~yfI~d~~p~~~~~~~~~l~~~lg~~~~~~~~~p~~l~~~~~~l~e~~~~~l~p~~p~lt~~~v~~~  311 (361)
T KOG1430         232 RALLDKSPSVNGQFYFITDDTPVRFFDFLSPLVKALGYCLPSSIKLPLFLSYFLAYLLEIVYFLLRPYQPILTRFRVALL  311 (361)
T ss_pred             HHHHHCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCEEECCHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHEEE
T ss_conf             98871487668508998689812036888999884399987556443589999999999999860677877576672231


Q ss_pred             -CEECCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             -3003171899998189661089999999999998867
Q gi|254780920|r  292 -RRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNN  328 (358)
Q Consensus       292 -~~~~~d~~K~~~~Lgw~p~~~l~egi~~~i~w~~~n~  328 (358)
                       ...+.|+.||+++|||+|.++++|++.+++.|+..-.
T Consensus       312 ~~~~~f~~~kA~~~lgY~P~~~~~e~~~~~~~~~~~~~  349 (361)
T KOG1430         312 GVTRTFSIEKAKRELGYKPLVSLEEAIQRTIHWVASES  349 (361)
T ss_pred             CCCCCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             14455078998776289986787898999999873421


No 32 
>KOG1502 consensus
Probab=100.00  E-value=1.3e-39  Score=261.43  Aligned_cols=304  Identities=20%  Similarity=0.203  Sum_probs=217.8

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCC-CHHHHHHHH-CCCCEEEEECCCCCHHHHHHHHHHCCCCEEE
Q ss_conf             94899767882779999999986898799994788765-856777620-3797499976388999999998622787178
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAG-NLNSLKEIS-QSNLFSFLQVDICDRECIRSALKEFQPDAIV   78 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~-~~~~~~~~~-~~~~v~~i~~Di~d~~~l~~~~~~~~~d~Vi   78 (358)
                      |+|+||||+||||||++++||++ ||.|.+.-|..... ....+..+. ..+++..+++||+|++.+++++.+|  |.||
T Consensus         7 ~~VcVTGAsGfIgswivk~LL~r-GY~V~gtVR~~~~~k~~~~L~~l~~a~~~l~l~~aDL~d~~sf~~ai~gc--dgVf   83 (327)
T KOG1502           7 KKVCVTGASGFIGSWIVKLLLSR-GYTVRGTVRDPEDEKKTEHLRKLEGAKERLKLFKADLLDEGSFDKAIDGC--DGVF   83 (327)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHC-CCEEEEEECCCCHHHHHHHHHHCCCCCCCCEEEECCCCCCCHHHHHHHCC--CEEE
T ss_conf             27999488208999999999868-99899997086305658999865157544258852435513599997078--7899


Q ss_pred             EECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCC-CCCCC-C---CCCCCCCCCCCCC
Q ss_conf             51234332222222222222222222024788865123221124784278630554-31122-2---2222222222222
Q gi|254780920|r   79 NFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTD-EVYGS-L---DKGLFSEDMPYNP  153 (358)
Q Consensus        79 HlAa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~-~vYg~-~---~~~~~~E~~~~~p  153 (358)
                      |.|+....... ..+.+.++..+.||+|+|++|+..        +.++|+|++||. ++... +   +...++|+.--.+
T Consensus        84 H~Asp~~~~~~-~~e~~li~pav~Gt~nVL~ac~~~--------~sVkrvV~TSS~aAv~~~~~~~~~~~vvdE~~wsd~  154 (327)
T KOG1502          84 HTASPVDFDLE-DPEKELIDPAVKGTKNVLEACKKT--------KSVKRVVYTSSTAAVRYNGPNIGENSVVDEESWSDL  154 (327)
T ss_pred             EECCCCCCCCC-CCHHHHHHHHHHHHHHHHHHHHCC--------CCCCEEEEECCHHHHCCCCCCCCCCCCCCCCCCCCH
T ss_conf             91766787778-747766317888899999998605--------872269996147871147767888854565557818


Q ss_pred             ------CCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             ------222233322100000012333222222222222233322222-2222222222222222222222332211332
Q gi|254780920|r  154 ------SSPYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPE-KLIPLAITRMIEGSHVFLYGDGQNVRDWLYV  226 (358)
Q Consensus       154 ------~s~Yg~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~~~-~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v  226 (358)
                            ...|..||..+|+.+..|+++.+++.+.+.|+.|+||...++ +.....+.+.++|..-.. .  .....|+||
T Consensus       155 ~~~~~~~~~Y~~sK~lAEkaAw~fa~e~~~~lv~inP~lV~GP~l~~~l~~s~~~~l~~i~G~~~~~-~--n~~~~~VdV  231 (327)
T KOG1502         155 DFCRCKKLWYALSKTLAEKAAWEFAKENGLDLVTINPGLVFGPGLQPSLNSSLNALLKLIKGLAETY-P--NFWLAFVDV  231 (327)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCEECCCCCCCCCHHHHHHHHHHHCCCCCC-C--CCCEEEEEH
T ss_conf             8887667788999999999999999857961899668713797756665502999999870655457-8--774346769


Q ss_pred             CCCCCCEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCEEECCCCCCCCCEECCCHHHHHHHHC
Q ss_conf             22200000001222222211135786420268899998860342655568643023348899865300317189999818
Q gi|254780920|r  227 EDHVRALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSSKIKSEIG  306 (358)
Q Consensus       227 ~D~a~~i~~~~~~~~~~~~fNigs~~~~s~~e~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~K~~~~Lg  306 (358)
                      +|+|.|++++++++..++.|.+.++. .++.|+++.+.+.+....    ....   ..............+++|+++++|
T Consensus       232 rDVA~AHv~a~E~~~a~GRyic~~~~-~~~~ei~~~l~~~~P~~~----ip~~---~~~~~~~~~~~~~~~~~k~k~lg~  303 (327)
T KOG1502         232 RDVALAHVLALEKPSAKGRYICVGEV-VSIKEIADILRELFPDYP----IPKK---NAEEHEGFLTSFKVSSEKLKSLGG  303 (327)
T ss_pred             HHHHHHHHHHHCCCCCCCEEEEECCC-CCHHHHHHHHHHHCCCCC----CCCC---CCCCCCCCCCCCCCCCHHHHHCCC
T ss_conf             99899999997176668349995276-529999999998688877----7877---776566554333334088886156


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             9661089999999999998867
Q gi|254780920|r  307 WFPQENMESGLNKTVCWYLDNN  328 (358)
Q Consensus       307 w~p~~~l~egi~~~i~w~~~n~  328 (358)
                      |+. ++++|++.+|+.++++..
T Consensus       304 ~~~-~~l~e~~~dt~~sl~~~~  324 (327)
T KOG1502         304 FKF-RPLEETLSDTVESLREKG  324 (327)
T ss_pred             CEE-CCHHHHHHHHHHHHHHHC
T ss_conf             310-576999999999999853


No 33 
>TIGR01777 yfcH conserved hypothetical protein TIGR01777; InterPro: IPR010099   This entry represents proteins of unknown function including the Escherichia coli YfcH protein..
Probab=100.00  E-value=6.4e-34  Score=226.65  Aligned_cols=295  Identities=21%  Similarity=0.270  Sum_probs=196.2

Q ss_pred             EEEECC-CCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEEC
Q ss_conf             899767-8827799999999868987999947887658567776203797499976388999999998622787178512
Q gi|254780920|r    3 LIVTGG-AGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNFA   81 (358)
Q Consensus         3 ILItG~-tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~ViHlA   81 (358)
                      |||||| |||||++|+.+|. +.||+|+.+-|.....+................-.++.+.+ . +.++.  .|+|||||
T Consensus         1 ~litGgnTGfiG~~L~~~L~-~~g~~V~~l~R~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~-W-~~l~~--~DaviNLA   75 (307)
T TIGR01777         1 ILITGGNTGFIGRALTQRLT-KSGHEVTILTRSPQAESNTKKVGYKNWLAEGKLGIVIAESG-W-SALEG--ADAVINLA   75 (307)
T ss_pred             CEECCCCCCHHHHHHHHHHH-HCCCEEEEEEECCCCCCCHHCCCCCCCCCCCCCCCCCCHHC-C-CCCCC--CCEEEECC
T ss_conf             96415330237899999998-47998999961686432000255445555221245207220-5-66788--62798556


Q ss_pred             CCCCCC-CCCC--CCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             343322-2222--2222222222222024788865123221124784278630554311222222222222222222223
Q gi|254780920|r   82 AESHVD-RSIL--GADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYS  158 (358)
Q Consensus        82 a~~~~~-~~~~--~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~s~Yg  158 (358)
                      +.+-.+ .-+.  ......++-|.+|..|.++.+...-    .....+.||-+|...-||...+.+++|+++..+.+-| 
T Consensus        76 G~~i~~P~RWt~~~K~~i~~SRi~~T~~L~~~i~~~~r----~~~~P~~~isaSAvGyYG~~~~~~~tE~~~~~~~ddF-  150 (307)
T TIGR01777        76 GEPIADPKRWTEERKQEIRDSRIDTTRALVEAIAAAPR----AEQKPKVFISASAVGYYGHSEDRVFTEEDASGPGDDF-  150 (307)
T ss_pred             CCCCCCCCCCCHHHHHHHHHCCHHHHHHHHHHHHHCCC----CCCCCCEEEEEEEEEEECCCCCCEEECCCCCCCCCCC-
T ss_conf             88857788878777575652334789999999984656----6788716885016663068998215116678887772-


Q ss_pred             CCCCCCEEEEC-CCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEC
Q ss_conf             33221000000-12333222222222222233322-22222222222222222222222223322113322220000000
Q gi|254780920|r  159 ATKASSDYLVL-AWGHTYGIPVLLSNCSNNYGPYH-FPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLV  236 (358)
Q Consensus       159 ~sK~~~E~~~~-~~~~~~~l~~~ilR~~~vyGp~~-~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~a~~i~~~  236 (358)
                      .++++-+.--. .-+++.|+++|++|.+.|.|+.+ .-.++++-  -+.--|+|+   |+|+|..+|||++|+|++|+.+
T Consensus       151 la~lc~~WE~~A~~a~~~g~Rvv~~R~G~VLg~~GGaL~~m~~p--f~~glGGpl---G~G~Q~~SWIH~~D~v~~I~~~  225 (307)
T TIGR01777       151 LAELCRDWEEAAQAAEQLGTRVVLLRTGIVLGPKGGALAKMLPP--FRLGLGGPL---GSGRQWFSWIHIEDLVQLILFA  225 (307)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEEEEEEEECCCCCCHHHHHHH--HHHHCCCCC---CCCCCCCCHHHHHHHHHHHHHH
T ss_conf             18999999998510533687389876413470898703454566--765157423---6884145053588999999999


Q ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCEEECCCCCCCCCEECCC-----HHHHHHHHCCCCCC
Q ss_conf             1222222211135786420268899998860342655568643023348899865300317-----18999981896610
Q gi|254780920|r  237 LKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAID-----SSKIKSEIGWFPQE  311 (358)
Q Consensus       237 ~~~~~~~~~fNigs~~~~s~~e~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d-----~~K~~~~Lgw~p~~  311 (358)
                      +++....++||++.++|++..||++++++.+.+........ ..+..   -.|+.....++     .+|+.+ .||+.+|
T Consensus       226 l~~~~~~Gp~N~tAP~Pv~n~~F~~~la~~l~RP~~~~vP~-~~~~~---~LGe~a~~~L~gQrV~P~kl~~-~GF~F~Y  300 (307)
T TIGR01777       226 LENASVSGPVNATAPEPVRNKEFAKALARALHRPAFLPVPA-FVLRL---LLGEMADLLLKGQRVLPEKLLE-AGFQFQY  300 (307)
T ss_pred             HHCCCCCCCEEEECCCCCCHHHHHHHHHHHHCCCCCCCCHH-HHHHH---HHHHHHHHHHHHHHHHHHHHHH-CCCEEEC
T ss_conf             85589963254107886357899999999818970101108-99998---8425588898657899999997-4976621


Q ss_pred             C-HHHHH
Q ss_conf             8-99999
Q gi|254780920|r  312 N-MESGL  317 (358)
Q Consensus       312 ~-l~egi  317 (358)
                      + ++++|
T Consensus       301 ~~l~~AL  307 (307)
T TIGR01777       301 PDLDEAL  307 (307)
T ss_pred             CCCCCCC
T ss_conf             3320249


No 34 
>CHL00194 ycf39 Ycf39; Provisional
Probab=99.97  E-value=7.7e-32  Score=213.96  Aligned_cols=278  Identities=15%  Similarity=0.187  Sum_probs=200.0

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEE
Q ss_conf             94899767882779999999986898799994788765856777620379749997638899999999862278717851
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNF   80 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~ViHl   80 (358)
                      |+||||||||++|++++++|+++ ||+|.++.|.     ..... .....+++.+.+|++|++.+..++++.  |+|||+
T Consensus         1 M~ILV~GATG~lGr~vVr~Ll~~-G~~Vr~lvRn-----p~ka~-~l~~~Gve~v~gDl~dpesl~~Al~Gv--daVi~~   71 (319)
T CHL00194          1 MSLLVIGATGTLGRQIVRRALDE-GYQVKCLVRN-----LRKAA-FLKEWGAELVYGDLSLPETIPPALEGI--TAIIDA   71 (319)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHC-CCCEEEEECC-----HHHHH-HHHHCCCEEEEECCCCHHHHHHHHCCC--CEEEEE
T ss_conf             97999899858999999999968-8908999578-----67632-342159679994278877899996599--679994


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             23433222222222222222222202478886512322112478427863055431122222222222222222222333
Q gi|254780920|r   81 AAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSAT  160 (358)
Q Consensus        81 Aa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~s~Yg~s  160 (358)
                      +...     ..++....++...|+.+++++|+         +.++++|||.|...+             ...|.++|..+
T Consensus        72 ~~~~-----~~~~~~~~~vd~~g~~~li~AAk---------~aGVkr~V~lS~lga-------------~~~~~~p~~~~  124 (319)
T CHL00194         72 STSR-----PSDLNNAYQIDLEGKLALIEAAK---------AAKVKRFIFFSILNA-------------EQYPQVPLMKI  124 (319)
T ss_pred             CCCC-----CCCCCHHHHHHHHHHHHHHHHHH---------HCCCCEEEEECCCCC-------------CCCCCCHHHHH
T ss_conf             5667-----78862088988988999999999---------849988999613566-------------66887567787


Q ss_pred             CCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCC
Q ss_conf             22100000012333222222222222233322222222222222222222222222233221133222200000001222
Q gi|254780920|r  161 KASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG  240 (358)
Q Consensus       161 K~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~a~~i~~~~~~~  240 (358)
                      |...|.+++    +.|++++|+||+..+.      +++.++...++.+.++.+.+ +...-.|+++.|+|+++..++..+
T Consensus       125 K~~~E~~L~----~Sgl~~TIlRPs~F~q------~l~~~~a~pi~~~~~v~~~~-~~~~ia~I~~~DVA~~~a~aL~~~  193 (319)
T CHL00194        125 KSDIEEKLK----QSGINYTIFRLAGFFQ------GLISQYAIPILDSQTIWITG-ESTPIAYIDTQDAAKFALKSLSLP  193 (319)
T ss_pred             HHHHHHHHH----HCCCCEEEECCHHHHH------HHHHHHHHHHHCCCCEEECC-CCCCCCCCCHHHHHHHHHHHHCCC
T ss_conf             999999998----6799859984739999------88998767763078577669-987528877999999999995897


Q ss_pred             C-CCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCEEECCC-------------CC------CCCCEECCCHHH
Q ss_conf             2-222111357864202688999988603426555686430233488-------------99------865300317189
Q gi|254780920|r  241 R-IGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIED-------------RP------GHDRRYAIDSSK  300 (358)
Q Consensus       241 ~-~~~~fNigs~~~~s~~e~~~~i~~~~~~~~~~~~~~~~~~~~~~~-------------~~------~~~~~~~~d~~K  300 (358)
                      . .|.+|.+++++..|..|+++.+.++.|+..+....+.....+...             |.      +.-..+..+.+.
T Consensus       194 ~~~gk~y~L~GP~a~T~~EIa~l~~~~~Gk~~~i~~vP~~~~~~~~~~~~~f~~~~~i~~rl~f~ev~~~~~~~~~~~~~  273 (319)
T CHL00194        194 ETKNKTFPLVGPKSWNSSEIISLCEQLSGQKAKVTRIPLFLLKLLRRITGFFEWTWNISDRLAFAEVLSEGNNFSASMAD  273 (319)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCEEECCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCHHH
T ss_conf             75898999549863899999999999859998778689899999999998723342599999999996559865788899


Q ss_pred             HHHHHCCCCC--CCHHHHHHHHHHHHH
Q ss_conf             9998189661--089999999999998
Q gi|254780920|r  301 IKSEIGWFPQ--ENMESGLNKTVCWYL  325 (358)
Q Consensus       301 ~~~~Lgw~p~--~~l~egi~~~i~w~~  325 (358)
                      ..+.+|-.|.  +++|+-+++++.-.+
T Consensus       274 ~~~~~~~~~~~~~~le~y~~ey~~~il  300 (319)
T CHL00194        274 VYKIFKIDSNEITSLEDYLQEYFGRIL  300 (319)
T ss_pred             HHHHHCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             987718892222218999999999999


No 35 
>pfam07993 NAD_binding_4 Male sterility protein. This family represents the C-terminal region of the male sterility protein in a number of arabidopsis and drosophila. A sequence-related jojoba acyl CoA reductase is also included.
Probab=99.97  E-value=2.3e-32  Score=217.12  Aligned_cols=213  Identities=20%  Similarity=0.223  Sum_probs=153.0

Q ss_pred             EECCCCHHHHHHHHHHHHHC-CCEEEEEECCCCCCC-HHHHHH----------HHCCCCEEEEECCCC------CHHHHH
Q ss_conf             97678827799999999868-987999947887658-567776----------203797499976388------999999
Q gi|254780920|r    5 VTGGAGFIGSALCRYLVNDL-KIQVLVIDKLTYAGN-LNSLKE----------ISQSNLFSFLQVDIC------DRECIR   66 (358)
Q Consensus         5 ItG~tGfIGs~l~~~Ll~~~-~~~V~~~d~~~~~~~-~~~~~~----------~~~~~~v~~i~~Di~------d~~~l~   66 (358)
                      |||||||||+||+.+|+++. +..|+++-|...... ..++..          ....++++++.|||+      +.+.++
T Consensus         1 vTGaTGFlG~~ll~~Ll~~~~~~~V~~LvR~~~~~~~~~r~~~~~~~~~~~~~~~~~~ri~~v~gDl~~~~lGL~~~~~~   80 (245)
T pfam07993         1 LTGATGFLGKVLLEKLLRSCPEVKIYCLVRAKDGESALERLRQELLKYGLFDRLKALERIIPVAGDLSEPNLGLSDEDFQ   80 (245)
T ss_pred             CCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHHCCCCCHHHCCCCEEEEECCCCCCCCCCCHHHHH
T ss_conf             93843599999999999579997899996789840589999999985675310103477799956168865798999999


Q ss_pred             HHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCC
Q ss_conf             99862278717851234332222222222222222222024788865123221124784278630554311222222222
Q gi|254780920|r   67 SALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFS  146 (358)
Q Consensus        67 ~~~~~~~~d~ViHlAa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~  146 (358)
                      .+.++  +|+|||+||..+..   .+.....++|+.||.+++++|+.         .+.++|+|+||+.++|........
T Consensus        81 ~l~~~--vd~IiH~Aa~v~~~---~~~~~~~~~NV~gt~~ll~~a~~---------~~~~~~v~vSS~~~~~~~~~~~~~  146 (245)
T pfam07993        81 ELAEE--VDVIIHNAATVNFV---EPYSDLRATNVLGTREVLRLAKQ---------MKKLPFHHVSTAYVNGERGGLLEE  146 (245)
T ss_pred             HHHHC--CCEEEECCEEECCC---CCHHHHHHHHHHHHHHHHHHHHH---------CCCCEEEEEECCEECCCCCCCCCC
T ss_conf             99835--99999874330356---88899999999999999999997---------699859999581650667787666


Q ss_pred             CCC---------CCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCC-CCCCCCC
Q ss_conf             222---------22222222333221000000123332222222222222333222----222222222222-2222222
Q gi|254780920|r  147 EDM---------PYNPSSPYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHF----PEKLIPLAITRM-IEGSHVF  212 (358)
Q Consensus       147 E~~---------~~~p~s~Yg~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~----~~~~i~~~i~~~-~~g~~~~  212 (358)
                      |..         .....+.|+.||.++|++++.+++  |++.+|+||+.|||+...    .+..++.++..+ ..|.-+.
T Consensus       147 ~~~~~~~~~~~~~~~~~~~Y~~SK~~aE~lv~~~~~--gl~~~I~Rp~~v~G~s~~G~~~~~~~~~~~~~~~~~~g~~p~  224 (245)
T pfam07993       147 KPYPLDEDEPALLGGLPNGYTQSKWLAEQLVREAAG--GLPVVIYRPSIITGESRTGWINGDDFGPRGLLGGAGLGVLPD  224 (245)
T ss_pred             CCCCCCCCCHHCCCCCCCHHHHHHHHHHHHHHHHHC--CCCEEEEECCEEECCCCCCCCCCHHHHHHHHHHHHHCCCCCC
T ss_conf             567888760110366688289999999999999733--299899969878658988870605469999999998799762


Q ss_pred             CCCCCCCCCCCCCCCCCCCCE
Q ss_conf             222223322113322220000
Q gi|254780920|r  213 LYGDGQNVRDWLYVEDHVRAL  233 (358)
Q Consensus       213 i~g~g~~~Rdfi~v~D~a~~i  233 (358)
                      +.|+++...||++||++|+++
T Consensus       225 ~~~~~~~~~d~vpVD~va~ai  245 (245)
T pfam07993       225 ILGDPDARLDLVPVDYVANAI  245 (245)
T ss_pred             CCCCCCCEEEEEEHHHHHHHC
T ss_conf             469988556477399997259


No 36 
>PRK07201 short chain dehydrogenase; Provisional
Probab=99.96  E-value=5.8e-30  Score=202.47  Aligned_cols=251  Identities=23%  Similarity=0.246  Sum_probs=179.4

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCC------HHHHHHHHHHCCC
Q ss_conf             9489976788277999999998689879999478876585677762037974999763889------9999999862278
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD------RECIRSALKEFQP   74 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d------~~~l~~~~~~~~~   74 (358)
                      |++|+||||||||++|++.||++.+.+|+++-|.....+..........++++.+.|||+.      .+.++.+-+  ++
T Consensus         1 mnyflTGaTGFLG~~LL~~LL~~~~a~V~cLVR~~s~~r~~~~~~~~~~~Rv~~v~GDL~~p~LGLs~~~~~~La~--~v   78 (663)
T PRK07201          1 MRYFVTGGTGFIGRRLVSRLLDRPGARVHVLVRRQSLGRFERLAEYWGVDRVVPVVGDLTAPELGLSAETIAELKG--KI   78 (663)
T ss_pred             CCEEECCCCCHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHHC--CC
T ss_conf             9365406842889999999984899989999787749999999997489887994677787678959999999967--48


Q ss_pred             CEEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCC---
Q ss_conf             71785123433222222222222222222202478886512322112478427863055431122222222222222---
Q gi|254780920|r   75 DAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPY---  151 (358)
Q Consensus        75 d~ViHlAa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~---  151 (358)
                      |+||||||.......   -......||.||.++|+.|..         .+.+.|.|.||..|.|... +.+.|++..   
T Consensus        79 d~I~H~aA~v~~~~~---y~~~~~~NV~GTr~vL~LA~~---------~~~~~~h~vST~~VaG~~~-g~~~Ed~~d~~~  145 (663)
T PRK07201         79 DHFFHLAAVYDLTAD---EESQRAANVEGTRAAIELAER---------LDAGTFHHVSSIAVAGLFE-GVFREDMFDEAQ  145 (663)
T ss_pred             CEEEECCEEECCCCC---HHHHHHHHHHHHHHHHHHHHH---------CCCCEEEEEEECEECCCCC-CCCCCCCCCCCC
T ss_conf             999989823578899---899765212999999999984---------7997479996374536889-875444454446


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCC-----CCCCC--CCCCCCCCCCCCCC--CCCCCCCCCCCC
Q ss_conf             2222223332210000001233322222222222223332-----22222--22222222222222--222222233221
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPY-----HFPEK--LIPLAITRMIEGSH--VFLYGDGQNVRD  222 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~-----~~~~~--~i~~~i~~~~~g~~--~~i~g~g~~~Rd  222 (358)
                      .-.++|+.||..+|++++.   .-|++++|.||+.|.|..     +..++  .+-.++.++...-|  ..+.+...-.-+
T Consensus       146 ~l~~~Y~qSK~~AE~lVr~---a~glP~~IyRPg~V~GdS~TG~~~k~Dgpy~~~~ll~~l~~~~p~~~P~~~~~~~~~n  222 (663)
T PRK07201        146 DLPTPYHRTKFEAEKLVRE---ECGLPWRIYRPAVVVGDSRTGEMDKIDGPYYFFKVIQKLRAVLPSWTPMLGPEGGRTN  222 (663)
T ss_pred             CCCCCCHHHHHHHHHHHHH---CCCCCEEEEECCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCEEE
T ss_conf             6899616589999999997---4899879980857623665676446640789999999998636554566677777322


Q ss_pred             CCCCCCCCCCEEECCCC-CCCCCCCCCCCCCCCCHHHHHHHHHHHHCC
Q ss_conf             13322220000000122-222221113578642026889999886034
Q gi|254780920|r  223 WLYVEDHVRALYLVLKK-GRIGERYNIGGNNERKNIDIVFEIGFLLDA  269 (358)
Q Consensus       223 fi~v~D~a~~i~~~~~~-~~~~~~fNigs~~~~s~~e~~~~i~~~~~~  269 (358)
                      ++-||=+++|+..+..+ +..|.+|+++.++|+++.++...+++....
T Consensus       223 ~vPVDfV~~Ai~~Ls~~~~~~g~~fHL~dP~p~~~~~v~~~~a~~~~~  270 (663)
T PRK07201        223 IVPVDYVVDALDHLAHADGRDGQTFHLTDPKPYRVGDIYNIFAEAAGA  270 (663)
T ss_pred             EECHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCHHHHHHHHHHHCCC
T ss_conf             511667999999995598878867870599986389999998873389


No 37 
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only]
Probab=99.95  E-value=1.1e-28  Score=194.69  Aligned_cols=280  Identities=22%  Similarity=0.311  Sum_probs=191.0

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEECC
Q ss_conf             89976788277999999998689879999478876585677762037974999763889999999986227871785123
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNFAA   82 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~ViHlAa   82 (358)
                      |+|||||||||++|+..|. +.||+|+.+.|.....+.+      .+.++.       ..+.+.+.... .+|+|||||+
T Consensus         1 IliTGgTGlIG~~L~~~L~-~~gh~v~iltR~~~~~~~~------~~~~v~-------~~~~~~~~~~~-~~DavINLAG   65 (297)
T COG1090           1 ILITGGTGLIGRALTARLR-KGGHQVTILTRRPPKASQN------LHPNVT-------LWEGLADALTL-GIDAVINLAG   65 (297)
T ss_pred             CEEECCCCCHHHHHHHHHH-HCCCEEEEEECCCCCHHHH------CCCCCC-------CCCHHHHCCCC-CCCEEEECCC
T ss_conf             9573566501689999998-4898699997478502332------476533-------43012440367-8778998889


Q ss_pred             CCCCCCCC--CCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             43322222--2222222222222202478886512322112478427863055431122222222222222222222333
Q gi|254780920|r   83 ESHVDRSI--LGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSAT  160 (358)
Q Consensus        83 ~~~~~~~~--~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~s~Yg~s  160 (358)
                      .+-..+-+  +......++-+..|..|.++...       .....+.|+-.|....||...+..++|+.++.-       
T Consensus        66 ~~I~~rrWt~~~K~~i~~SRi~~T~~L~e~I~~-------~~~~P~~~isaSAvGyYG~~~~~~~tE~~~~g~-------  131 (297)
T COG1090          66 EPIAERRWTEKQKEEIRQSRINTTEKLVELIAA-------SETKPKVLISASAVGYYGHSGDRVVTEESPPGD-------  131 (297)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH-------CCCCCCEEEECCEEEEECCCCCEEEECCCCCCC-------
T ss_conf             815446578899999999776899999999985-------267980898524577755888646415788877-------


Q ss_pred             CCCCEEEECCC------CCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCE
Q ss_conf             22100000012------333222222222222233322-22222222222222222222222223322113322220000
Q gi|254780920|r  161 KASSDYLVLAW------GHTYGIPVLLSNCSNNYGPYH-FPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRAL  233 (358)
Q Consensus       161 K~~~E~~~~~~------~~~~~l~~~ilR~~~vyGp~~-~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~a~~i  233 (358)
                       -...++|+.|      +++-|+++|.+|.+.|.||.+ .-..++|.|  +.-.|+++   |+|.|..+|||++|+++++
T Consensus       132 -~Fla~lc~~WE~~a~~a~~~gtRvvllRtGvVLs~~GGaL~~m~~~f--k~glGG~~---GsGrQ~~SWIhieD~v~~I  205 (297)
T COG1090         132 -DFLAQLCQDWEEEALQAQQLGTRVVLLRTGVVLSPDGGALGKMLPLF--KLGLGGKL---GSGRQWFSWIHIEDLVNAI  205 (297)
T ss_pred             -CHHHHHHHHHHHHHHHHHHCCCEEEEEEEEEEECCCCCCHHHHCCHH--HHCCCCCC---CCCCCEEEEEEHHHHHHHH
T ss_conf             -75999999999998666406846999988778617886034310135--52257715---8987303433299999999


Q ss_pred             EECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCEEECCCCCCCCCEECCC-----HHHHHHHHCCC
Q ss_conf             0001222222211135786420268899998860342655568643023348899865300317-----18999981896
Q gi|254780920|r  234 YLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAID-----SSKIKSEIGWF  308 (358)
Q Consensus       234 ~~~~~~~~~~~~fNigs~~~~s~~e~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d-----~~K~~~~Lgw~  308 (358)
                      +.++++....+.||+++++|++..++++++++.+............ +.+.   .|+.....++     ..|+.+ .||+
T Consensus       206 ~fll~~~~lsGp~N~taP~PV~~~~F~~al~r~l~RP~~~~vP~~~-~rl~---LGe~a~~lL~gQrvlP~kl~~-aGF~  280 (297)
T COG1090         206 LFLLENEQLSGPFNLTAPNPVRNKEFAHALGRALHRPAILPVPSFA-LRLL---LGEMADLLLGGQRVLPKKLEA-AGFQ  280 (297)
T ss_pred             HHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCHHH-HHHH---HHHHHHHHHCCCHHHHHHHHH-CCCE
T ss_conf             9998475777751035898672899999999986799535693899-9998---522589886360344799987-7981


Q ss_pred             CCC-CHHHHHHHHHH
Q ss_conf             610-89999999999
Q gi|254780920|r  309 PQE-NMESGLNKTVC  322 (358)
Q Consensus       309 p~~-~l~egi~~~i~  322 (358)
                      .+| ++++++.+.+.
T Consensus       281 F~y~dl~~AL~~il~  295 (297)
T COG1090         281 FQYPDLEEALADILK  295 (297)
T ss_pred             EECCCHHHHHHHHHH
T ss_conf             665779999999972


No 38 
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase. Members of this protein family are L-aminoadipate-semialdehyde dehydrogenase (EC 1.2.1.31), product of the LYS2 gene. It is also called alpha-aminoadipate reductase. In fungi, lysine is synthesized via aminoadipate. Currently, all members of this family are fungal.
Probab=99.94  E-value=3.4e-27  Score=185.55  Aligned_cols=246  Identities=15%  Similarity=0.165  Sum_probs=170.6

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHC---CCEEEEEECCCCCC-CHHHHHHH---------HCCCCEEEEECCCCC------H
Q ss_conf             48997678827799999999868---98799994788765-85677762---------037974999763889------9
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDL---KIQVLVIDKLTYAG-NLNSLKEI---------SQSNLFSFLQVDICD------R   62 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~---~~~V~~~d~~~~~~-~~~~~~~~---------~~~~~v~~i~~Di~d------~   62 (358)
                      +||+||||||+|+||.++||++.   ..+|+++-|..... -..++++-         .-.++++.+.|||..      .
T Consensus       973 ~VlLTGATGFLG~~lL~~LL~~~~~~~~~v~cLVRa~~~~~a~~Rl~~~~~~y~lw~~~~~~Ri~v~~GDLs~p~LGLs~ 1052 (1389)
T TIGR03443       973 TVFLTGATGFLGSFILRDLLTRRSNSNFKVFAHVRAKSEEAGLERLRKTGTTYGIWDEEWASRIEVVLGDLSKEKFGLSD 1052 (1389)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCCCEEEEEEECCCCHHHHHHHHHHHHHHCCCCCHHCCCCEEEECCCCCCCCCCCCH
T ss_conf             79993876188999999998287878538999967898788999999999871886310115779981777874689699


Q ss_pred             HHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCC-
Q ss_conf             9999998622787178512343322222222222222222220247888651232211247842786305543112222-
Q gi|254780920|r   63 ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLD-  141 (358)
Q Consensus        63 ~~l~~~~~~~~~d~ViHlAa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~-  141 (358)
                      +.++.+..  .+|+|||+||.++--..+   ......||.||.++|+.|.         ..+.|.|-|.||.+|++... 
T Consensus      1053 ~~~~~La~--~vD~IiHngA~Vn~~~pY---~~Lr~aNV~gT~elLrla~---------~gr~k~~h~vST~sv~~~~~~ 1118 (1389)
T TIGR03443      1053 EKWSDLTN--EVDVIIHNGALVHWVYPY---SKLRDANVIGTINVLNLCA---------EGKAKQFSFVSSTSALDTEYY 1118 (1389)
T ss_pred             HHHHHHHH--HCCEEEECCCEECCCCCH---HHHHHCCCHHHHHHHHHHH---------CCCCCEEEEEECHHHCCCCCC
T ss_conf             99999984--169999789353467668---8875442278999999985---------699970699712100687543


Q ss_pred             -----------CCCCCCCCCCC-----CCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCC
Q ss_conf             -----------22222222222-----22222333221000000123332222222222222333222----22222222
Q gi|254780920|r  142 -----------KGLFSEDMPYN-----PSSPYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHF----PEKLIPLA  201 (358)
Q Consensus       142 -----------~~~~~E~~~~~-----p~s~Yg~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~----~~~~i~~~  201 (358)
                                 ...+.|++++.     -.+-|+-||+.+|++++..+++ |++++|.||++|-|-...    ++-++..+
T Consensus      1119 ~~~~~~~~~~g~~~~~E~d~l~~~~~~l~~GY~qSKWvaE~lv~~A~~r-Glpv~I~RpG~I~G~s~tG~~n~dDf~~r~ 1197 (1389)
T TIGR03443      1119 VNLSDELVQAGGAGIPESDDLMGSSKGLGTGYGQSKWVAEYIIREAGKR-GLRGCIVRPGYVTGDSKTGATNTDDFLLRM 1197 (1389)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHC-CCCEEEECCCCCCCCCCCCCCCHHHHHHHH
T ss_conf             4432101135777888776554542225774388899999999999966-998899777535016887887778899999


Q ss_pred             CCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCC---CCCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             22222-2222222222233221133222200000001222---22221113578642026889999886
Q gi|254780920|r  202 ITRMI-EGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG---RIGERYNIGGNNERKNIDIVFEIGFL  266 (358)
Q Consensus       202 i~~~~-~g~~~~i~g~g~~~Rdfi~v~D~a~~i~~~~~~~---~~~~~fNigs~~~~s~~e~~~~i~~~  266 (358)
                      +.-++ .|.-    .+.+..-+++-||-+++++..+.-++   ....+|++++...+++.|+...+.+.
T Consensus      1198 ikg~iqlG~~----P~~~~~~~~~PVD~va~~iv~~~~~~~~~~~~~~~h~~~~~~~~~~~~~~~~~~~ 1262 (1389)
T TIGR03443      1198 LKGCIQLGLI----PNINNTVNMVPVDHVARVVVAAALNPPKESELAVAHVTGHPRIRFNDFLGTLKTY 1262 (1389)
T ss_pred             HHHHHHCCCC----CCCCCCCCEEEHHHHHHHHHHHHCCCCCCCCCEEEEECCCCCCCHHHHHHHHHHH
T ss_conf             9999974897----8988842424276899999998728986788428983699975099999999983


No 39 
>KOG2774 consensus
Probab=99.93  E-value=2.7e-26  Score=180.03  Aligned_cols=303  Identities=17%  Similarity=0.192  Sum_probs=222.4

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCC-CEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEE
Q ss_conf             489976788277999999998689-8799994788765856777620379749997638899999999862278717851
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLK-IQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNF   80 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~-~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~ViHl   80 (358)
                      ||||||+-|++|..++..|-...| ..|+.-|...++.+..        +.=.|+-.||.|...|++++-+.++|-.||+
T Consensus        46 rvLITG~LGQLG~~~A~LLR~~yGs~~VILSDI~KPp~~V~--------~~GPyIy~DILD~K~L~eIVVn~RIdWL~Hf  117 (366)
T KOG2774          46 RVLITGSLGQLGRGLASLLRYMYGSECVILSDIVKPPANVT--------DVGPYIYLDILDQKSLEEIVVNKRIDWLVHF  117 (366)
T ss_pred             EEEEECCHHHHHHHHHHHHHHHHCCCCEEECCCCCCCHHHC--------CCCCEEEHHHHCCCCHHHHHHCCEEEEEEHH
T ss_conf             58884553677688999999984776376010358855432--------5687543245420147887534511021119


Q ss_pred             CCC-CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCC-CCCCCCCCCCCCCCCCC
Q ss_conf             234-3322222222222222222220247888651232211247842786305543112222-22222222222222223
Q gi|254780920|r   81 AAE-SHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLD-KGLFSEDMPYNPSSPYS  158 (358)
Q Consensus        81 Aa~-~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~-~~~~~E~~~~~p~s~Yg  158 (358)
                      .|. +.+++  .|-....++|+.|.-|+|+.+..+          +-++..+||...||... ..|...-...+|++.||
T Consensus       118 SALLSAvGE--~NVpLA~~VNI~GvHNil~vAa~~----------kL~iFVPSTIGAFGPtSPRNPTPdltIQRPRTIYG  185 (366)
T KOG2774         118 SALLSAVGE--TNVPLALQVNIRGVHNILQVAAKH----------KLKVFVPSTIGAFGPTSPRNPTPDLTIQRPRTIYG  185 (366)
T ss_pred             HHHHHHHCC--CCCCCEEEECCHHHHHHHHHHHHH----------CEEEEECCCCCCCCCCCCCCCCCCCEECCCCEEEC
T ss_conf             999987511--577413565104366899999870----------73686024334568999999899813226731203


Q ss_pred             CCCCCCEEEECCCCCCCCCCCCCCCCCCCCC---CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEE
Q ss_conf             3322100000012333222222222222233---322-222222222222222222222222233221133222200000
Q gi|254780920|r  159 ATKASSDYLVLAWGHTYGIPVLLSNCSNNYG---PYH-FPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALY  234 (358)
Q Consensus       159 ~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyG---p~~-~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~a~~i~  234 (358)
                      .||.-+|.+-..|.+++|+++.++|++.+..   |++ ..+..+..| ..++++++-..+-.++.+.+++|++|+..+++
T Consensus       186 VSKVHAEL~GEy~~hrFg~dfr~~rfPg~is~~~pgggttdya~A~f-~~Al~~gk~tCylrpdtrlpmmy~~dc~~~~~  264 (366)
T KOG2774         186 VSKVHAELLGEYFNHRFGVDFRSMRFPGIISATKPGGGTTDYAIAIF-YDALQKGKHTCYLRPDTRLPMMYDTDCMASVI  264 (366)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCEECCCCCCCCCCCCCCCCCCHHHHHH-HHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             35889999999988650754000247751026899998531145530-78886588665547776574001588999999


Q ss_pred             ECCCCC---CCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCEEECCCCCCCCCEECCCHHHHHHHHCCCCCC
Q ss_conf             001222---22221113578642026889999886034265556864302334889986530031718999981896610
Q gi|254780920|r  235 LVLKKG---RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSSKIKSEIGWFPQE  311 (358)
Q Consensus       235 ~~~~~~---~~~~~fNigs~~~~s~~e~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~K~~~~Lgw~p~~  311 (358)
                      ..+..+   ....+||++ +-+.+-.|++..+.+.+.. ....+....-..+...+|     ..+|-+.|+.++.|+-++
T Consensus       265 ~~~~a~~~~lkrr~ynvt-~~sftpee~~~~~~~~~p~-~~i~y~~~srq~iad~wp-----~~~dds~ar~~wh~~h~~  337 (366)
T KOG2774         265 QLLAADSQSLKRRTYNVT-GFSFTPEEIADAIRRVMPG-FEIDYDICTRQSIADSWP-----MSLDDSEARTEWHEKHSL  337 (366)
T ss_pred             HHHHCCHHHHHHHEEEEE-EECCCHHHHHHHHHHHCCC-CEEEECCCHHHHHHHHCC-----CCCCCHHHHHHHHHHHHH
T ss_conf             998688887555415000-0105889999999722899-455306415666664165-----434735665667775220


Q ss_pred             CHHHHHHHHHHHHHHHHHHHH
Q ss_conf             899999999999988678655
Q gi|254780920|r  312 NMESGLNKTVCWYLDNNWWWR  332 (358)
Q Consensus       312 ~l~egi~~~i~w~~~n~~~~~  332 (358)
                      ++-..+.-++.-.++|..-.+
T Consensus       338 ~l~~~i~~~i~~~~~n~~~~~  358 (366)
T KOG2774         338 HLLSIISTVVAVHKSNLKLLK  358 (366)
T ss_pred             HHHHHHHHHHHHHHHHHHCCC
T ss_conf             499999999999874342058


No 40 
>TIGR01746 Thioester-redct thioester reductase domain; InterPro: IPR010080   This domain includes the C-terminal domain from the fungal alpha aminoadipate reductase enzyme (also known as aminoadipate semialdehyde dehydrogenase) which is involved in the biosynthesis of lysine , as well as the reductase-containing component of the myxochelin biosynthetic gene cluster, MxcG . The mechanism of reduction involves activation of the substrate by adenylation and transfer to a covalently-linked pantetheine cofactor as a thioester. This thioester is then reduced to give an aldehyde (thus releasing the product) and a regenerated pantetheine thiol ; in myxochelin biosynthesis this aldehyde is further reduced to an alcohol or converted to an amine by an aminotransferase. This is a fundamentally different reaction than beta-ketoreductase domains of polyketide synthases which act at a carbonyl two carbons removed from the thioester and forms an alcohol as a product. The majority of bacterial sequences containing this domain are non-ribosomal peptide synthetases in which this domain is similarly located proximal to a thiolation domain (IPR006163 from INTERPRO). In some cases this domain is found at the end of a polyketide synthetase enzyme, but is unlike ketoreductase domains which are found before the thiolase domains. Exceptions to this observed relationship with the thiolase domain include three proteins which consist of stand-alone reductase domains (from Mycobacterium leprae, Anabaena and from Streptomyces coelicolor) and one protein (from Nostoc) which contains N-terminal homology with a small group of hypothetical proteins but no evidence of a thiolation domain next to the putative reductase domain.; GO: 0004043 L-aminoadipate-semialdehyde dehydrogenase activity.
Probab=99.93  E-value=3.1e-26  Score=179.67  Aligned_cols=259  Identities=16%  Similarity=0.139  Sum_probs=177.9

Q ss_pred             EEEEECCCCHHHHHHHHHHHHH---CCCEEEEEEC-CCC----------CCC--HHHHHHHHCC--CCEEEEECCCCC--
Q ss_conf             4899767882779999999986---8987999947-887----------658--5677762037--974999763889--
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVND---LKIQVLVIDK-LTY----------AGN--LNSLKEISQS--NLFSFLQVDICD--   61 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~---~~~~V~~~d~-~~~----------~~~--~~~~~~~~~~--~~v~~i~~Di~d--   61 (358)
                      +||+||||||+|.+|+++|+..   ...+|+++-| ...          +-+  ...+.+....  ++|+.+.|||..  
T Consensus         1 ~vlLTGAtGfLG~~ll~~Ll~~~~s~~~~v~CLVRva~~~~~A~~RL~~~~~Gd~~~l~~~~~~~~~Ri~~~~GDl~~p~   80 (405)
T TIGR01746         1 TVLLTGATGFLGAYLLEELLRRNDSTEAKVICLVRVAKSEEHAMERLREALRGDSYRLWQEDLASIERIEVVAGDLSKPR   80 (405)
T ss_pred             CEEEECCCHHHHHHHHHHHHHCCCCCCEEEEEEEEECCCHHHHHHHHHHHCCCCHHHHHHHHHHHHCCEEEEECCCCCCC
T ss_conf             95873362678999999997204886405687775149879999999851684223322333331136058868746666


Q ss_pred             ----HHHHHHHH-HHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCC
Q ss_conf             ----99999998-6227871785123433222222222222222222202478886512322112478427863055431
Q gi|254780920|r   62 ----RECIRSAL-KEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEV  136 (358)
Q Consensus        62 ----~~~l~~~~-~~~~~d~ViHlAa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~v  136 (358)
                          ....+.+- +..+.|.|||-||.++.-.   +-...-..||.||..+|+.|.         ....|.|+|.||..|
T Consensus        81 lGL~~~~~~~L~Gqs~~~D~i~HngA~Vn~~~---pY~~Lr~~NV~Gt~~~L~L~~---------~~~~kpl~yvSt~~v  148 (405)
T TIGR01746        81 LGLSEAEWERLAGQSENVDTIVHNGALVNWVY---PYEELRAANVLGTREVLRLAA---------SGRAKPLHYVSTISV  148 (405)
T ss_pred             CCCCHHHHHHCCCCCEECCEEEECCEEECCCC---CHHHHHHHCCHHHHHHHHHHH---------CCCCCEEEEECCHHC
T ss_conf             78871677324777300386783641422326---826652102125999999961---------589851688524000


Q ss_pred             CCCCCCCC------CCCCCC-----CCCCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCC-CCC--C-CCCCC
Q ss_conf             12222222------222222-----2222222333221000000123332---22222222222233-322--2-22222
Q gi|254780920|r  137 YGSLDKGL------FSEDMP-----YNPSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYG-PYH--F-PEKLI  198 (358)
Q Consensus       137 Yg~~~~~~------~~E~~~-----~~p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyG-p~~--~-~~~~i  198 (358)
                      +......+      +.++++     ....+.|+.||..+|.+++.....-   |++++|+||+.|.| +..  . ++-++
T Consensus       149 ~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~GY~~SKwvaE~lv~~A~~~~PadGl~v~i~RpG~i~g~s~~G~~n~~D~l  228 (405)
T TIGR01746       149 LAAIDLSGGKEEEDVTEDDATVTAPPGLAGGYAQSKWVAELLVREASDRLPADGLPVTIYRPGRILGDSETGAINTSDIL  228 (405)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCCEECCCCCCCCCCCHHH
T ss_conf             25343678876367620460012677667873034999999999988737745573579827513416336735353088


Q ss_pred             CCCCCCCC-CC--CCCCCCCCCCCCC-CCCCCCCCCCCEEECCCCC-----CCCCCCCCCCCCC--CCHHHHHHHHHHHH
Q ss_conf             22222222-22--2222222223322-1133222200000001222-----2222111357864--20268899998860
Q gi|254780920|r  199 PLAITRMI-EG--SHVFLYGDGQNVR-DWLYVEDHVRALYLVLKKG-----RIGERYNIGGNNE--RKNIDIVFEIGFLL  267 (358)
Q Consensus       199 ~~~i~~~~-~g--~~~~i~g~g~~~R-dfi~v~D~a~~i~~~~~~~-----~~~~~fNigs~~~--~s~~e~~~~i~~~~  267 (358)
                      ..++..++ .|  --+...++-+... ++++|+.+++++..+....     ..+.+||+.++++  ++..+++..+.+..
T Consensus       229 ~r~v~~~~~~G~l~~P~~~~Nrqr~~~~~~pVd~~a~ai~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~f~~~~~~~~  308 (405)
T TIGR01746       229 WRMVKGCLELGDLAYPQLDENRQRLTEDLTPVDYVARAIVALSSQPAAEAQAGGAVFHLVNPEPEPVSLDEFLEWLKRSA  308 (405)
T ss_pred             HHHHHHHHHHHCCCCCCCCCCHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHH
T ss_conf             89999987440000466611012133223109999999999998764643277217872289985657899999998861


Q ss_pred             CCCCC
Q ss_conf             34265
Q gi|254780920|r  268 DALIP  272 (358)
Q Consensus       268 ~~~~~  272 (358)
                      |..++
T Consensus       309 G~~~~  313 (405)
T TIGR01746       309 GYELK  313 (405)
T ss_pred             CCCCC
T ss_conf             88653


No 41 
>pfam05368 NmrA NmrA-like family. NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA. NmrA is part of a system controlling nitrogen metabolite repression in fungi. This family only contains a few sequences as iteration results in significant matches to other Rossmann fold families.
Probab=99.93  E-value=1.4e-25  Score=175.70  Aligned_cols=227  Identities=16%  Similarity=0.152  Sum_probs=156.8

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEECC
Q ss_conf             89976788277999999998689879999478876585677762037974999763889999999986227871785123
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNFAA   82 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~ViHlAa   82 (358)
                      ||||||||++|+++++.|++. |++|.++.|....   ...+.+ ...+++++++|+.|++.+.++++++  |.|||+++
T Consensus         1 IlV~GatG~iG~~vv~~L~~~-g~~Vr~l~R~~~~---~~~~~l-~~~gve~v~gD~~d~~sl~~al~gv--d~v~~~~~   73 (232)
T pfam05368         1 ILVFGATGYQGGSVVRASLKA-GHPVRALVRDPKS---ELAKSL-KAAGVELVEGDLDDHESLVEALKGV--DVVFSVTG   73 (232)
T ss_pred             EEEECCCHHHHHHHHHHHHHC-CCCEEEEECCCCH---HHHHHH-HHCCCEEEEECCCCHHHHHHHHCCC--CEEEEECC
T ss_conf             099896828999999999858-9938999718736---656666-4179889990688878999996799--88999158


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             43322222222222222222220247888651232211247842786305543112222222222222222222233322
Q gi|254780920|r   83 ESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSATKA  162 (358)
Q Consensus        83 ~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~s~Yg~sK~  162 (358)
                      ...            +.++..+.+++++|+         +.++++||+.|....        .++..+..|..+|..+|.
T Consensus        74 ~~~------------~~~~~~~~~~~~AA~---------~aGVk~~V~ss~~~~--------~~~~~~~~~~~~~~~~K~  124 (232)
T pfam05368        74 FWL------------SKEIEDGKKLADAAK---------EAGVKHFIPSEFGND--------VDRSNGVEPAVPHFDSKA  124 (232)
T ss_pred             CCC------------CHHHHHHHHHHHHHH---------HCCCCCEEEEEECCC--------CCCCCCCCCCCHHHHHHH
T ss_conf             874------------177999999999999---------739983455550125--------545676665527889899


Q ss_pred             CCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCEEECCCCCC
Q ss_conf             10000001233322222222222223332222222222222222222222222223322-11332222000000012222
Q gi|254780920|r  163 SSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVR-DWLYVEDHVRALYLVLKKGR  241 (358)
Q Consensus       163 ~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~R-dfi~v~D~a~~i~~~~~~~~  241 (358)
                      .+|.+++    +.+++++++||+..+|.....  .. .+...........+++++...+ .+++++|+++++..++.++.
T Consensus       125 ~~e~~l~----~~g~~~tilrp~~f~~~~~~~--~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dva~~~~~~l~~p~  197 (232)
T pfam05368       125 EVERYIR----ALGIPYTFVYAGFFMGNFLSN--LA-PPGDLAPPRDKVTLLGPGNPKAVPLDDEEDIGTYVIKILDDPR  197 (232)
T ss_pred             HHHHHHH----HHCCCEEEEECCCHHHHHHHH--HH-HHHHCCCCCCEEEEECCCCCCEEEEEEHHHHHHHHHHHHCCHH
T ss_conf             9999999----819985999684254301656--54-4320257653699944898761126528899999999964912


Q ss_pred             -CCCCCCCCCCCCCCHHHHHHHHHHHHCCCCC
Q ss_conf             -2221113578642026889999886034265
Q gi|254780920|r  242 -IGERYNIGGNNERKNIDIVFEIGFLLDALIP  272 (358)
Q Consensus       242 -~~~~fNigs~~~~s~~e~~~~i~~~~~~~~~  272 (358)
                       .++.+.+.+++.+|..|+++.+.+.+|+.++
T Consensus       198 ~~~~~~~~~~~~~lT~~Eia~~~~~~~Gr~v~  229 (232)
T pfam05368       198 KLKGKYIRPPGNILSGNEIAELWSKKIGKTVK  229 (232)
T ss_pred             HCCCEEEEECCCCCCHHHHHHHHHHHHCCCCE
T ss_conf             11999998289867999999999998899837


No 42 
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=99.92  E-value=7.4e-25  Score=171.25  Aligned_cols=250  Identities=19%  Similarity=0.155  Sum_probs=165.5

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCC-HHHHHHH---------HCCCCEEEEECCCC------CHHH
Q ss_conf             948997678827799999999868987999947887658-5677762---------03797499976388------9999
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGN-LNSLKEI---------SQSNLFSFLQVDIC------DREC   64 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~-~~~~~~~---------~~~~~v~~i~~Di~------d~~~   64 (358)
                      |+||+||||||+|++|+.+||.+...+|+++-|...... ..++...         .-.++++.+.||+.      +...
T Consensus         1 ~~vlLTGATGFLG~yLl~eLL~~~~~kv~cLVRA~s~E~a~~RL~~~~~~~~~~~e~~~~ri~vv~gDl~e~~lGL~~~~   80 (382)
T COG3320           1 RNVLLTGATGFLGAYLLLELLDRSDAKVICLVRAQSDEAALARLEKTFDLYRHWDELSADRVEVVAGDLAEPDLGLSERT   80 (382)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCCCCCCCCCCHHH
T ss_conf             91899457027699999999716887289998227779999999997655301344302537998134445568987889


Q ss_pred             HHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCC
Q ss_conf             99998622787178512343322222222222222222220247888651232211247842786305543112222222
Q gi|254780920|r   65 IRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGL  144 (358)
Q Consensus        65 l~~~~~~~~~d~ViHlAa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~  144 (358)
                      ++++-+  ++|.|||.||.++--.   .-......||.||..+|..|.         ..+.|-+.|.||.+|++......
T Consensus        81 ~~~La~--~vD~I~H~gA~Vn~v~---pYs~L~~~NVlGT~evlrLa~---------~gk~Kp~~yVSsisv~~~~~~~~  146 (382)
T COG3320          81 WQELAE--NVDLIIHNAALVNHVF---PYSELRGANVLGTAEVLRLAA---------TGKPKPLHYVSSISVGETEYYSN  146 (382)
T ss_pred             HHHHHH--HCCEEEECCHHHCCCC---CHHHHCCCCHHHHHHHHHHHH---------CCCCCEEEEEEEEEECCCCCCCC
T ss_conf             999863--2035775432443557---688734764576999999996---------17984049971001145324677


Q ss_pred             ----CCCCCC-----CCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCC
Q ss_conf             ----222222-----22222223332210000001233322222222222223332222222222222222222-22222
Q gi|254780920|r  145 ----FSEDMP-----YNPSSPYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGS-HVFLY  214 (358)
Q Consensus       145 ----~~E~~~-----~~p~s~Yg~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~-~~~i~  214 (358)
                          ++|..+     ..+.+.|+.||.++|.+++...+. |++++|+||+.+-|+......-.++|+.++..+- ..-++
T Consensus       147 ~~~~~~~~~~~~~~~~~~~~GY~~SKwvaE~Lvr~A~~r-GLpv~I~Rpg~I~gds~tG~~n~~D~~~Rlv~~~~~lg~~  225 (382)
T COG3320         147 FTVDFDEISPTRNVGQGLAGGYGRSKWVAEKLVREAGDR-GLPVTIFRPGYITGDSRTGALNTRDFLTRLVLGLLQLGIA  225 (382)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHC-CCCEEEEECCEEECCCCCCCCCCCHHHHHHHHHHHHHCCC
T ss_conf             753312245322456766788412389999999998663-8976998167241167667635434999999999985778


Q ss_pred             CCCCCCCCCCCCCCCCCCEEECCCCCC-----CC----CCCCCCC----CCCCCHHHHHHHHHH
Q ss_conf             222332211332222000000012222-----22----2111357----864202688999988
Q gi|254780920|r  215 GDGQNVRDWLYVEDHVRALYLVLKKGR-----IG----ERYNIGG----NNERKNIDIVFEIGF  265 (358)
Q Consensus       215 g~g~~~Rdfi~v~D~a~~i~~~~~~~~-----~~----~~fNigs----~~~~s~~e~~~~i~~  265 (358)
                      .+.....+.+.++.+++++.....+..     .+    ..|+.-.    |..+...++.+-+.+
T Consensus       226 P~~~~~~~~~p~~~v~~~v~~~~~~~~~~~~~l~~~~~~~f~~~~~~~~~~~i~l~~~~~w~~~  289 (382)
T COG3320         226 PDSEYSLDMLPVDHVARAVVAPSVQVAEAIAALGAHSDIRFNQLHMLTHPDEIGLDEYVDWLIS  289 (382)
T ss_pred             CCCCCCHHHCCCCEEEEEEEHHHHHHHHHHHHHCCCCCCHHHHEECCCCCCCCCHHHHHHHHHH
T ss_conf             9865554337652035775202454788899732686311321003468875454578776764


No 43 
>KOG1221 consensus
Probab=99.82  E-value=1.6e-19  Score=138.63  Aligned_cols=252  Identities=17%  Similarity=0.180  Sum_probs=162.7

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHC-C-CEEEEEECCCCCCC-HHHHHHHH--------------CCCCEEEEECCCCCH--
Q ss_conf             48997678827799999999868-9-87999947887658-56777620--------------379749997638899--
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDL-K-IQVLVIDKLTYAGN-LNSLKEIS--------------QSNLFSFLQVDICDR--   62 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~-~-~~V~~~d~~~~~~~-~~~~~~~~--------------~~~~v~~i~~Di~d~--   62 (358)
                      .|||||||||+|.-|+..||-.. + ..++.+-|.+.... ..++..+.              .-.++.-+.||++++  
T Consensus        14 ~i~vTG~tGFlgKVliEklLr~~p~v~~IYlLiR~k~g~~~~~Rl~~~~~~~lF~~l~~~~p~~l~Kv~pi~GDi~~~~L   93 (467)
T KOG1221          14 TIFVTGATGFLGKVLIEKLLRTTPDVKRIYLLIRAKKGKAAQERLRTELKDPLFEVLKEKKPEALEKVVPIAGDISEPDL   93 (467)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHCCCCEECCEECCCCCCCCCC
T ss_conf             59997276345789999998507676569999834789877899999874469999986395210200001256668666


Q ss_pred             ----HHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCC
Q ss_conf             ----9999998622787178512343322222222222222222220247888651232211247842786305543112
Q gi|254780920|r   63 ----ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYG  138 (358)
Q Consensus        63 ----~~l~~~~~~~~~d~ViHlAa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg  138 (358)
                          .+++.+.+  ++|+|||+||.+.-++..   ......|+.||.++++.|+..        ...+.|++.||.-+..
T Consensus        94 Gis~~D~~~l~~--eV~ivih~AAtvrFde~l---~~al~iNt~Gt~~~l~lak~~--------~~l~~~vhVSTAy~n~  160 (467)
T KOG1221          94 GISESDLRTLAD--EVNIVIHSAATVRFDEPL---DVALGINTRGTRNVLQLAKEM--------VKLKALVHVSTAYSNC  160 (467)
T ss_pred             CCCHHHHHHHHH--CCCEEEEEEEEECCCHHH---HHHHHHHHHHHHHHHHHHHHH--------HHHHEEEEEEHHHEEC
T ss_conf             888277888874--577899953042255366---565422227489999999985--------2112689842122224


Q ss_pred             ---CCCCCCC--------------CCCC----------CC--CCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             ---2222222--------------2222----------22--22222233322100000012333222222222222233
Q gi|254780920|r  139 ---SLDKGLF--------------SEDM----------PY--NPSSPYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYG  189 (358)
Q Consensus       139 ---~~~~~~~--------------~E~~----------~~--~p~s~Yg~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyG  189 (358)
                         ...+.++              +|+.          +.  ...+.|..+|..+|+++..++  .+++.+|+||+.|..
T Consensus       161 ~~~~i~E~~y~~~~~~~~~~~i~~~~~~~~~~ld~~~~~l~~~~PNTYtfTKal~E~~i~~~~--~~lPivIiRPsiI~s  238 (467)
T KOG1221         161 NVGHIEEKPYPMPETCNPEKILKLDENLSDELLDQKAPKLLGGWPNTYTFTKALAEMVIQKEA--ENLPLVIIRPSIITS  238 (467)
T ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCEEEHHHHHHHHHHHHC--CCCCEEEECCCCEEC
T ss_conf             666521025676455898888764322218999876477508999863011865899998526--489869974874101


Q ss_pred             CCCCC-----CC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECC-CCC-CC----CCCCCCCCC--CCC
Q ss_conf             32222-----22--22222222222222222222233221133222200000001-222-22----221113578--642
Q gi|254780920|r  190 PYHFP-----EK--LIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVL-KKG-RI----GERYNIGGN--NER  254 (358)
Q Consensus       190 p~~~~-----~~--~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~a~~i~~~~-~~~-~~----~~~fNigs~--~~~  254 (358)
                      ...-+     ++  -...++-.+-+|.=-.+..+++..-|++-||.+|.+++.+. +.. ..    -.+||++++  +++
T Consensus       239 t~~EP~pGWidn~~gp~g~i~g~gkGvlr~~~~d~~~vadiIPvD~vvN~~ia~~~~~~~~~~~~~~~IY~~tss~~Np~  318 (467)
T KOG1221         239 TYKEPFPGWIDNLNGPDGVIIGYGKGVLRCFLVDPKAVADIIPVDMVVNAMIASAWQHAGNSKEKTPPIYHLTSSNDNPV  318 (467)
T ss_pred             CCCCCCCCCCCCCCCCCEEEEEECCCEEEEEEECCCCCCCEEEHHHHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCCCC
T ss_conf             33379987032687875478985022599998765546655128999999999999985048889986798535565761


Q ss_pred             CHHHHHHHHHHHHC
Q ss_conf             02688999988603
Q gi|254780920|r  255 KNIDIVFEIGFLLD  268 (358)
Q Consensus       255 s~~e~~~~i~~~~~  268 (358)
                      +..++++...+...
T Consensus       319 t~~~~~e~~~~~~~  332 (467)
T KOG1221         319 TWGDFIELALRYFE  332 (467)
T ss_pred             CHHHHHHHHHHHCC
T ss_conf             08999999997431


No 44 
>PRK05865 hypothetical protein; Provisional
Probab=99.78  E-value=1.3e-18  Score=133.01  Aligned_cols=251  Identities=19%  Similarity=0.231  Sum_probs=167.9

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEE
Q ss_conf             94899767882779999999986898799994788765856777620379749997638899999999862278717851
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNF   80 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~ViHl   80 (358)
                      |+|+|||++|-+|+-++.+|+.. ||+|.++-+..         +-.-+.+++|+-.||+|+..++.+..+  .|+|+||
T Consensus         1 M~i~VT~A~G~lGR~va~qLia~-GH~V~GIAr~r---------~~~~~~~~DFV~A~iRd~~~~~~a~~~--AD~V~H~   68 (854)
T PRK05865          1 MRIAVTGASGVLGRGLTARLLSQ-GHEVVGIARHR---------PDSWPSSADFIAADIRDATAVESAMTG--ADVVAHC   68 (854)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHC-CCEEEEEECCC---------CCCCCCCCCEEECCCCCHHHHHHHHCC--CCEEEEE
T ss_conf             93788336215777899999866-87245540579---------865675566663233478999875246--6548983


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             23433222222222222222222202478886512322112478427863055431122222222222222222222333
Q gi|254780920|r   81 AAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSAT  160 (358)
Q Consensus        81 Aa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~s~Yg~s  160 (358)
                      |+.-.       +  .-..|+.|+.|+++++-         +.+..+++|.||..                +|       
T Consensus        69 A~~~~-------~--~~~~~idG~a~V~~A~a---------~aG~r~i~~sqsa~----------------~~-------  107 (854)
T PRK05865         69 AWVRG-------R--NDHINIDGTANVLKAMA---------ETGTGRIVFTSSGH----------------QP-------  107 (854)
T ss_pred             CCCCC-------C--CCCCCCHHHHHHHHHHH---------HHCCCEEEEECCCC----------------CH-------
T ss_conf             12158-------8--76446276889999998---------61883699815888----------------56-------


Q ss_pred             CCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCEEECCC
Q ss_conf             221000000123332222222222222333222222222222222222222222222--332211332222000000012
Q gi|254780920|r  161 KASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDG--QNVRDWLYVEDHVRALYLVLK  238 (358)
Q Consensus       161 K~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g--~~~Rdfi~v~D~a~~i~~~~~  238 (358)
                        ..|+++..    .+.+.+.+|...+.|- +-+.     |+.+...   +.++.++  .+....+|.||+.+.+..++.
T Consensus       108 --~~e~~la~----sg~~~v~iR~A~~vGR-~lD~-----~V~R~~A---l~~~~~~~s~~pmrVlHlDD~~R~Lv~Al~  172 (854)
T PRK05865        108 --RVEQMLAD----CGLEWVAVRCALIFGR-NVDN-----WVQRLFA---LPVLPAGYADRVVQVVHSDDAQRLLVRALL  172 (854)
T ss_pred             --HHHHHHHH----CCCCEEEEEECCCCCC-CHHH-----HHHHHHH---HHHCCCCCCCCCEEEEEHHHHHHHHHHHHH
T ss_conf             --69999985----3897169996155453-1578-----9998876---641346556663378757789999999973


Q ss_pred             CCC-CCCCCCCCCCCCCCHHHHHHHHHHHHCCCCC---CCCCCCCCEEECCCCCCCCCEECCCHHHHHHHHCCCCCCCHH
Q ss_conf             222-2221113578642026889999886034265---556864302334889986530031718999981896610899
Q gi|254780920|r  239 KGR-IGERYNIGGNNERKNIDIVFEIGFLLDALIP---KSYSHTELIRFIEDRPGHDRRYAIDSSKIKSEIGWFPQENME  314 (358)
Q Consensus       239 ~~~-~~~~fNigs~~~~s~~e~~~~i~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~d~~K~~~~Lgw~p~~~l~  314 (358)
                      .+. .+++.|+.+....++...+..+..-......   ..............      --.+|+..++++++|+|-..-+
T Consensus       173 t~~~~sGvVdLAap~~~~~~~~a~~L~r~~~~~~~~~~~Rv~s~aqL~~~~~------~P~mD~a~~qedW~F~~~W~a~  246 (854)
T PRK05865        173 DTVIDSGPVNLAAPGELTFRRIAAALGRPMVPIGSPVLRRVTSFAELELLHS------APLMDVTLLRDRWGFQPAWNAE  246 (854)
T ss_pred             CCCCCCCCEEECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHCC------CCCHHHHHHHHHHCCCCCCCHH
T ss_conf             2666676233248997619999999658876446665322368898634128------8602278776764888342157


Q ss_pred             HHHHHHHHHHH
Q ss_conf             99999999998
Q gi|254780920|r  315 SGLNKTVCWYL  325 (358)
Q Consensus       315 egi~~~i~w~~  325 (358)
                      |.|.+|---.+
T Consensus       247 eav~D~~~~lr  257 (854)
T PRK05865        247 ECLEDFTLAVR  257 (854)
T ss_pred             HHHHHHHHHHC
T ss_conf             88887645440


No 45 
>PRK12320 hypothetical protein; Provisional
Probab=99.73  E-value=2.2e-17  Score=125.51  Aligned_cols=246  Identities=17%  Similarity=0.198  Sum_probs=158.6

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEE
Q ss_conf             94899767882779999999986898799994788765856777620379749997638899999999862278717851
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNF   80 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~ViHl   80 (358)
                      |+|+|||++|-+|+-|+.+|+.. ||+|+++-+..+         -.-+.+++|+-.||+|.. +..+..  ..|+|+||
T Consensus         1 M~i~VT~A~G~lGR~la~rLla~-GH~V~Giar~r~---------~s~~~~~dFV~A~iRd~v-~~el~~--~AD~V~Hl   67 (699)
T PRK12320          1 MQILVTDATGAVGRSVTRQLIAA-GHTVSGIAQHPH---------DALDPRVDYVCASLRNPV-LQELAG--EADAVIHL   67 (699)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHC-CCEEEEEECCCC---------CCCCCCCCEEECHHHHHH-HHHHCC--CCCEEEEE
T ss_conf             94788346215677899999866-872454404798---------666754555421123099-997404--55548882


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             23433222222222222222222202478886512322112478427863055431122222222222222222222333
Q gi|254780920|r   81 AAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSAT  160 (358)
Q Consensus        81 Aa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~s~Yg~s  160 (358)
                      |+.-..     .|.   ..|+.|+.|+++++-         +.+. +++|.||.+  |.+ .             .|   
T Consensus        68 A~~~~~-----~p~---~~~idG~a~V~~A~a---------~~G~-R~vfvs~Aa--g~p-~-------------ly---  110 (699)
T PRK12320         68 APVDTS-----APG---GVGITGLAHVANAAA---------RAGA-RLLFVSQAA--GRP-E-------------LY---  110 (699)
T ss_pred             CCCCCC-----CCC---CCCCHHHHHHHHHHH---------HHCC-CEEEEECCC--CCH-H-------------HC---
T ss_conf             255689-----998---546366889999998---------6188-179860578--980-3-------------31---


Q ss_pred             CCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCEEECCCC
Q ss_conf             2210000001233322222222222223332222222222222222222222222223-322113322220000000122
Q gi|254780920|r  161 KASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQ-NVRDWLYVEDHVRALYLVLKK  239 (358)
Q Consensus       161 K~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~-~~Rdfi~v~D~a~~i~~~~~~  239 (358)
                       ..+|+++..    -+.+.+.+|...+.|-. - +    .|+.+...   ..++.++. +....+|.||+.+.+..++..
T Consensus       111 -r~~E~lva~----~~~~~v~iR~A~~vGR~-l-D----~~V~R~~A---~~~~~~~Sa~pmqVvHlDD~~R~Lv~Al~~  176 (699)
T PRK12320        111 -RQAETLVST----GWAPSLVIRIAPPVGRQ-L-D----WMVCRTVA---TLLRSKVSARPIRVLHLDDLVRFLVLALNT  176 (699)
T ss_pred             -CHHHHHHHC----CCCCEEEEEECCCCCCC-H-H----HHHHHHHH---HCCCCCCCCCCEEEEEHHHHHHHHHHHHHC
T ss_conf             -579999862----48860699961554531-6-7----89998753---232677776722787577799999999824


Q ss_pred             CCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCEEECCCCCC--CCCEECCCHHHHHHHHCCCCCCCHHHHH
Q ss_conf             22222111357864202688999988603426555686430233488998--6530031718999981896610899999
Q gi|254780920|r  240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPG--HDRRYAIDSSKIKSEIGWFPQENMESGL  317 (358)
Q Consensus       240 ~~~~~~fNigs~~~~s~~e~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~d~~K~~~~Lgw~p~~~l~egi  317 (358)
                      +..| +.|+.+.+.+.+..    ...+.....+..         ...|..  ...--.+|+..+++++||+|-..-+|.|
T Consensus       177 ~~sG-vVnLAap~~~~~~~----a~~llr~~~P~~---------r~~Rv~s~a~l~P~mD~a~~qe~W~F~~~W~a~eav  242 (699)
T PRK12320        177 DRNG-VVDLATPDTTNVVT----AWRLLRSVDPHL---------RTRRVRSWEQLIPEVDIAAVQEDWNFEFGWQATEAI  242 (699)
T ss_pred             CCCC-CEEECCCCCCHHHH----HHHHHCCCCCCC---------CCCCCCCHHHHCCHHHHHHHHHHHCCCCCCCHHHHH
T ss_conf             6777-43314898515999----999717778433---------444577577736245588777864888342247788


Q ss_pred             HHHHHHH
Q ss_conf             9999999
Q gi|254780920|r  318 NKTVCWY  324 (358)
Q Consensus       318 ~~~i~w~  324 (358)
                      .+|---.
T Consensus       243 ~D~~~~~  249 (699)
T PRK12320        243 VDTGRGL  249 (699)
T ss_pred             HHHHHHH
T ss_conf             7641343


No 46 
>KOG2865 consensus
Probab=99.70  E-value=5.4e-17  Score=123.17  Aligned_cols=304  Identities=16%  Similarity=0.172  Sum_probs=195.4

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEECC
Q ss_conf             89976788277999999998689879999478876585677762037974999763889999999986227871785123
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNFAA   82 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~ViHlAa   82 (358)
                      .-|.|||||+|.++|.+|. +.|-+|+.=-|-.. .....++-.-+--.+-|..-|++|.++++++++..  .+||+|-+
T Consensus        64 aTVFGAtGFlGryvvnkla-k~GSQviiPyR~d~-~~~r~lkvmGdLGQvl~~~fd~~DedSIr~vvk~s--NVVINLIG  139 (391)
T KOG2865          64 ATVFGATGFLGRYVVNKLA-KMGSQVIIPYRGDE-YDPRHLKVMGDLGQVLFMKFDLRDEDSIRAVVKHS--NVVINLIG  139 (391)
T ss_pred             EEEECCCCCCCHHHHHHHH-HCCCEEEEECCCCC-CCHHHEEECCCCCCEEEECCCCCCHHHHHHHHHHC--CEEEEEEC
T ss_conf             9985264412089999886-35876998535886-44545000254333456416777879999998747--57998403


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             43322222222222222222220247888651232211247842786305543112222222222222222222233322
Q gi|254780920|r   83 ESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSATKA  162 (358)
Q Consensus        83 ~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~s~Yg~sK~  162 (358)
                      .    +.......+.++|+.|...+...|+         +.++-|||+.|+--   ..          ....|-|=.+|.
T Consensus       140 r----d~eTknf~f~Dvn~~~aerlArick---------e~GVerfIhvS~Lg---an----------v~s~Sr~LrsK~  193 (391)
T KOG2865         140 R----DYETKNFSFEDVNVHIAERLARICK---------EAGVERFIHVSCLG---AN----------VKSPSRMLRSKA  193 (391)
T ss_pred             C----CCCCCCCCCCCCCCHHHHHHHHHHH---------HHCHHHEEEHHHCC---CC----------CCCHHHHHHHHH
T ss_conf             5----3445886612001458999999998---------62835254165456---65----------457678877653


Q ss_pred             CCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCEEECCCCC-
Q ss_conf             10000001233322222222222223332222222222222222222222222223-3221133222200000001222-
Q gi|254780920|r  163 SSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQ-NVRDWLYVEDHVRALYLVLKKG-  240 (358)
Q Consensus       163 ~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~-~~Rdfi~v~D~a~~i~~~~~~~-  240 (358)
                      ++|..++...    -..+|+||+.+||.-|.   ++..+.+...+=+.+.+++.|+ ....-+||-|+|.+|..+++.+ 
T Consensus       194 ~gE~aVrdaf----PeAtIirPa~iyG~eDr---fln~ya~~~rk~~~~pL~~~GekT~K~PVyV~DVaa~IvnAvkDp~  266 (391)
T KOG2865         194 AGEEAVRDAF----PEATIIRPADIYGTEDR---FLNYYASFWRKFGFLPLIGKGEKTVKQPVYVVDVAAAIVNAVKDPD  266 (391)
T ss_pred             HHHHHHHHHC----CCCEEECHHHHCCCCHH---HHHHHHHHHHHCCCEEEECCCCCEEECCEEEEHHHHHHHHHCCCCC
T ss_conf             2379998638----74435242551155136---7789999987337345104775146345787518899998603942


Q ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCC-CCCC---------CCC--CEEECCCCCC--------CCCEECCCHHH
Q ss_conf             22221113578642026889999886034265-5568---------643--0233488998--------65300317189
Q gi|254780920|r  241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIP-KSYS---------HTE--LIRFIEDRPG--------HDRRYAIDSSK  300 (358)
Q Consensus       241 ~~~~~fNigs~~~~s~~e~~~~i~~~~~~~~~-~~~~---------~~~--~~~~~~~~~~--------~~~~~~~d~~K  300 (358)
                      ..|.+|-.+++..+.+-|+++.+-..+-.... ..+.         ...  ..+|.+.-|.        .+....++...
T Consensus       267 s~Gktye~vGP~~yql~eLvd~my~~~~~~~ry~r~~mP~f~a~a~~~~f~~~pf~~~~pln~d~ie~~~v~~~vlt~~~  346 (391)
T KOG2865         267 SMGKTYEFVGPDRYQLSELVDIMYDMAREWPRYVRLPMPIFKAMAAARDFMIVPFPPPSPLNRDQIERLTVTDLVLTGAP  346 (391)
T ss_pred             CCCCEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHEEECCCCCCCCCCHHHHHHEEEHHHHCCCCC
T ss_conf             25845661387221099999999999754102325784789998766640506778998879899644100223237987


Q ss_pred             HHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCH
Q ss_conf             99981896610899999999999988678655323113556723
Q gi|254780920|r  301 IKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKELKPDNDY  344 (358)
Q Consensus       301 ~~~~Lgw~p~~~l~egi~~~i~w~~~n~~~~~~~~~~~~~~~~~  344 (358)
                      .-++||-.+ +.+|..--+..--|+.-+.|+..-..|++|-+.+
T Consensus       347 tleDLgv~~-t~le~~~~e~l~~yR~~~~~f~ae~~e~~P~k~~  389 (391)
T KOG2865         347 TLEDLGVVL-TKLELYPVEFLRQYRKGGRYFGAEVGEKIPTKFY  389 (391)
T ss_pred             CHHHCCCEE-EECCCCCHHHHHHHHHCCCCHHHHHCCCCCCCCC
T ss_conf             475627042-2200363899888751164212241445887789


No 47 
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated
Probab=99.68  E-value=3.3e-17  Score=124.47  Aligned_cols=220  Identities=21%  Similarity=0.166  Sum_probs=148.5

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHH-HH-HCCCCEEEEECCCCCHHHHHHHHHHC-----CC
Q ss_conf             4899767882779999999986898799994788765856777-62-03797499976388999999998622-----78
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLK-EI-SQSNLFSFLQVDICDRECIRSALKEF-----QP   74 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~-~~-~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~   74 (358)
                      .||||||+|-||+.+++.|+++ |++|+.+++...  ...... .+ ....++.++++|++|++.++++++..     .+
T Consensus         7 v~lITGgs~GIG~a~a~~la~~-G~~V~~~~r~~~--~l~~~~~~~~~~~~~~~~~~~Dl~~~~~~~~~~~~~~~~~g~i   83 (246)
T PRK05653          7 TALVTGASRGIGRAIALRLAAD-GARVVIYDSNEE--AAEALAEELRAAGGEAALLVFDVTDEAAVRALIEAAVERFGGL   83 (246)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHH--HHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCC
T ss_conf             8999389758999999999987-999999979999--9999999999659948999972899999999999999974998


Q ss_pred             CEEEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             71785123433222----22222222222222220247888651232211247842786305543112222222222222
Q gi|254780920|r   75 DAIVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMP  150 (358)
Q Consensus        75 d~ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~  150 (358)
                      |+++|.|+......    +.++....+++|+.|+.++..++....     .+.+.-++|++||...+-           +
T Consensus        84 DilvnnAg~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m-----~~~~~G~II~isS~~~~~-----------~  147 (246)
T PRK05653         84 DVLVNNAGITRDALLPRMSEEDWDRVIDTNLTGTFNVCRAALPPM-----RKARYGRIVNISSVSGVA-----------G  147 (246)
T ss_pred             CEEEECCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEECCHHHCC-----------C
T ss_conf             699989999999880139999999999986088999999999999-----984699789983655467-----------8


Q ss_pred             CCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222233322100000012333---22222222222223332222222222222222222222222223322113322
Q gi|254780920|r  151 YNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVE  227 (358)
Q Consensus       151 ~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~  227 (358)
                      ......|+.||.+.+.+++..+++   +++++.++.|+.+--|..  ....+.+..++.+.-|+         +-+...+
T Consensus       148 ~~~~~~Y~asKaal~~lt~~la~e~~~~~IrvN~I~PG~i~T~~~--~~~~~~~~~~~~~~~Pl---------~R~~~p~  216 (246)
T PRK05653        148 NPGQTNYAAAKAGVIGLTKALALELASRGITVNAVAPGFIDTDMT--RALPEEVKEALLKQIPL---------GRLGTPE  216 (246)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCC--CCCCHHHHHHHHHCCCC---------CCCCCHH
T ss_conf             999666899999999999999999504393999996388877231--11689999999847998---------9983999


Q ss_pred             CCCCCEEECCCCC---CCCCCCCCCCC
Q ss_conf             2200000001222---22221113578
Q gi|254780920|r  228 DHVRALYLVLKKG---RIGERYNIGGN  251 (358)
Q Consensus       228 D~a~~i~~~~~~~---~~~~~fNigs~  251 (358)
                      |+|+++..++...   ..|.++.+.+|
T Consensus       217 dia~~v~fL~S~~s~~itG~~i~vDGG  243 (246)
T PRK05653        217 EVANAVAFLASDAASYITGQVIPVNGG  243 (246)
T ss_pred             HHHHHHHHHHCCHHCCCCCCEEEECCC
T ss_conf             999999999687112835874887989


No 48 
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family. This family consists of fungal proteins of unknown function associated with secondary metabolite biosynthesis, such as of the ergot alkaloids such as ergovaline. Nomenclature differs because gene order differs - this is EasG in Neotyphodium lolii but is designated ergot alkaloid biosynthetic protein A in several other fungi.
Probab=99.67  E-value=1.6e-16  Score=120.23  Aligned_cols=212  Identities=16%  Similarity=0.183  Sum_probs=134.4

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             48997678827799999999868987999947887658567776203797499976388999999998622-----7871
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEF-----QPDA   76 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d~   76 (358)
                      .||||||||.||++++++|++ .|+.|.++.|..     ..    ......+-+++|+.|++.+..++...     ..|.
T Consensus         1 TIlVtGATG~iG~~v~~~L~~-~g~~v~~~~R~~-----~~----~~~~~~~~v~~d~~d~~~~~~a~~~~d~~~~~v~~   70 (285)
T TIGR03649         1 TILLTGGTGKTASRIARLLQA-ASVPFLVASRSS-----SS----SAGPNEKHVKFDWLDEDTWDNPFSSDDGMEPEISA   70 (285)
T ss_pred             CEEEECCCCHHHHHHHHHHHH-CCCCEEEEECCH-----HH----CCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEE
T ss_conf             989998998189999999986-899789995885-----66----46666753686444811488897635323127418


Q ss_pred             EEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             78512343322222222222222222220247888651232211247842786305543112222222222222222222
Q gi|254780920|r   77 IVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSP  156 (358)
Q Consensus        77 ViHlAa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~s~  156 (358)
                      +|-+... .+     +.       ...-.+++++++         ..++++||+.|...+-   ..         .|   
T Consensus        71 v~l~~p~-~~-----~~-------~~~~~~~i~aA~---------~aGV~~iV~lS~~~~~---~~---------~~---  113 (285)
T TIGR03649        71 VYLVAPP-IP-----DL-------APPMIKFIDFAR---------SKGVRRFVLLSASIIE---KG---------GP---  113 (285)
T ss_pred             EEECCCC-CC-----CH-------HHHHHHHHHHHH---------HCCCCEEEEEECCCCC---CC---------CC---
T ss_conf             9983899-87-----76-------789999999999---------8499889998303566---79---------86---


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEE
Q ss_conf             233322100000012333222222222222233322222222222-2222222222222222332211332222000000
Q gi|254780920|r  157 YSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLA-ITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYL  235 (358)
Q Consensus       157 Yg~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~~~~~i~~~-i~~~~~g~~~~i~g~g~~~Rdfi~v~D~a~~i~~  235 (358)
                       ...+.. |.+    ....|++++++||+...      +++...+ ...+...+.+.. ..|+.+..|++.+|++++...
T Consensus       114 -~~~~~~-~~~----~~~sg~~~tiLRp~~fm------~N~~~~~~~~~i~~~g~~~~-~~gd~~~~~V~~~DiA~vaa~  180 (285)
T TIGR03649       114 -AMGQVH-AHL----DSLGGVEYTVLRPTWFM------ENFSEEFHVEAIRKENKIYS-ATGDGKIPFVSADDIARVAYR  180 (285)
T ss_pred             -CCHHHH-HHH----HHHCCCCEEEEECHHHH------HHHHHHHHHHHHHHCCEEEC-CCCCCCCCCCCHHHHHHHHHH
T ss_conf             -103899-999----97369976999663998------75056665899974897844-478877573558789999999


Q ss_pred             CCCCC-CCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCC
Q ss_conf             01222-222211135786420268899998860342655
Q gi|254780920|r  236 VLKKG-RIGERYNIGGNNERKNIDIVFEIGFLLDALIPK  273 (358)
Q Consensus       236 ~~~~~-~~~~~fNigs~~~~s~~e~~~~i~~~~~~~~~~  273 (358)
                      ++..+ ..+..|.+++++..|..|+++.+.+++|+.+..
T Consensus       181 ~L~~~~~~~~~~~ltGpe~lt~~eiA~~ls~vlGr~V~y  219 (285)
T TIGR03649       181 ALTDKVAPNTDYVVLGPELLTYDDVAEILSRVLGRKITH  219 (285)
T ss_pred             HHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEE
T ss_conf             974977689779986886579999999999987992278


No 49 
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=99.67  E-value=8.7e-17  Score=121.92  Aligned_cols=221  Identities=20%  Similarity=0.118  Sum_probs=148.7

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHH-H-HCCCCEEEEECCCCCHHHHHHHHHHC-----CCC
Q ss_conf             8997678827799999999868987999947887658567776-2-03797499976388999999998622-----787
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKE-I-SQSNLFSFLQVDICDRECIRSALKEF-----QPD   75 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~-~-~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d   75 (358)
                      +|||||++=||+.++++|+++ |++|+..++..... .....+ . ....++.++++|+++.+.++++++..     .+|
T Consensus        10 ~lITGas~GIG~aia~~la~~-G~~V~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~Dl~~~~~~~~~~~~~~~~~g~iD   87 (250)
T PRK12825         10 ALVTGAARGIGRAIALRLAAA-GADVIVHPPSDEAA-AEETVAAVEALGRRAQAVQADVTDAAALEAAVEELVERFGAID   87 (250)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCCHHH-HHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCC
T ss_conf             999389558999999999987-99899997988789-9999999985399489999418999999999999999769998


Q ss_pred             EEEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             1785123433222----222222222222222202478886512322112478427863055431122222222222222
Q gi|254780920|r   76 AIVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPY  151 (358)
Q Consensus        76 ~ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~  151 (358)
                      ++||.|+......    ..++-...+++|+.|+..+..++....     .+.+.-++|++||...+-.           .
T Consensus        88 ilInnAg~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m-----~~~~~G~II~isS~~~~~~-----------~  151 (250)
T PRK12825         88 ILVNNAGITGDGRLWEMSDDEWERVIDVNLTGVFNVLRAVVPPM-----IEAGGGRIVNISSVAGLKG-----------N  151 (250)
T ss_pred             EEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHCCCCEEEEEECHHHCCC-----------C
T ss_conf             99989988999890239999999999985189999999989999-----9749973999914555578-----------9


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222233322100000012333---222222222222233322222222222222222222222222233221133222
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVED  228 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D  228 (358)
                      ....+|+.||.+.+.+++..+.+   +|+++-++.|+.+-.|...  ...+.....+...-|         .+-+...+|
T Consensus       152 ~~~~~Y~~sK~Al~~l~~~la~e~~~~gIrvN~I~PG~v~T~~~~--~~~~~~~~~~~~~~p---------~~R~~~ped  220 (250)
T PRK12825        152 PGQVNYAAAKAGLVGLTKALARELAERGIRVNAVAPGAIDTEMIE--ATIEEAREAILKLIP---------LGRLGTPEE  220 (250)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCCC--CCCHHHHHHHHHCCC---------CCCCCCHHH
T ss_conf             996778999999999999999986042929999972888770321--258889999982699---------899839999


Q ss_pred             CCCCEEECCCC---CCCCCCCCCCCCC
Q ss_conf             20000000122---2222211135786
Q gi|254780920|r  229 HVRALYLVLKK---GRIGERYNIGGNN  252 (358)
Q Consensus       229 ~a~~i~~~~~~---~~~~~~fNigs~~  252 (358)
                      +|+++..++..   ...|+++.+.+|=
T Consensus       221 va~~v~fL~s~~s~~itG~~i~vDGGl  247 (250)
T PRK12825        221 IADAVAFLASDAAGYITGQVIAVDGGM  247 (250)
T ss_pred             HHHHHHHHHCCHHCCCCCCEEEECCCC
T ss_conf             999999996862228248868989681


No 50 
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed
Probab=99.61  E-value=4.6e-16  Score=117.47  Aligned_cols=226  Identities=19%  Similarity=0.116  Sum_probs=147.0

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             89976788277999999998689879999478876585677762-03797499976388999999998622-----7871
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEI-SQSNLFSFLQVDICDRECIRSALKEF-----QPDA   76 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~-~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d~   76 (358)
                      +|||||++=||..++++|+++ |++|+..|+..... ....+.+ ....++.++.+|++|.+.++++++..     .+|+
T Consensus         9 alITGgs~GIG~aia~~la~~-G~~V~~~~r~~~~~-~~~~~~l~~~g~~~~~~~~Dl~~~~~~~~~~~~~~~~~g~iD~   86 (253)
T PRK12826          9 ALVTGAARGIGRAIAVRFAAD-GADVIVVDICGQAA-AATAELVAAAGGKARAYQVDVRDRAALKALVAAGVERFGRLDI   86 (253)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHHH-HHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             999489778999999999987-99899998988999-9999999850995899995179999999999999998399878


Q ss_pred             EEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             785123433222----2222222222222222024788865123221124784278630554311222222222222222
Q gi|254780920|r   77 IVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYN  152 (358)
Q Consensus        77 ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~  152 (358)
                      ++|.|+......    +.++-...+++|+.|..++...+...     ..+.+.-++|++||..-  .  ..      +..
T Consensus        87 lvnnAg~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~-----m~~~~~G~II~isS~~g--~--~~------~~~  151 (253)
T PRK12826         87 LVANAGIFPLTPFAELDDEDWDRVIDVNLTGTFLLTQAALPA-----LKRAGGGRIVLTSSVAG--P--RV------GYP  151 (253)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEEEECHHH--H--CC------CCC
T ss_conf             998998899998155999999999998756664337874699-----99769976999952564--1--56------899


Q ss_pred             CCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222233322100000012333---2222222222222333222222-22222222222222222222233221133222
Q gi|254780920|r  153 PSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEK-LIPLAITRMIEGSHVFLYGDGQNVRDWLYVED  228 (358)
Q Consensus       153 p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~-~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D  228 (358)
                      ....|+.||.+.+.+.+.++.+   +|+++-.+.|+.+-.|...... -.........+.-|+         .-+...+|
T Consensus       152 ~~~~Y~asKaal~~ltk~lA~e~~~~gIrvN~I~PG~i~T~~~~~~~~~~~~~~~~~~~~~pl---------~R~~~p~e  222 (253)
T PRK12826        152 GLAHYAASKAGVVGFTRALALELARRNITVNSVHPGMVDTPMAGNVFLGDASVAEAAAAAIPL---------GRLGEPED  222 (253)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCHHHHCCCCCCHHHHHHHHHCCCC---------CCCCCHHH
T ss_conf             738899999999999999999853209599999628796721214466878999999837999---------99859999


Q ss_pred             CCCCEEECCCC---CCCCCCCCCCCCCCC
Q ss_conf             20000000122---222221113578642
Q gi|254780920|r  229 HVRALYLVLKK---GRIGERYNIGGNNER  254 (358)
Q Consensus       229 ~a~~i~~~~~~---~~~~~~fNigs~~~~  254 (358)
                      +|+++..++..   ...|.++.+.+|-..
T Consensus       223 iA~~v~fL~S~~s~~itG~~i~vDGG~tl  251 (253)
T PRK12826        223 IAAAVLFLASDAARYITGQTLPVDGGATL  251 (253)
T ss_pred             HHHHHHHHHCCHHCCCCCCEEEECCCCCC
T ss_conf             99999999686322956873887899608


No 51 
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated
Probab=99.61  E-value=8.5e-16  Score=115.86  Aligned_cols=219  Identities=21%  Similarity=0.167  Sum_probs=144.3

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHH--HCCCCEEEEECCCCCHHHHHHHHHHC-----CCC
Q ss_conf             89976788277999999998689879999478876585677762--03797499976388999999998622-----787
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEI--SQSNLFSFLQVDICDRECIRSALKEF-----QPD   75 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~--~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d   75 (358)
                      +|||||++-||+.++++|+++ |++|+..++...... ....+.  ....++.++++|+++.+.++++++..     ++|
T Consensus         8 ~lITGgs~GIG~aia~~la~~-G~~Vii~~~~~~~~~-~~~~~~~~~~~~~~~~~~~Dlt~~~~v~~~~~~~~~~~g~iD   85 (248)
T PRK05557          8 ALVTGASRGIGRAIAERLAAQ-GANVVLNYASSEAGA-EALVAEIGALGGKALAVQGDVADAESIERAVDEAKAEFGGVD   85 (248)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCCHHHH-HHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCC
T ss_conf             999489768999999999987-998999969856589-999999996399589999038999999999999999829971


Q ss_pred             EEEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCC-CCCCCCCCCCCCCC
Q ss_conf             1785123433222----222222222222222202478886512322112478427863055431-12222222222222
Q gi|254780920|r   76 AIVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEV-YGSLDKGLFSEDMP  150 (358)
Q Consensus        76 ~ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~v-Yg~~~~~~~~E~~~  150 (358)
                      +++|.|+......    ..++....+++|+.|+.++..++....     .+.+.-++|++||.+. .+.           
T Consensus        86 ~linnAg~~~~~~~~~~~~~~~~~~~~vN~~~~~~~~~~~~p~m-----~~~~~G~IVnisS~~~~~~~-----------  149 (248)
T PRK05557         86 ILVNNAGITRDNLLMRMKEEDWDRVIDTNLTGVFNLTKAVARPM-----MKQRSGRIINISSVVGLMGN-----------  149 (248)
T ss_pred             EEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHCCCCEEEEECCHHHCCCC-----------
T ss_conf             99989977999991559999999999878304999999999999-----97069718998046656789-----------


Q ss_pred             CCCCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222333221000000123332---2222222222223332222222222222222222222222223322113322
Q gi|254780920|r  151 YNPSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVE  227 (358)
Q Consensus       151 ~~p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~  227 (358)
                       .....|+.+|.+.+.+.+..+.++   |+++-.+.|+.+--|..  ...-+.+..+..+..|         .+-+...+
T Consensus       150 -~~~~~Y~asKaal~~lt~~lA~e~~~~gIrvN~V~PG~i~T~~~--~~~~~~~~~~~~~~~p---------l~R~~~p~  217 (248)
T PRK05557        150 -PGQANYAASKAGVIGFTKSLARELASRGITVNAVAPGFIETDMT--DALPEDVKEAILAQIP---------LGRLGQPE  217 (248)
T ss_pred             -CCCHHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCC--CCCCHHHHHHHHHCCC---------CCCCCCHH
T ss_conf             -99555699999999999999998533194999997488877542--1179999999985799---------99980999


Q ss_pred             CCCCCEEECCCCC---CCCCCCCCCCC
Q ss_conf             2200000001222---22221113578
Q gi|254780920|r  228 DHVRALYLVLKKG---RIGERYNIGGN  251 (358)
Q Consensus       228 D~a~~i~~~~~~~---~~~~~fNigs~  251 (358)
                      |++.++..++...   ..|+.+.+.+|
T Consensus       218 dva~~v~fL~S~~s~~iTG~~i~VDGG  244 (248)
T PRK05557        218 EIASAVAFLASDEAAYITGQTLHVNGG  244 (248)
T ss_pred             HHHHHHHHHHCCHHCCCCCCEEEECCC
T ss_conf             999999999687222835872887967


No 52 
>PRK10538 3-hydroxy acid dehydrogenase; Provisional
Probab=99.61  E-value=1.2e-15  Score=114.93  Aligned_cols=209  Identities=19%  Similarity=0.175  Sum_probs=137.1

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH--CCCCEEEEECCCCCHHHHHHHHHHC-----C
Q ss_conf             94899767882779999999986898799994788765856777620--3797499976388999999998622-----7
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS--QSNLFSFLQVDICDRECIRSALKEF-----Q   73 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~--~~~~v~~i~~Di~d~~~l~~~~~~~-----~   73 (358)
                      |-||||||++=||..+++.|+++ |++|+..++.     ...++.+.  ...++.++++|++|.+.++++++..     .
T Consensus         1 mVvlVTGassGIG~a~A~~la~~-Ga~Vv~~~r~-----~~~l~~l~~~lg~~~~~~~~Dvsd~~~v~~~~~~~~~~~g~   74 (248)
T PRK10538          1 MIVLVTGATAGFGECITRRFIQN-GHKVIATGRR-----QERLQELKDELGDNLYIAQLDVRNRAAIEEMLASLPAEWRN   74 (248)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHC-CCEEEEEECC-----HHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHCCC
T ss_conf             99999888669999999999987-9999999899-----99999999984886799997348889999999999997099


Q ss_pred             CCEEEEECCCCCC-C----CCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCC
Q ss_conf             8717851234332-2----2222222222222222202478886512322112478427863055431122222222222
Q gi|254780920|r   74 PDAIVNFAAESHV-D----RSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSED  148 (358)
Q Consensus        74 ~d~ViHlAa~~~~-~----~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~  148 (358)
                      +|+++|.|+.... .    .+.++....+++|+.|+.++..++...     ..+.+.-++|++||.+-.     .     
T Consensus        75 iDiLVnNAG~~~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~~p~-----m~~~~~G~IVnisS~ag~-----~-----  139 (248)
T PRK10538         75 IDILVNNAGLALGLEPAHKASVEDWETMIDTNNKGLVYMTRAVLPG-----MVERNHGHIINIGSTAGS-----W-----  139 (248)
T ss_pred             CCEEEECCCCCCCCCCHHHCCHHHHHHHHHHCCHHHHHHHHHHHHH-----HHHCCCCEEEEEECCCCC-----C-----
T ss_conf             7599977854678886376899999877752413199999998676-----663599589999360007-----8-----


Q ss_pred             CCCCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222222233322100000012333---222222222222233322222222222222222222222222233221133
Q gi|254780920|r  149 MPYNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLY  225 (358)
Q Consensus       149 ~~~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~  225 (358)
                       +....+.|+.||.+.+.+.+..+.+   +|+++..+.|+.|-.+... .     .   ...+..-.+ ......+.++.
T Consensus       140 -~~~~~~~Y~asKaal~~~t~~La~El~~~gIrVn~v~PG~v~t~~~~-~-----~---~~~~~~~~~-~~~~~~~~~l~  208 (248)
T PRK10538        140 -PYAGGNVYGATKAFVRQFSLNLRTDLHGTAVRVTDIEPGLVGGTEFS-N-----V---RFKGDDGKA-EKTYQNTVALT  208 (248)
T ss_pred             -CCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCHH-C-----C---CCCCCHHHH-HHHHCCCCCCC
T ss_conf             -89996889999999999999999984786859999984757684111-1-----4---556768889-74035789999


Q ss_pred             CCCCCCCEEECCCCCC
Q ss_conf             2222000000012222
Q gi|254780920|r  226 VEDHVRALYLVLKKGR  241 (358)
Q Consensus       226 v~D~a~~i~~~~~~~~  241 (358)
                      .+|+|++++.++..+.
T Consensus       209 PedVA~av~fl~s~p~  224 (248)
T PRK10538        209 PEDVSEAVWWVATLPA  224 (248)
T ss_pred             HHHHHHHHHHHHCCCC
T ss_conf             9999999999982999


No 53 
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]
Probab=99.61  E-value=2.9e-15  Score=112.59  Aligned_cols=222  Identities=17%  Similarity=0.190  Sum_probs=149.8

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEE
Q ss_conf             94899767882779999999986898799994788765856777620379749997638899999999862278717851
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNF   80 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~ViHl   80 (358)
                      |+|||||||||+|+++|++|+++ +++|.++-|.     ........  ..+++..+|+.++..+...+++.  |.++++
T Consensus         1 ~~ilV~GatG~~G~~~~~~L~~~-~~~v~~~~r~-----~~~~~~~~--~~v~~~~~d~~~~~~l~~~~~G~--~~~~~i   70 (275)
T COG0702           1 MKILVTGATGFVGGAVVRELLAR-GHEVRAAVRN-----PEAAAALA--GGVEVVLGDLRDPKSLVAGAKGV--DGVLLI   70 (275)
T ss_pred             CCEEEECCCCCHHHHHHHHHHHC-CCEEEEECCC-----CHHHHHCC--CCCEEECCCCCCCHHHHHHHCCC--EEEEEE
T ss_conf             93899867775799999999975-9869997368-----22111103--78528845641607799984894--179995


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             23433222222222222222222202478886512322112478427863055431122222222222222222222333
Q gi|254780920|r   81 AAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSAT  160 (358)
Q Consensus        81 Aa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~s~Yg~s  160 (358)
                      ..... +.    + ...........+..+++          ..+...+++.|......             ...+.|..+
T Consensus        71 ~~~~~-~~----~-~~~~~~~~~~~~~a~~a----------~~~~~~~~~~s~~~~~~-------------~~~~~~~~~  121 (275)
T COG0702          71 SGLLD-GS----D-AFRAVQVTAVVRAAEAA----------GAGVKHGVSLSVLGADA-------------ASPSALARA  121 (275)
T ss_pred             CCCCC-CC----C-CHHHHHHHHHHHHHHHC----------CCCCCCEEEEEECCCCC-------------CCCHHHHHH
T ss_conf             25455-66----3-01200367899999862----------74424326875023566-------------880678999


Q ss_pred             CCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCC
Q ss_conf             221000000123332222222222222333222222222222222-2222222222223322113322220000000122
Q gi|254780920|r  161 KASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRM-IEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK  239 (358)
Q Consensus       161 K~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~-~~g~~~~i~g~g~~~Rdfi~v~D~a~~i~~~~~~  239 (358)
                      |..+|..+..    -+++++++|+...|.......      +..+ ..+.+....+.+  ....+.++|++.++..++..
T Consensus       122 ~~~~e~~l~~----sg~~~t~lr~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~--~~~~i~~~d~a~~~~~~l~~  189 (275)
T COG0702         122 KAAVEAALRS----SGIPYTTLRRAAFYLGAGAAF------IEAAEAAGLPVIPRGIG--RLSPIAVDDVAEALAAALDA  189 (275)
T ss_pred             HHHHHHHHHH----CCCCCCCCCCCCEECCCCHHH------HHHHHHCCCCEEECCCC--CCCCEEHHHHHHHHHHHHCC
T ss_conf             9999999985----698620355630011530567------99998458851412566--54714565679999987148


Q ss_pred             C-CCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCC
Q ss_conf             2-222211135786420268899998860342655
Q gi|254780920|r  240 G-RIGERYNIGGNNERKNIDIVFEIGFLLDALIPK  273 (358)
Q Consensus       240 ~-~~~~~fNigs~~~~s~~e~~~~i~~~~~~~~~~  273 (358)
                      + ..+.+|.+++.+..+..+.+..+....++....
T Consensus       190 ~~~~~~~~~l~g~~~~~~~~~~~~l~~~~gr~~~~  224 (275)
T COG0702         190 PATAGRTYELAGPEALTLAELASGLDYTIGRPVGL  224 (275)
T ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCC
T ss_conf             53348679995740035568987789987887545


No 54 
>PRK07578 short chain dehydrogenase; Provisional
Probab=99.60  E-value=1.1e-15  Score=115.27  Aligned_cols=192  Identities=19%  Similarity=0.208  Sum_probs=128.4

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC-CCCEEEE
Q ss_conf             948997678827799999999868987999947887658567776203797499976388999999998622-7871785
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEF-QPDAIVN   79 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~-~~d~ViH   79 (358)
                      ||||||||++=||+.+++.|. + +++|+...+..              .   -+++|++|++.++++++.. ++|+++|
T Consensus         1 MrVlVTGas~GIG~aia~~la-~-~~~vv~~~r~~--------------~---~~~~Dvtd~~~v~~~~~~~G~iD~lVn   61 (199)
T PRK07578          1 MKILVIGASGTIGRAVVAELS-A-RHEVITAGRSS--------------G---DVQVDITDPASIRALFEKVGKVDAVVS   61 (199)
T ss_pred             CEEEEECCCCHHHHHHHHHHH-C-CCCEEEEECCC--------------C---CEEEECCCHHHHHHHHHHHCCCCEEEE
T ss_conf             979999987489999999996-7-99989983686--------------7---756858899999999996299989998


Q ss_pred             ECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             123433222----2222222222222222024788865123221124784278630554311222222222222222222
Q gi|254780920|r   80 FAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSS  155 (358)
Q Consensus        80 lAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~s  155 (358)
                      .|+......    +.++....+++|+.|+.++..++....      +.+ -.++++||....     .      +.....
T Consensus        62 nAG~~~~~~~~~~~~e~~~~~~~~nl~g~~~l~~~~~~~l------~~g-GsIv~isS~~~~-----~------~~~~~~  123 (199)
T PRK07578         62 AAGKVHFAPLTEMTDEDFQLGLQSKLMGQINLVLIGQEYL------NDG-GSFTLTSGILSE-----E------PIPGGA  123 (199)
T ss_pred             CCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH------HCC-CCCEEEEEHHEE-----C------CCCCCH
T ss_conf             8722679894879998977787200138999999999987------608-985688313000-----7------688818


Q ss_pred             CCCCCCCCCEEEECCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCE
Q ss_conf             22333221000000123332--2222222222223332222222222222222222222222223322113322220000
Q gi|254780920|r  156 PYSATKASSDYLVLAWGHTY--GIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRAL  233 (358)
Q Consensus       156 ~Yg~sK~~~E~~~~~~~~~~--~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~a~~i  233 (358)
                      .|+.+|.+.+.+.+..+.+.  |+++-.+-|+.|--|.           .+..   |..-.+      .-..++|+|.++
T Consensus       124 ~Y~asKaal~~ltr~lA~El~~gIRVN~VaPG~V~T~m-----------~~~~---~~~~~~------~~~~~~~~A~a~  183 (199)
T PRK07578        124 SAATVNGALEGFVKAAALELPRGIRINVVSPTVLTESL-----------DKYG---PFFPGF------EPVPAADVALAY  183 (199)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHH-----------HHCC---CCCCCC------CCCCHHHHHHHH
T ss_conf             99999999999999999974879799998568655656-----------6555---548999------987999999999


Q ss_pred             EECCCCCCCCCCCCCC
Q ss_conf             0001222222211135
Q gi|254780920|r  234 YLVLKKGRIGERYNIG  249 (358)
Q Consensus       234 ~~~~~~~~~~~~fNig  249 (358)
                      +...+....|+++.+|
T Consensus       184 l~~~~~~~tgqv~~v~  199 (199)
T PRK07578        184 LRSVEGAQTGEVYKVG  199 (199)
T ss_pred             HHHHCCCCCCEEEECC
T ss_conf             9742255774378559


No 55 
>PRK08267 short chain dehydrogenase; Provisional
Probab=99.60  E-value=2.3e-15  Score=113.19  Aligned_cols=207  Identities=22%  Similarity=0.131  Sum_probs=134.3

Q ss_pred             CE-EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH------CC
Q ss_conf             94-899767882779999999986898799994788765856777620379749997638899999999862------27
Q gi|254780920|r    1 MR-LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKE------FQ   73 (358)
Q Consensus         1 Mk-ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~------~~   73 (358)
                      || ||||||++=||..+++.|+++ |++|+..|+...  ....+.......++.++.+|++|.+++++++++      .+
T Consensus         1 MK~vlITGassGIG~a~A~~~a~~-G~~V~~~~r~~~--~l~~~~~~l~~~~~~~~~~Dvtd~~~v~~~~~~~~~~~~G~   77 (258)
T PRK08267          1 MKSIFITGAASGIGRATARLFAAR-GWRVGAYDINED--GLAALAAELGAERAWTGALDVTDRAAWDAALADFCAATGGR   77 (258)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHH--HHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCC
T ss_conf             998999072268999999999987-999999988899--99999998369967999911799999999999999995899


Q ss_pred             CCEEEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCC-CCCCCCCCCCCCC
Q ss_conf             871785123433222----22222222222222220247888651232211247842786305543-1122222222222
Q gi|254780920|r   74 PDAIVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDE-VYGSLDKGLFSED  148 (358)
Q Consensus        74 ~d~ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~-vYg~~~~~~~~E~  148 (358)
                      +|+++|.|+......    +.++....+++|+.|+.++..++.-+.     .+.+.-++|.+||.+ .+|.+        
T Consensus        78 iDiLVNNAGi~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~lp~m-----~~~~~g~IvnisS~~g~~~~p--------  144 (258)
T PRK08267         78 LDVLFNNAGILRGGPFEDIPLEAHDRVIDINVKGVLNGAYAALPYL-----KATPGARVINTSSASAIYGQP--------  144 (258)
T ss_pred             CCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHCCCCEEEEEECHHHCCCCC--------
T ss_conf             8689988877999882449999999999997399999999999999-----977992799990654467999--------


Q ss_pred             CCCCCCCCCCCCCCCCEEEECCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222223332210000001233---3222222222222233322222222222222222222222222233221133
Q gi|254780920|r  149 MPYNPSSPYSATKASSDYLVLAWGH---TYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLY  225 (358)
Q Consensus       149 ~~~~p~s~Yg~sK~~~E~~~~~~~~---~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~  225 (358)
                          ..+.|+.||.+...+.+..+.   .+|+++..+-|+.|--|--..+.        ...+.+..   .   ......
T Consensus       145 ----~~~~Y~aSK~av~~lt~sla~El~~~gIrVn~v~PG~v~T~m~~~~~--------~~~~~~~~---~---~~~~~~  206 (258)
T PRK08267        145 ----QLAVYSATKFAVRGLTEALDLEWRRHGIRVADVMPLFVDTPMLGSNG--------VRAGSPKR---L---GVRLTP  206 (258)
T ss_pred             ----CCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCCCC--------CCCCCCCC---C---CCCCCC
T ss_conf             ----98669999999999999999984301918999971889876689887--------76753001---5---898999


Q ss_pred             CCCCCCCEEECCCCCC
Q ss_conf             2222000000012222
Q gi|254780920|r  226 VEDHVRALYLVLKKGR  241 (358)
Q Consensus       226 v~D~a~~i~~~~~~~~  241 (358)
                      .+++|++++.++.++.
T Consensus       207 pe~vA~~i~~a~~~~~  222 (258)
T PRK08267        207 VEDVAEAVWAAAHGPT  222 (258)
T ss_pred             HHHHHHHHHHHHCCCC
T ss_conf             9999999999972799


No 56 
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=99.60  E-value=1e-15  Score=115.34  Aligned_cols=221  Identities=18%  Similarity=0.122  Sum_probs=143.0

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             89976788277999999998689879999478876585677762-03797499976388999999998622-----7871
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEI-SQSNLFSFLQVDICDRECIRSALKEF-----QPDA   76 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~-~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d~   76 (358)
                      ||||||++=||..++++|+++ |++|+...+.....-......+ ....++.++++|++|.+.++++++..     .+|+
T Consensus         8 vlITGgs~GIG~aia~~la~~-G~~V~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~Dl~~~~~~~~~~~~~~~~~g~iD~   86 (247)
T PRK05565          8 AIVTGASGGIGRAIAELLAKE-GAKVVIAYDKNEEAANELLEEIKEVGGDAIAVKADVSSEDDVENLVEQIVEKFGKIDI   86 (247)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCE
T ss_conf             999378458999999999987-9989998179989999999999963990899983589999999999999998099849


Q ss_pred             EEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             785123433222----2222222222222222024788865123221124784278630554311222222222222222
Q gi|254780920|r   77 IVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYN  152 (358)
Q Consensus        77 ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~  152 (358)
                      ++|.|+......    +.++-...+++|+.|+.++..++....     .+.+.-++|++||...+-           +..
T Consensus        87 lVnnAg~~~~~~~~~~~~~~~~~~~~~Nl~~~~~~~~~~~~~m-----~~~~~G~II~isS~~~~~-----------~~~  150 (247)
T PRK05565         87 LVNNAGISKFGLVTDMTDEEWDRVINVNLTGVMRLTRYALPIM-----IKRGSGVIVNISSIWGLI-----------GAS  150 (247)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHCCCCEEEEECCHHHCC-----------CCC
T ss_conf             9989987899991559999999999985478999999857988-----756997599973512257-----------899


Q ss_pred             CCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222233322100000012333---2222222222222333222222222222222222222222222332211332222
Q gi|254780920|r  153 PSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDH  229 (358)
Q Consensus       153 p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~  229 (358)
                      ....|+.+|.+.+.+.+.++.+   +|+++.++.|+.+-.|...  .+.+....++.+.-|+         .-+...+|+
T Consensus       151 ~~~~Y~asKaal~~ltr~lA~e~~~~gIrvN~V~PG~~~T~~~~--~~~~~~~~~~~~~~p~---------~R~~~p~dv  219 (247)
T PRK05565        151 CEVLYSASKGAVNAFTKALAKELAPSGIRVNAIAPGAIETEMNS--SFSEEDKEGLAEEIPL---------GRLGEPEEI  219 (247)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCCC--CCCHHHHHHHHHCCCC---------CCCCCHHHH
T ss_conf             83388999999999999999995430949999960989574210--0497789999855998---------899399999


Q ss_pred             CCCEEECCCC---CCCCCCCCCCCC
Q ss_conf             0000000122---222221113578
Q gi|254780920|r  230 VRALYLVLKK---GRIGERYNIGGN  251 (358)
Q Consensus       230 a~~i~~~~~~---~~~~~~fNigs~  251 (358)
                      ++++..++..   ...|+++++.+|
T Consensus       220 a~~v~fL~s~~s~~itG~~i~VDGG  244 (247)
T PRK05565        220 AKVVLFLASDDASYITGQIITVDGG  244 (247)
T ss_pred             HHHHHHHHCCHHCCCCCCEEEECCC
T ss_conf             9999999686221856864874849


No 57 
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=99.59  E-value=1.7e-15  Score=114.02  Aligned_cols=220  Identities=19%  Similarity=0.249  Sum_probs=137.9

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH-CCCCEEEEECCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             899767882779999999986898799994788765856777620-3797499976388999999998622-----7871
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS-QSNLFSFLQVDICDRECIRSALKEF-----QPDA   76 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~-~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d~   76 (358)
                      +|||||++-||+.+++.|+++ |++|+..|+..... ..-.+.+. ....+.++.+|++|.+.++++++..     .+|+
T Consensus         8 ~lITGas~GIG~aiA~~la~~-Ga~V~i~~r~~~~l-~~~~~~l~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~~g~iD~   85 (253)
T PRK08217          8 IVITGGAQGLGRAMAEYLAQK-GAKLALIDLNQEKL-EEAVAQCAALGGEAEVYAANVTDEEDVEATFAQIAEDFGQLNG   85 (253)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHHH-HHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             999488778999999999987-99899997999999-9999999965994899982479999999999999998399859


Q ss_pred             EEEECCCCCCCC-------------CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCC
Q ss_conf             785123433222-------------2222222222222222024788865123221124784278630554311222222
Q gi|254780920|r   77 IVNFAAESHVDR-------------SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKG  143 (358)
Q Consensus        77 ViHlAa~~~~~~-------------~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~  143 (358)
                      ++|.|+......             +.++....+++|+.|+..+...+....    ......-++|.+||.+.+|.+   
T Consensus        86 lVnNAGi~~~~~~~~~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m----~~~~~~g~Ii~isS~~~~~~~---  158 (253)
T PRK08217         86 LINNAGILRDGLLVKAKDGKVTSKMSLEQFQSVIDVNLTGVFLCGREAAAKM----IESGSKGVIINISSIARAGNM---  158 (253)
T ss_pred             EEECCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHCCCEEEEEECCHHCCCCC---
T ss_conf             9985743677664446666520119999999999998178999999999999----984897279996331113888---


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222222222233322100000012333---2222222222222333222222222222222222222222222332
Q gi|254780920|r  144 LFSEDMPYNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNV  220 (358)
Q Consensus       144 ~~~E~~~~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~  220 (358)
                               +.+.|+.||.+.+.+.+.++.+   +|+++-.+-|+.+--|..  ...-+....+..+.-|+         
T Consensus       159 ---------~~~~Y~asKaal~~ltk~lA~el~~~gIrVN~I~PG~i~T~~~--~~~~~~~~~~~~~~~pl---------  218 (253)
T PRK08217        159 ---------GQTNYSASKAGVAAMTVTWAKELARYGIRVAAIAPGVIETEMT--AAMKPEALERLEKMIPV---------  218 (253)
T ss_pred             ---------CCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCC--CCCCHHHHHHHHHCCCC---------
T ss_conf             ---------8616899999999999999999532195999997388987331--11799999999857999---------


Q ss_pred             CCCCCCCCCCCCEEECCCC-CCCCCCCCCCCC
Q ss_conf             2113322220000000122-222221113578
Q gi|254780920|r  221 RDWLYVEDHVRALYLVLKK-GRIGERYNIGGN  251 (358)
Q Consensus       221 Rdfi~v~D~a~~i~~~~~~-~~~~~~fNigs~  251 (358)
                      +-+.-.+|+|.++..++.. .-.|+++.+.+|
T Consensus       219 ~R~g~p~dva~~v~fL~s~~~iTG~~i~VDGG  250 (253)
T PRK08217        219 GRLGEPEEIAHTVRFIIENDYVTGRVLEIDGG  250 (253)
T ss_pred             CCCCCHHHHHHHHHHHHHCCCCCCCEEEECCC
T ss_conf             99849999999999999589988996786968


No 58 
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated
Probab=99.58  E-value=1.2e-15  Score=114.96  Aligned_cols=218  Identities=16%  Similarity=0.180  Sum_probs=145.2

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             48997678827799999999868987999947887658567776203797499976388999999998622-----7871
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEF-----QPDA   76 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d~   76 (358)
                      .+|||||++=||..++++|+++ |++|+++|+.        .+.+....++..+.+|++|.+.++++++..     ++|+
T Consensus        10 ~alITG~s~GIG~aia~~la~~-Ga~V~~~~r~--------~~~l~~~~~~~~~~~Dv~~~~~v~~~~~~~~~~~g~iDi   80 (253)
T PRK08220         10 TVWVTGAAQGIGYAVALAFVEA-GAKVIGFDQA--------FEQLNEQYPFATFVLDVADAAAVAQVCQRLLAETGPLDV   80 (253)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECC--------HHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCCE
T ss_conf             8999588568999999999987-9999999788--------778748997799997379999999999999997399888


Q ss_pred             EEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             785123433222----2222222222222222024788865123221124784278630554311222222222222222
Q gi|254780920|r   77 IVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYN  152 (358)
Q Consensus        77 ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~  152 (358)
                      ++|.|+......    +.++....+++|+.|..++..++-...     ...+.-++|++||.+..     .      +..
T Consensus        81 lVnnAG~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~p~m-----~~~~~G~IV~isS~~~~-----~------~~~  144 (253)
T PRK08220         81 LVNVAGVLRMGATDSLSDEDWQQTFAVNAGGVFNLSRAVMPQF-----RRQRGGAIVTVGSNAAH-----T------PRI  144 (253)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHCCCCEEEEEEEHHHH-----C------CCC
T ss_conf             9989987899980449999999999997463899999999877-----77389659999747871-----8------689


Q ss_pred             CCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCC---C-----CCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222233322100000012333---22222222222223332222---2-----22222222222222222222223322
Q gi|254780920|r  153 PSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFP---E-----KLIPLAITRMIEGSHVFLYGDGQNVR  221 (358)
Q Consensus       153 p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~---~-----~~i~~~i~~~~~g~~~~i~g~g~~~R  221 (358)
                      ..+.|+.||.+.+.+.+..+.+   +|+++-.+-|+.+--|....   +     +.+..+..+...         +-..+
T Consensus       145 ~~~~Y~asKaal~~lt~~lA~el~~~gIrVN~V~PG~v~T~~~~~~~~~~~~~~~~~~~~~~~~~~---------~iPl~  215 (253)
T PRK08220        145 GMAAYGASKAALTSLTKCVGLELAPYGVRCNVVSPGSTDTDMQRTLWVDEDGEQQRIAGFPEQFKL---------GIPLG  215 (253)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEECCCCCCHHHHHHCCCCHHHHHHHHHHHHHHHC---------CCCCC
T ss_conf             838899999999999999999954309599999608898744554324814789999865998855---------89988


Q ss_pred             CCCCCCCCCCCEEECCCC---CCCCCCCCCCCCCC
Q ss_conf             113322220000000122---22222111357864
Q gi|254780920|r  222 DWLYVEDHVRALYLVLKK---GRIGERYNIGGNNE  253 (358)
Q Consensus       222 dfi~v~D~a~~i~~~~~~---~~~~~~fNigs~~~  253 (358)
                      -+...+|+|.++..++..   ...|+.+.+.+|-.
T Consensus       216 R~~~p~diA~~v~fL~S~~s~~itGq~i~vDGG~t  250 (253)
T PRK08220        216 KIARPQEIANAVLFLASDLASHITMQDIVVDGGAT  250 (253)
T ss_pred             CCCCHHHHHHHHHHHHCCHHCCCCCCEEEECCCCC
T ss_conf             98199999999999958543392483288993710


No 59 
>PRK07479 consensus
Probab=99.58  E-value=1.6e-15  Score=114.26  Aligned_cols=223  Identities=15%  Similarity=0.109  Sum_probs=142.9

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHH-HHHH-CCCCEEEEECCCCCHHHHHHHHHHC-----CCC
Q ss_conf             89976788277999999998689879999478876585677-7620-3797499976388999999998622-----787
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSL-KEIS-QSNLFSFLQVDICDRECIRSALKEF-----QPD   75 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~-~~~~-~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d   75 (358)
                      +|||||++-||+.+++.|+++ |++|+..|+....  .... ..+. ...++.++++|++|++.++++++..     ++|
T Consensus         8 alITGgs~GIG~a~a~~la~~-G~~V~i~~~~~~~--~~~~~~~l~~~g~~~~~~~~Dv~~~~~~~~~~~~~~~~~G~iD   84 (252)
T PRK07479          8 AIVTGAGSGFGEGIAKRFARE-GAKVVVADLNAAA--AERVASEIADAGGNAIAVAADVSRGADVEALVEAALEAFGRVD   84 (252)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHH--HHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             999388768999999999987-9999999798999--9999999985399789999258999999999999999819985


Q ss_pred             EEEEECCCCCCCC-----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             1785123433222-----22222222222222220247888651232211247842786305543112222222222222
Q gi|254780920|r   76 AIVNFAAESHVDR-----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMP  150 (358)
Q Consensus        76 ~ViHlAa~~~~~~-----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~  150 (358)
                      +++|.|+......     +.++....+++|+.|+.++..++...     ....+.-++|++||...+-           +
T Consensus        85 ~lVnnAG~~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~p~-----m~~~~~G~Iv~isS~~~~~-----------~  148 (252)
T PRK07479         85 IVVNNAGTTHRNKPMLDVTEAEFDRVYAVNVKSIYLSTRHFVPH-----FRAQGGGVIINIASTAGVR-----------P  148 (252)
T ss_pred             EEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEEEECHHHCC-----------C
T ss_conf             99989976689988276999999999999863105654440498-----9867997299980487668-----------9


Q ss_pred             CCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222233322100000012333---22222222222223332222---222222222222222222222223322113
Q gi|254780920|r  151 YNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFP---EKLIPLAITRMIEGSHVFLYGDGQNVRDWL  224 (358)
Q Consensus       151 ~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~---~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi  224 (358)
                      ......|+.||.+.+.+.+..+.+   +|+++-.+.|+.+-.|.-..   ....+....++...-|+         +-+.
T Consensus       149 ~~~~~~Y~asKaal~~ltr~lA~el~~~gIrVN~I~Pg~~~T~~~~~~~~~~~~~~~~~~~~~~~Pl---------~R~g  219 (252)
T PRK07479        149 RPGLTWYNASKGAVITATKAMAAELAPDNIRVNCLNPVAGETGLLTEFMGVEDTPENRAKFLATIPL---------GRFS  219 (252)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEECCCCCCHHHHHHHCCCCCHHHHHHHHHCCCC---------CCCC
T ss_conf             9997179999999999999999995140969999966978765788761379989999999707998---------9980


Q ss_pred             CCCCCCCCEEECCCC---CCCCCCCCCCCCCC
Q ss_conf             322220000000122---22222111357864
Q gi|254780920|r  225 YVEDHVRALYLVLKK---GRIGERYNIGGNNE  253 (358)
Q Consensus       225 ~v~D~a~~i~~~~~~---~~~~~~fNigs~~~  253 (358)
                      ..+|+++++..++..   ...|+++.+.+|.+
T Consensus       220 ~pedia~~v~fL~S~~s~~iTGq~i~VDGG~s  251 (252)
T PRK07479        220 TPQDVANAALYLASDEASFITGVCLEVDGGRC  251 (252)
T ss_pred             CHHHHHHHHHHHHCCHHCCCCCCEEEECCCCC
T ss_conf             99999999999968443294688188598960


No 60 
>PRK12824 acetoacetyl-CoA reductase; Provisional
Probab=99.58  E-value=1.9e-15  Score=113.74  Aligned_cols=224  Identities=22%  Similarity=0.158  Sum_probs=146.5

Q ss_pred             CE--EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHH-HHCCCCEEEEECCCCCHHHHHHHHHH-----C
Q ss_conf             94--8997678827799999999868987999947887658567776-20379749997638899999999862-----2
Q gi|254780920|r    1 MR--LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKE-ISQSNLFSFLQVDICDRECIRSALKE-----F   72 (358)
Q Consensus         1 Mk--ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~-~~~~~~v~~i~~Di~d~~~l~~~~~~-----~   72 (358)
                      ||  +|||||++=||..+++.|+++ |++|+..++............ -....++.++++|++|++.++++++.     .
T Consensus         1 M~KvalITGas~GIG~a~a~~la~~-G~~Vv~~~~~~~~~~~~~~~~~~~~~~~~~~~~~D~~d~~~~~~~v~~~~~~~g   79 (245)
T PRK12824          1 MKKIALVTGAKRGIGSAIARELLAD-GYRVIATYFGNYDAAKDWFEEYGFTEDQVRLKSLDVTDTEECQEALARIEEEEG   79 (245)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCC
T ss_conf             9859999478888999999999987-998999958807789999998740499389999138999999999999999749


Q ss_pred             CCCEEEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCC
Q ss_conf             7871785123433222----222222222222222202478886512322112478427863055431122222222222
Q gi|254780920|r   73 QPDAIVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSED  148 (358)
Q Consensus        73 ~~d~ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~  148 (358)
                      .+|+++|.|+......    ..++....+++|+.|+..+..++...     ..+.+.-++|++||...+-.         
T Consensus        80 ~iDiLVnnAG~~~~~~~~~~~~e~w~~~~~vNl~~~f~~~~~~~~~-----m~~~~~G~IVnisS~~~~~~---------  145 (245)
T PRK12824         80 PVDILVNNAGITRDSGFKRMSHQEWNDVINTNLNSVFNVTQPLFPA-----MCEQGYGRIINISSVNGLKG---------  145 (245)
T ss_pred             CCCEEEECCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEEECCHHHCCC---------
T ss_conf             9989998988899999023999999999999734159999999999-----99839955999746775778---------


Q ss_pred             CCCCCCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222222333221000000123332---22222222222233322222222222222222222222222233221133
Q gi|254780920|r  149 MPYNPSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLY  225 (358)
Q Consensus       149 ~~~~p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~  225 (358)
                        ......|+.||.+...+.+.+++++   |+++-.+-|+.+-.|.-  ....+....+..+.-|         .+-+.-
T Consensus       146 --~~~~~~Y~asKaal~~ltk~lA~E~a~~gIrvN~I~PG~i~T~~~--~~~~~e~~~~~~~~~P---------l~R~g~  212 (245)
T PRK12824        146 --QFGQTNYSAAKAGMIGFTKALASEGARYGITVNCIAPGYIATPMV--EQAGPEVLQSIKNQIP---------MKRLGT  212 (245)
T ss_pred             --CCCCHHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCC--HHCCHHHHHHHHHCCC---------CCCCCC
T ss_conf             --899689999999999999999999725491999997446878210--0059999999985699---------889878


Q ss_pred             CCCCCCCEEECCCC---CCCCCCCCCCCCC
Q ss_conf             22220000000122---2222211135786
Q gi|254780920|r  226 VEDHVRALYLVLKK---GRIGERYNIGGNN  252 (358)
Q Consensus       226 v~D~a~~i~~~~~~---~~~~~~fNigs~~  252 (358)
                      .+|+|+++..+...   .-.|.++.+.+|-
T Consensus       213 peevA~~v~FL~Sd~a~~iTG~~i~VDGG~  242 (245)
T PRK12824        213 PEEIAAAVAFLVSEAAGFITGETISINGGL  242 (245)
T ss_pred             HHHHHHHHHHHHCCHHCCCCCCEEEECCCH
T ss_conf             999999999995863258418537978670


No 61 
>PRK07856 short chain dehydrogenase; Provisional
Probab=99.57  E-value=3.5e-15  Score=112.07  Aligned_cols=219  Identities=15%  Similarity=0.100  Sum_probs=140.7

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             48997678827799999999868987999947887658567776203797499976388999999998622-----7871
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEF-----QPDA   76 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d~   76 (358)
                      .+|||||++-||..+++.|+++ |.+|+..++...         ........++++|++|.+.++++++..     ++|+
T Consensus        10 ~alITGgs~GIG~aia~~la~~-Ga~V~i~~r~~~---------~~~~~~~~~~~~Dv~~~~~v~~~~~~~~~~~g~iDi   79 (254)
T PRK07856         10 VVLVTGGTRGVGAGISEAFLAA-GATVVVCGRRAP---------EVDGRPAEFHACDIRDPDQVAALVDAIAERHGRLDV   79 (254)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHH---------HCCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             8999476768999999999987-999999979855---------748984399984699999999999999998099888


Q ss_pred             EEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCC-CCCCCCCCCCCCCCC
Q ss_conf             785123433222----222222222222222202478886512322112478427863055431-122222222222222
Q gi|254780920|r   77 IVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEV-YGSLDKGLFSEDMPY  151 (358)
Q Consensus        77 ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~v-Yg~~~~~~~~E~~~~  151 (358)
                      ++|.|+......    +.++....+++|+.|+..+..++.....    .....-+||.+||... .+.            
T Consensus        80 lVnNAG~~~~~~~~~~~~~~~~~~~~vNl~~~~~l~q~~~~~m~----~~~~~G~IVnisS~~~~~~~------------  143 (254)
T PRK07856         80 LVNNAGGSPYALAAEASPRFHEKIVELNLLAPLLVAQAANAVMQ----QQPGGGSIVNIGSVSGRRPS------------  143 (254)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHH----HCCCCCEEEEECCHHHCCCC------------
T ss_conf             99889889998813499999999999982899999999999999----72799789994542432788------------


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222223332210000001233322--22222222222333222222222222222222222222222332211332222
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGHTYG--IPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDH  229 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~~~~--l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~  229 (358)
                      .....|+.||.+.+.+.+..+.+++  +++-.+.|+.+..+......--+..+....+.-|         .+-+...+|+
T Consensus       144 ~~~~~Y~asKaal~~ltk~lA~e~a~~IrVN~VaPG~i~T~~~~~~~~~~e~~~~~~~~iP---------lgR~g~pedv  214 (254)
T PRK07856        144 PGTAAYGAAKAGLLNLTTSLAVEWAPKVRVNAVVVGLVETEQSELHYGDAEGIAAVAATVP---------LGRLATPADI  214 (254)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHCCCHHHHHHHHHCCC---------CCCCCCHHHH
T ss_conf             9728799999999999999999977998899997598977114331599999999983799---------9997699999


Q ss_pred             CCCEEECCCC---CCCCCCCCCCCCCCCC
Q ss_conf             0000000122---2222211135786420
Q gi|254780920|r  230 VRALYLVLKK---GRIGERYNIGGNNERK  255 (358)
Q Consensus       230 a~~i~~~~~~---~~~~~~fNigs~~~~s  255 (358)
                      ++++..++..   ...|+++.|.+|...+
T Consensus       215 A~~v~fL~S~~s~~iTG~~i~VDGG~~~~  243 (254)
T PRK07856        215 GWACLFLASDAASYVSGANLEVHGGGEPP  243 (254)
T ss_pred             HHHHHHHHCCHHCCEECCEEEECCCCCCH
T ss_conf             99999995872168108557889999934


No 62 
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=99.57  E-value=3.4e-15  Score=112.21  Aligned_cols=224  Identities=15%  Similarity=0.115  Sum_probs=145.6

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH-----CCCCE
Q ss_conf             4899767882779999999986898799994788765856777620379749997638899999999862-----27871
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKE-----FQPDA   76 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~-----~~~d~   76 (358)
                      .+|||||++-||..++++|+++ |++|+..|+...  ............++.++++|++|.+.++++++.     ..+|+
T Consensus         8 ~alITGgs~GIG~aia~~la~~-G~~V~i~~r~~~--~~~~~~~~~~~~~~~~~~~Dv~~~~~~~~~~~~~~~~~g~iD~   84 (250)
T PRK07231          8 VAIVTGAGSGFGEGIARRFAAE-GARVVVTDRNQE--AAERVAAEIRGGRAIAVAADVSDEADVRAAVEAALERFGSVDI   84 (250)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHH--HHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             8999388868999999999987-999999979889--9999999844996799993079999999999999998199719


Q ss_pred             EEEECCCCCCCC-----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             785123433222-----222222222222222202478886512322112478427863055431122222222222222
Q gi|254780920|r   77 IVNFAAESHVDR-----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPY  151 (358)
Q Consensus        77 ViHlAa~~~~~~-----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~  151 (358)
                      ++|.|+......     +.++....+++|+.|+..+..++....     .+.+.-++|++||...+-           +.
T Consensus        85 lInnAG~~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~p~m-----~~~~~G~IinisS~~~~~-----------~~  148 (250)
T PRK07231         85 LVNNAGTTHRNGPLLDVDEAEFDRVYAVNVKSIYLWAQAAVPAW-----RGEGGGAIVNVASTAGIR-----------PR  148 (250)
T ss_pred             EEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHCCCCEEEEEECHHHCC-----------CC
T ss_conf             99888337899892769999999999999899999999999999-----983996499994477658-----------89


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222233322100000012333---2222222222222333222--222222222222222222222222332211332
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHF--PEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYV  226 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~--~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v  226 (358)
                      .....|+.||.+.+.+.+.++.+   +|+++-.+-|+.+-.|.-.  .....+.....+...-|+         +-+...
T Consensus       149 ~~~~~Y~asKaal~~lt~~lA~el~~~gIrVN~I~PG~v~T~~~~~~~~~~~~~~~~~~~~~~Pl---------~R~~~p  219 (250)
T PRK07231        149 PGLGWYNASKGAVITATKSLAVELAPDNIRVNAVNPVVGETGLLEAFMGEPTPENRAKFLATIPL---------GRLGTP  219 (250)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCHHHHHHHCCCCHHHHHHHHHCCCC---------CCCCCH
T ss_conf             99627999999999999999999534095999996387986377775238989999999837999---------998199


Q ss_pred             CCCCCCEEECCCC---CCCCCCCCCCCCCC
Q ss_conf             2220000000122---22222111357864
Q gi|254780920|r  227 EDHVRALYLVLKK---GRIGERYNIGGNNE  253 (358)
Q Consensus       227 ~D~a~~i~~~~~~---~~~~~~fNigs~~~  253 (358)
                      +|+++++..++..   ...|+++.+.+|..
T Consensus       220 ~dia~~v~fL~S~~s~~itG~~i~VDGG~s  249 (250)
T PRK07231        220 EDIANAAAFLASDEASFITGVALEVDGGRC  249 (250)
T ss_pred             HHHHHHHHHHHCCHHCCCCCCEEEECCCCC
T ss_conf             999999999968533294687188488877


No 63 
>PRK07454 short chain dehydrogenase; Provisional
Probab=99.57  E-value=3.1e-15  Score=112.39  Aligned_cols=206  Identities=16%  Similarity=0.179  Sum_probs=135.4

Q ss_pred             CE-EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHH-HHHH-CCCCEEEEECCCCCHHHHHHHHHHC-----
Q ss_conf             94-89976788277999999998689879999478876585677-7620-3797499976388999999998622-----
Q gi|254780920|r    1 MR-LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSL-KEIS-QSNLFSFLQVDICDRECIRSALKEF-----   72 (358)
Q Consensus         1 Mk-ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~-~~~~-~~~~v~~i~~Di~d~~~l~~~~~~~-----   72 (358)
                      || +|||||++=||..+++.|.++ |++|+.++|....  ...+ +++. ...++.++.+|++|++.++++++..     
T Consensus         6 mKvalITGas~GIG~a~A~~la~~-G~~V~l~~R~~~~--l~~~~~e~~~~g~~~~~~~~Dvt~~~~v~~~~~~~~~~~G   82 (241)
T PRK07454          6 MPTALITGASRGIGKATALAFAKA-GWDLALVARSQDA--LEALAEELRSTGVKVAAYSIDLSNPEAIAPGIAELLEQFG   82 (241)
T ss_pred             CCEEEECCCCCHHHHHHHHHHHHC-CCEEEEEECCHHH--HHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHCC
T ss_conf             988999175878999999999987-9989999899999--9999999996599289999518999999999999999759


Q ss_pred             CCCEEEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCC
Q ss_conf             7871785123433222----222222222222222202478886512322112478427863055431122222222222
Q gi|254780920|r   73 QPDAIVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSED  148 (358)
Q Consensus        73 ~~d~ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~  148 (358)
                      .+|+++|.|+......    +.++....+++|+.|+..+..++...     ..+.+.-++|.+||.+-+-     +.   
T Consensus        83 ~iDiLVnNAG~~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~lp~-----M~~~~~G~IinisS~ag~~-----~~---  149 (241)
T PRK07454         83 CPSVLINNAGAAYTGPLLEMPLSDWQWVIQLNLTSVFQCCSAVLPG-----MRARGGGLIINVSSHAARN-----AF---  149 (241)
T ss_pred             CCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEEEECHHHCC-----CC---
T ss_conf             9889998898899999266999999999999869999999999999-----9973998999983565447-----78---


Q ss_pred             CCCCCCCCCCCCCCCCEEEECCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222223332210000001233---3222222222222233322222222222222222222222222233221133
Q gi|254780920|r  149 MPYNPSSPYSATKASSDYLVLAWGH---TYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLY  225 (358)
Q Consensus       149 ~~~~p~s~Yg~sK~~~E~~~~~~~~---~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~  225 (358)
                         .....|+.||.+...+.+..+.   .+|+++..+.|+.|--|-.          ..    +.+.  .+ -.+..++.
T Consensus       150 ---~~~~~Y~aSK~al~~lt~~la~E~~~~gIrVn~V~PG~v~T~m~----------~~----~~~~--~~-~~~~~~l~  209 (241)
T PRK07454        150 ---PQWGAYCVSKAALAAFTKCLAEEERSHGIRVCTLTLGAVNTPLW----------DS----ETVQ--AD-FDRSAMLS  209 (241)
T ss_pred             ---CCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCC----------CC----CCCC--CC-CCCCCCCC
T ss_conf             ---99757999999999999999998384593899997388988988----------86----3333--55-45568999


Q ss_pred             CCCCCCCEEECCCCCCC
Q ss_conf             22220000000122222
Q gi|254780920|r  226 VEDHVRALYLVLKKGRI  242 (358)
Q Consensus       226 v~D~a~~i~~~~~~~~~  242 (358)
                      .+|+|++++.++..+..
T Consensus       210 PedVA~~v~flas~p~~  226 (241)
T PRK07454        210 PEQVAQTILYLAQLPPS  226 (241)
T ss_pred             HHHHHHHHHHHHCCCCC
T ss_conf             99999999999769985


No 64 
>PRK06482 short chain dehydrogenase; Provisional
Probab=99.55  E-value=1.3e-14  Score=108.68  Aligned_cols=166  Identities=19%  Similarity=0.231  Sum_probs=118.5

Q ss_pred             CE--EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH--CCCCEEEEECCCCCHHHHHHHHHH----C
Q ss_conf             94--899767882779999999986898799994788765856777620--379749997638899999999862----2
Q gi|254780920|r    1 MR--LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS--QSNLFSFLQVDICDRECIRSALKE----F   72 (358)
Q Consensus         1 Mk--ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~--~~~~v~~i~~Di~d~~~l~~~~~~----~   72 (358)
                      |+  +||||+++=||..+++.|+++ |++|++..|.     ...+.++.  ..+++..+++|++|.+.++++++.    +
T Consensus         1 M~Kv~lITGaSsGiG~ala~~l~~~-G~~Vi~t~R~-----~~~l~~l~~~~~~~~~~~~~Dvt~~~~v~~~v~~~~~~~   74 (276)
T PRK06482          1 MTKTWFITGASSGFGRGLTERLLAR-GDRVAATVRR-----PDALDDLKARYGERLWVLQLDVTDTAAVRAVVDRAFAEL   74 (276)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHC-CCEEEEEECC-----HHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHC
T ss_conf             9978999158659999999999988-9989999789-----899999998669957999953799999999999999980


Q ss_pred             -CCCEEEEECCCCCCCCC----CCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCC
Q ss_conf             -78717851234332222----2222222222222220247888651232211247842786305543112222222222
Q gi|254780920|r   73 -QPDAIVNFAAESHVDRS----ILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSE  147 (358)
Q Consensus        73 -~~d~ViHlAa~~~~~~~----~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E  147 (358)
                       ++|++++.|++......    ..+....+++|+.|+.++..++.-.     ..+.+.-++|.+||..-+..        
T Consensus        75 G~iDvLVNNAG~~~~g~~ee~~~~~~~~~~~vN~~g~~~~~ra~lP~-----mr~~~~G~IinisS~~g~~~--------  141 (276)
T PRK06482         75 GRIDVVVSNAGYGLFGAAEELSDAQIRRQIDTNLTGSIQVIRAALPH-----LRRQGGGRIVQVSSEGGQIA--------  141 (276)
T ss_pred             CCCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHCHH-----HHHCCCCEEEEECCHHHCCC--------
T ss_conf             99878874687778887676775779999887417799999985735-----57558977999545243468--------


Q ss_pred             CCCCCCCCCCCCCCCCCEEEECCCCC---CCCCCCCCCCCCCCC
Q ss_conf             22222222223332210000001233---322222222222223
Q gi|254780920|r  148 DMPYNPSSPYSATKASSDYLVLAWGH---TYGIPVLLSNCSNNY  188 (358)
Q Consensus       148 ~~~~~p~s~Yg~sK~~~E~~~~~~~~---~~~l~~~ilR~~~vy  188 (358)
                         .-..+.|+.||.+.|-+.+..+.   .+|++++++-|+.+-
T Consensus       142 ---~p~~~~Y~AsK~Al~g~tesLa~El~~~gI~V~~V~PG~~~  182 (276)
T PRK06482        142 ---YPGFSLYHASKWGIEGFVESVRQEVAPFGIGFTIVEPGPTR  182 (276)
T ss_pred             ---CCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCC
T ss_conf             ---99976899999999999999999844319389999718985


No 65 
>PRK07774 short chain dehydrogenase; Provisional
Probab=99.55  E-value=5.8e-15  Score=110.78  Aligned_cols=220  Identities=21%  Similarity=0.171  Sum_probs=144.4

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH-CCCCEEEEECCCCCHHHHHHHHHH-----CCCC
Q ss_conf             4899767882779999999986898799994788765856777620-379749997638899999999862-----2787
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS-QSNLFSFLQVDICDRECIRSALKE-----FQPD   75 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~-~~~~v~~i~~Di~d~~~l~~~~~~-----~~~d   75 (358)
                      .+|||||++-||+.+++.|++. |.+|+..|+.. .......+++. ...+..++++|++|++.++++++.     .++|
T Consensus         8 ~alVTGgs~GiG~aia~~la~~-Ga~V~i~~~~~-~~~~~~~~~i~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~fG~iD   85 (250)
T PRK07774          8 VAIVTGAAGGIGQAYAEALARE-GASVVVADINA-EGAERVAKQIVADGGTAIAVQVDVSDPDSAKAMADRTVSAFGGID   85 (250)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCH-HHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             8999797688999999999986-99999997988-999999999985598499998258999999999999999839998


Q ss_pred             EEEEECCCCCC-------CCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCC
Q ss_conf             17851234332-------22222222222222222202478886512322112478427863055431122222222222
Q gi|254780920|r   76 AIVNFAAESHV-------DRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSED  148 (358)
Q Consensus        76 ~ViHlAa~~~~-------~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~  148 (358)
                      +++|.|+....       ..+.++....+++|+.|+..+..++...     ..+.+.-++|..||...+           
T Consensus        86 ilVNnAg~~~~~~~~~~~~~~~~~w~~~~~vNl~~~f~~~~~~~~~-----m~~~~~G~IIn~sS~~~~-----------  149 (250)
T PRK07774         86 YLVNNAAIYGGMKLDLLITVPWDYYKKFMSVNLDGALVCTRAVYKH-----MAKRGGGAIVNQSSTAAW-----------  149 (250)
T ss_pred             EEEECCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEEECCCCCC-----------
T ss_conf             9998884357899974212999999999999889999999999999-----998299589997750045-----------


Q ss_pred             CCCCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222222233322100000012333---2222222222222333222222222-2222222222222222223322113
Q gi|254780920|r  149 MPYNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIP-LAITRMIEGSHVFLYGDGQNVRDWL  224 (358)
Q Consensus       149 ~~~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~-~~i~~~~~g~~~~i~g~g~~~Rdfi  224 (358)
                         .|..+|+.||.+.+.+.+..+.+   +|+++-++-|+.+--+...  ...+ .+...+...-|+         +-+.
T Consensus       150 ---~~~~~Y~asKaal~~ltk~lA~el~~~gIrVN~V~PG~i~t~~~~--~~~~~~~~~~~~~~~Pl---------~R~g  215 (250)
T PRK07774        150 ---LYSNFYGLAKVGINGLTQQLARELGGMNIRVNAIAPGPIDTEATR--TVTPKEFVADMVKGIPL---------SRMG  215 (250)
T ss_pred             ---CCCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCC--CCCCHHHHHHHHHCCCC---------CCCC
T ss_conf             ---785389999999999999999997064948999973878772200--14979999999857998---------8985


Q ss_pred             CCCCCCCCEEECCCC---CCCCCCCCCCCCCC
Q ss_conf             322220000000122---22222111357864
Q gi|254780920|r  225 YVEDHVRALYLVLKK---GRIGERYNIGGNNE  253 (358)
Q Consensus       225 ~v~D~a~~i~~~~~~---~~~~~~fNigs~~~  253 (358)
                      ..+|++.++..++..   ...|+++++.+|..
T Consensus       216 ~pedia~~v~fL~S~~s~~iTGq~i~VDGG~~  247 (250)
T PRK07774        216 TPEDLVGMCLFLLSDAASWITGQIFNVDGGQI  247 (250)
T ss_pred             CHHHHHHHHHHHHCCHHCCCCCCEEEECCCCC
T ss_conf             99999999999948242686498399788812


No 66 
>PRK09730 hypothetical protein; Provisional
Probab=99.55  E-value=5.3e-15  Score=111.03  Aligned_cols=228  Identities=20%  Similarity=0.188  Sum_probs=142.6

Q ss_pred             CEE-EEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH-CCCCEEEEECCCCCHHHHHHHHHHC-----C
Q ss_conf             948-99767882779999999986898799994788765856777620-3797499976388999999998622-----7
Q gi|254780920|r    1 MRL-IVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS-QSNLFSFLQVDICDRECIRSALKEF-----Q   73 (358)
Q Consensus         1 MkI-LItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~-~~~~v~~i~~Di~d~~~l~~~~~~~-----~   73 (358)
                      ||| |||||++=||..+++.|+++ |++|+..++.....-..-...+. ...+..++++|++|.+.+++++...     +
T Consensus         1 mKValITGas~GIG~aia~~la~~-Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~~~~i~~~~g~   79 (247)
T PRK09730          1 MAIALVTGGSRGIGRATALLLAQE-GYTVAVNYQQNLHAAQEVVNLITQAGGKAFVLQADISDENQVVAMFTAIDQHDEP   79 (247)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHC-CCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCC
T ss_conf             979999062269999999999987-9999996699878999999999974992899982589999999999999997599


Q ss_pred             CCEEEEECCCCCCCC-----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCC-CCCCCCCCCCC
Q ss_conf             871785123433222-----222222222222222202478886512322112478427863055431-12222222222
Q gi|254780920|r   74 PDAIVNFAAESHVDR-----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEV-YGSLDKGLFSE  147 (358)
Q Consensus        74 ~d~ViHlAa~~~~~~-----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~v-Yg~~~~~~~~E  147 (358)
                      +|+++|.|+......     +.++....+++|+.|+..+..++......  ......-++|.+||... .|.+       
T Consensus        80 id~LVNNAG~~~~~~~~~~~~~e~~~~~~~vNl~g~f~~~~~~~~~m~~--~~~~~~g~IVnisS~~~~~g~~-------  150 (247)
T PRK09730         80 LAALVNNAGILFTQCTVENLTAERINRVLSTNVTGYFLCCREAVKRMAL--KNGGSGGAIVNVSSVASRLGSP-------  150 (247)
T ss_pred             CEEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HCCCCCCEEEEEEEHHHCCCCC-------
T ss_conf             5599989863568998133999999999999738999999999999999--6289997699981265465898-------


Q ss_pred             CCCCCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222222233322100000012333---22222222222223332222222222222222222222222223322113
Q gi|254780920|r  148 DMPYNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWL  224 (358)
Q Consensus       148 ~~~~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi  224 (358)
                          ....+|+.||.+.+.+.+.++.+   +++++-.+-|+.+..+..... .-+....++...-|+.-         +.
T Consensus       151 ----~~~~~Y~asKaav~~ltk~lA~ela~~gIrVN~IaPG~i~T~~~~~~-~~~~~~~~~~~~~Pl~R---------~g  216 (247)
T PRK09730        151 ----GEYVDYAASKGAIDTLTTGLSLEVAAQGIRVNCVRPGFIYTEMHASG-GEPGRVDRVKSNIPMQR---------GG  216 (247)
T ss_pred             ----CCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCC-CCHHHHHHHHHCCCCCC---------CC
T ss_conf             ----41277799999999999999999705492899997788978543234-99699999985799899---------84


Q ss_pred             CCCCCCCCEEECCCC---CCCCCCCCCCCCC
Q ss_conf             322220000000122---2222211135786
Q gi|254780920|r  225 YVEDHVRALYLVLKK---GRIGERYNIGGNN  252 (358)
Q Consensus       225 ~v~D~a~~i~~~~~~---~~~~~~fNigs~~  252 (358)
                      ..+|++.++..++..   ...|+++.+.+|+
T Consensus       217 ~pedia~~v~fL~Sd~a~~iTGq~i~VDGG~  247 (247)
T PRK09730        217 QAEEVAQAIVWLLSDKASYVTGSFIDLAGGK  247 (247)
T ss_pred             CHHHHHHHHHHHHCCHHCCCCCCEEEECCCC
T ss_conf             9999999999996872248348347857999


No 67 
>PRK09009 C factor cell-cell signaling protein; Provisional
Probab=99.55  E-value=6.8e-15  Score=110.36  Aligned_cols=215  Identities=19%  Similarity=0.222  Sum_probs=130.8

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC-CCCEEEE
Q ss_conf             948997678827799999999868987999947887658567776203797499976388999999998622-7871785
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEF-QPDAIVN   79 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~-~~d~ViH   79 (358)
                      |+||||||++=||..++++|+++ +.++.+.......      ......+++.++++|++|.+.++++.+.+ ++|+++|
T Consensus         1 mnVLITGas~GIG~aia~~l~~~-~~~~~v~~~~~~~------~~~~~~~~v~~~~~Dvt~~~~i~~~~~~~~~iD~lin   73 (235)
T PRK09009          1 MNILIVGGSGGIGKAMVKQLLET-YPDATVHATYRHH------KPDFRHDNVQWHALDVTDEAEIKQLSEQFTQLDWLIN   73 (235)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHC-CCCEEEEEEECCC------CCCCCCCCEEEEECCCCCHHHHHHHHHHHCCCCEEEE
T ss_conf             97999755639999999999856-9980999973776------5444579838998747999999999987087789997


Q ss_pred             ECCCCCCC-----CCC--CCC---CCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             12343322-----222--222---22222222222024788865123221124784278630554311222222222222
Q gi|254780920|r   80 FAAESHVD-----RSI--LGA---DEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDM  149 (358)
Q Consensus        80 lAa~~~~~-----~~~--~~p---~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~  149 (358)
                      +|+..+..     ...  .++   ...+++|+.|+..+..+....     ..+.+..+++++||..-  ...     . .
T Consensus        74 nAGi~~~~~~~~~~~~~~~~~~~~~~~~~vN~~~~~~~~~~~~p~-----l~~~~~~~iv~isS~~g--~i~-----~-~  140 (235)
T PRK09009         74 CVGMLHTQDKGPEKSLQSLDSDFFLQNITLNTLPSLLLAKHFTPL-----LKQSESARFAVISAKVG--SIS-----D-N  140 (235)
T ss_pred             CCCCCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHHCCCCCCEEEEEEC--CCC-----C-C
T ss_conf             675244677776468677899999999988619999999999999-----98607876401222341--577-----8-8


Q ss_pred             CCCCCCCCCCCCCCCEEEECCCCCCC-----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222222333221000000123332-----2222222222223332222222222222222222222222223322113
Q gi|254780920|r  150 PYNPSSPYSATKASSDYLVLAWGHTY-----GIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWL  224 (358)
Q Consensus       150 ~~~p~s~Yg~sK~~~E~~~~~~~~~~-----~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi  224 (358)
                      +..+...|+.||.+...+++..+.++     ++.+..+.|+.|--|          +-.....+.|.       .  -+.
T Consensus       141 ~~~g~~~Y~aSKaAl~~lt~~la~E~~~~~~~i~V~~i~PG~v~T~----------m~~~~~~~~p~-------~--r~~  201 (235)
T PRK09009        141 RLGGWYSYRASKAALNMFLKTLSIEWQRSLKHGVVLALHPGTTDTP----------LSKPFQQNVPK-------G--KLF  201 (235)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCC----------CCCHHHHCCCC-------C--CCC
T ss_conf             8886236699999999999999999764269968999814865671----------23067857998-------8--882


Q ss_pred             CCCCCCCCEEECCCC---CCCCCCCCCCCCCCCC
Q ss_conf             322220000000122---2222211135786420
Q gi|254780920|r  225 YVEDHVRALYLVLKK---GRIGERYNIGGNNERK  255 (358)
Q Consensus       225 ~v~D~a~~i~~~~~~---~~~~~~fNigs~~~~s  255 (358)
                      ..+|+|++++.++..   ...|..+++. |.+++
T Consensus       202 ~PeeiA~~i~~L~s~~s~~~tG~~i~vd-G~~~p  234 (235)
T PRK09009        202 TPEYVAQCLLGIIANATPAQSGSFLAYD-GEELP  234 (235)
T ss_pred             CHHHHHHHHHHHHCCCCCCCCCCEEEEC-CCCCC
T ss_conf             9999999999997169723698889789-77876


No 68 
>PRK05875 short chain dehydrogenase; Provisional
Probab=99.54  E-value=2.9e-15  Score=112.64  Aligned_cols=225  Identities=16%  Similarity=0.114  Sum_probs=145.0

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCC--HHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHH-----CCC
Q ss_conf             8997678827799999999868987999947887658--5677762-0379749997638899999999862-----278
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGN--LNSLKEI-SQSNLFSFLQVDICDRECIRSALKE-----FQP   74 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~--~~~~~~~-~~~~~v~~i~~Di~d~~~l~~~~~~-----~~~   74 (358)
                      +|||||++=||+.+++.|+++ |.+|+..++......  .+.+... .....+.++.+|+++++.++++++.     .++
T Consensus        10 alVTGas~GIG~aiA~~la~~-Ga~Vii~~r~~~~l~~~~~~l~~~~~~~~~v~~~~~Dvs~~~~v~~~v~~~~~~~g~i   88 (277)
T PRK05875         10 YLVTGGGSGIGKGVAAALVAA-GAAVMIVGRNPDKLAAAAEEIEALAGGAGAVRYEPADVTNEDEVARAVDAATAWHGRL   88 (277)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHHHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCC
T ss_conf             999488749999999999987-9989999798899999999999612788628999578999999999999999984995


Q ss_pred             CEEEEECCCCCC--C---CCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             717851234332--2---22222222222222222024788865123221124784278630554311222222222222
Q gi|254780920|r   75 DAIVNFAAESHV--D---RSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDM  149 (358)
Q Consensus        75 d~ViHlAa~~~~--~---~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~  149 (358)
                      |.++|+|+....  +   .+.++....+++|+.|+..+..++...     ..+.+.-+||.+||.....           
T Consensus        89 D~LVnnAg~~~~~~~~~~~~~e~w~~~~~iNl~g~~~~~~~~~~~-----m~~~~~GsIVnisS~~~~~-----------  152 (277)
T PRK05875         89 HGVVHCAGGSETIGPITQIDSEAWRRTVDLNVNGTMYVLKHAARE-----LVRGGGGSFVGISSIASSN-----------  152 (277)
T ss_pred             EEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEEEEEHHHCC-----------
T ss_conf             399987813678797255999999999999738899999999999-----9874897241475304336-----------


Q ss_pred             CCCCCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222222333221000000123332---222222222222333222222222222222222222222222332211332
Q gi|254780920|r  150 PYNPSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYV  226 (358)
Q Consensus       150 ~~~p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v  226 (358)
                      +......|+.+|.+.+.+.+..+.++   ++++-.+-|+.+.-|....-.--+.+.....+.-|+.-         +...
T Consensus       153 ~~~~~~~Y~asKaal~~ltk~lA~Ela~~gIrVNaV~PG~i~T~~~~~~~~~~~~~~~~~~~~Pl~R---------~g~p  223 (277)
T PRK05875        153 THRWFGAYGVSKAAVDHLMKLAADELGPSWVRVNSIRPGLIRTDLVAPITESPEVSADYAACTPLPR---------VGEV  223 (277)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCHHHHHCCCCHHHHHHHHHCCCCCC---------CCCH
T ss_conf             7875166799999999999999999710696999986388986535421479999999995799999---------8689


Q ss_pred             CCCCCCEEECCCC---CCCCCCCCCCCCCC
Q ss_conf             2220000000122---22222111357864
Q gi|254780920|r  227 EDHVRALYLVLKK---GRIGERYNIGGNNE  253 (358)
Q Consensus       227 ~D~a~~i~~~~~~---~~~~~~fNigs~~~  253 (358)
                      +|+|.++..++..   ...|+++.|.+|..
T Consensus       224 ediA~~v~FL~Sd~s~~iTGq~i~VDGG~~  253 (277)
T PRK05875        224 EDIANLAMFLLSDAASWITGQVINVDGGHM  253 (277)
T ss_pred             HHHHHHHHHHHCCHHCCCCCCEEEECCCHH
T ss_conf             999999999958831686588179980566


No 69 
>PRK08340 glucose-1-dehydrogenase; Provisional
Probab=99.54  E-value=1.3e-14  Score=108.60  Aligned_cols=229  Identities=18%  Similarity=0.129  Sum_probs=141.8

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH-----CCCC
Q ss_conf             94899767882779999999986898799994788765856777620379749997638899999999862-----2787
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKE-----FQPD   75 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~-----~~~d   75 (358)
                      ||||||||++=||+.+++.|+++ |++|+..|+..... ..-.+++....++.++++|++|.++++++++.     .++|
T Consensus         1 mnVlITGas~GIG~aiA~~la~~-Ga~V~i~~r~~~~l-~~~~~~l~~~g~~~~~~~Dv~~~~~v~~~v~~~~~~~G~iD   78 (259)
T PRK08340          1 MNVLVTASSRGIGFNVARELLKK-GARVVISSRNEENL-EKALKELKELGEVYAIKADLSDKDDLKNLVKEAWELLGGID   78 (259)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHHH-HHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCC
T ss_conf             98999758778999999999987-99999997998999-99999987418879999636998999999999999859988


Q ss_pred             EEEEECCCCCCCC------CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             1785123433222------2222222222222222024788865123221124784278630554311222222222222
Q gi|254780920|r   76 AIVNFAAESHVDR------SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDM  149 (358)
Q Consensus        76 ~ViHlAa~~~~~~------~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~  149 (358)
                      +++|.|+......      ..++....+..|+.+...+...+...    .....+.-++|++||.....           
T Consensus        79 ~LVnNAg~~~~~p~~~~~~~~~~~~~~~~~n~~~~~~~~~~~~~~----~~~~~~~G~Ii~isS~~~~~-----------  143 (259)
T PRK08340         79 ALVWNAGNVKCEPCMLHEAGYSDWLEAALLHLVAPGYLTTLLLQT----WLEKKMKGVLVYLSSVSVKE-----------  143 (259)
T ss_pred             EEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHCCCCEEEEEEEHEEEC-----------
T ss_conf             899857667789743354999999999998715599999999999----99865886499972121025-----------


Q ss_pred             CCCCCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCC--CC------CCC--CCCCCCCCCCCCCCCC
Q ss_conf             22222222333221000000123332---22222222222233322222--22------222--2222222222222222
Q gi|254780920|r  150 PYNPSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPE--KL------IPL--AITRMIEGSHVFLYGD  216 (358)
Q Consensus       150 ~~~p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~--~~------i~~--~i~~~~~g~~~~i~g~  216 (358)
                      +..+...|+.+|.+.+.+.+..+.++   |+++-.+-|+.+--|+-...  ..      .+.  +-+.+...-|      
T Consensus       144 ~~~~~~~y~asKaal~~ltk~lA~e~~~~gIrvN~v~pG~i~tp~~~~~~~~~~~~~~~~~~e~~~~~~~~~~P------  217 (259)
T PRK08340        144 PMPPLLLADVTRAGLVQLAKGVSRTYGGRGIRAYTVLLGSFDTPGARENLARIAEERGVSPEETWEKEVLERTP------  217 (259)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHCCC------
T ss_conf             57862689998899999999999998422919999854889896367789999987289978999999970899------


Q ss_pred             CCCCCCCCCCCCCCCCEEECCC-C--CCCCCCCCCCCCCCCC
Q ss_conf             2332211332222000000012-2--2222211135786420
Q gi|254780920|r  217 GQNVRDWLYVEDHVRALYLVLK-K--GRIGERYNIGGNNERK  255 (358)
Q Consensus       217 g~~~Rdfi~v~D~a~~i~~~~~-~--~~~~~~fNigs~~~~s  255 (358)
                         .+-+...+|++.++..++. .  ...|+.+.+.+|-+.+
T Consensus       218 ---l~R~g~pediA~~v~fL~Sd~a~~iTG~~i~VDGG~t~g  256 (259)
T PRK08340        218 ---LHRTGRWEELGSLIAFLLSENAEYMLGSTIVFDGAMTRG  256 (259)
T ss_pred             ---CCCCCCHHHHHHHHHHHHCCHHCCCCCCEEEECCCCCCC
T ss_conf             ---999859999999999995864268218238999651258


No 70 
>PRK09135 pteridine reductase; Provisional
Probab=99.54  E-value=7.7e-15  Score=110.01  Aligned_cols=225  Identities=20%  Similarity=0.171  Sum_probs=140.8

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH--CCCCEEEEECCCCCHHHHHHHHHHC-----CCC
Q ss_conf             899767882779999999986898799994788765856777620--3797499976388999999998622-----787
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS--QSNLFSFLQVDICDRECIRSALKEF-----QPD   75 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~--~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d   75 (358)
                      +|||||++-||..+++.|+++ |++|+...+.+...-..-..++.  ....+.++++|++|.+.++++++..     ++|
T Consensus         9 alVTGas~GIG~aia~~la~~-Ga~Vvi~~~~~~~~~~~~~~~l~~~~~~~~~~~~~Dv~~~~~v~~~~~~~~~~~G~iD   87 (249)
T PRK09135          9 ALITGGARRIGAAIARTLHAA-GYRVAVHYHRSAAEADALAAELNRLRPGSAAALQADLLDPDALEQLVAAAVAAFGRLD   87 (249)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCC
T ss_conf             999688758999999999987-9989998189879999999999850598189998169999999999999999839998


Q ss_pred             EEEEECCCCCCC----CCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             178512343322----2222222222222222202478886512322112478427863055431122222222222222
Q gi|254780920|r   76 AIVNFAAESHVD----RSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPY  151 (358)
Q Consensus        76 ~ViHlAa~~~~~----~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~  151 (358)
                      +++|.|+.....    .+.++....+++|+.|+..+..++....      +...-++|.+||...+.           +.
T Consensus        88 iLVNNAg~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~~~m------~~~~G~IInisS~~~~~-----------~~  150 (249)
T PRK09135         88 ALVNNASSFYPTPLGEITEAQWDDLFASNAKAPFFLSQAAAPQL------RKQRGAIVNITDIHAER-----------PL  150 (249)
T ss_pred             EEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH------HHCCCCEEEEEECCCCC-----------CC
T ss_conf             99989988999981559999999999983399999999999998------74788789998712277-----------88


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222223332210000001233322--22222222222333222222222222222222222222222332211332222
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGHTYG--IPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDH  229 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~~~~--l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~  229 (358)
                      .....|+.||.+...+.+..+.+++  +++-.+-|+.+.-|... ...-........+.-|+.         -+...+|+
T Consensus       151 ~~~~~Y~asKaal~~ltr~lA~ela~~IrVNaVaPG~i~t~~~~-~~~~~~~~~~~~~~~Pl~---------R~g~pedi  220 (249)
T PRK09135        151 KNYPVYCAAKAALEMLTRSLALELAPEVRVNAVAPGAILWPEND-QGLDAEARQAILARTPLK---------RIGTPEDI  220 (249)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCC-CCCCHHHHHHHHHCCCCC---------CCCCHHHH
T ss_conf             98567899999999999999999779988999930773677633-449999999998579999---------98199999


Q ss_pred             CCCEEECCCC--CCCCCCCCCCCCCCCC
Q ss_conf             0000000122--2222211135786420
Q gi|254780920|r  230 VRALYLVLKK--GRIGERYNIGGNNERK  255 (358)
Q Consensus       230 a~~i~~~~~~--~~~~~~fNigs~~~~s  255 (358)
                      |.++..++..  ...|+++.+.+|.+.|
T Consensus       221 A~~v~fLasdasyiTGq~i~VDGG~slt  248 (249)
T PRK09135        221 AEAVLFLLEDASFITGQILAVDGGRSLT  248 (249)
T ss_pred             HHHHHHHHCCCCCCCCCEEEECCCCCCC
T ss_conf             9999999656787429848859894576


No 71 
>PRK08339 short chain dehydrogenase; Provisional
Probab=99.54  E-value=6.8e-15  Score=110.36  Aligned_cols=226  Identities=14%  Similarity=0.070  Sum_probs=148.6

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHH-HHHH--CCCCEEEEECCCCCHHHHHHHHHH----CCCC
Q ss_conf             89976788277999999998689879999478876585677-7620--379749997638899999999862----2787
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSL-KEIS--QSNLFSFLQVDICDRECIRSALKE----FQPD   75 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~-~~~~--~~~~v~~i~~Di~d~~~l~~~~~~----~~~d   75 (358)
                      +|||||++=||..+++.|+++ |++|+..++...  ..... ..+.  ....+.++.+|+++.+.++++++.    ..+|
T Consensus        11 alITG~s~GIG~aiA~~la~~-Ga~V~i~~r~~~--~l~~~~~~l~~~~~~~~~~~~~D~~~~~~v~~~~~~~~~~g~~d   87 (263)
T PRK08339         11 AFTTASSKGIGFGVARVLARA-GADVIILSRNEE--NLKRAKEKIKSESDVEVHYIVADLTKREDLERTVKELKNIGDPD   87 (263)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHH--HHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             999162609999999999986-999999979889--99999999985049857999848999999999999999569998


Q ss_pred             EEEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             1785123433222----222222222222222202478886512322112478427863055431122222222222222
Q gi|254780920|r   76 AIVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPY  151 (358)
Q Consensus        76 ~ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~  151 (358)
                      +++|.|+.+.+..    +.++....+++|+.|+.++..++...     ..+.+.-++|++||.+....           .
T Consensus        88 ilv~nag~~~~~~~~~~~~e~w~~~~~vnl~~~~~~~~~~~p~-----m~~~~~G~II~isS~a~~~~-----------~  151 (263)
T PRK08339         88 IFFFSTGGPKPGYFMEMSMEDWEEAVKLLLYPAVYLTRALVPG-----MERKGFGRIIYSTSVAIKEP-----------I  151 (263)
T ss_pred             EEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEEECCHHHCCC-----------C
T ss_conf             9998999999989155999999999999869999999999876-----52438963999554243478-----------9


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCC---C------CCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222233322100000012333---22222222222223332222---2------222222222222222222222233
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFP---E------KLIPLAITRMIEGSHVFLYGDGQN  219 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~---~------~~i~~~i~~~~~g~~~~i~g~g~~  219 (358)
                      .....|+.+|.+.+.+.+..+.+   +|+++-.+.|+.+..|....   +      .-+...+.+..+.-|+        
T Consensus       152 ~~~~~y~asKaal~~ltk~lA~ela~~gIrVN~V~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Pl--------  223 (263)
T PRK08339        152 PNIALSNVVRIAMAGLVRTLAKELGPKGITVNGIMPGIIRTDRVIQLAQDRARREGKSVEEALQEYAKPIPL--------  223 (263)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHCCCCC--------
T ss_conf             861778999999999999999997111979999952879872366675657765289889999999707999--------


Q ss_pred             CCCCCCCCCCCCCEEECCCC---CCCCCCCCCCCCCCCCH
Q ss_conf             22113322220000000122---22222111357864202
Q gi|254780920|r  220 VRDWLYVEDHVRALYLVLKK---GRIGERYNIGGNNERKN  256 (358)
Q Consensus       220 ~Rdfi~v~D~a~~i~~~~~~---~~~~~~fNigs~~~~s~  256 (358)
                       +-+...+|+|+++..++..   .-.|+++.+.+|...|+
T Consensus       224 -~R~g~pediA~~v~fL~Sd~a~~itG~~i~VDGG~~~s~  262 (263)
T PRK08339        224 -GRLGEPEEIGYLVAFLASDLGSYINGAMIPVDGGRLNSV  262 (263)
T ss_pred             -CCCCCHHHHHHHHHHHHCCHHCCCCCCEEEECCCCCCCC
T ss_conf             -998599999999999829442681486289889813458


No 72 
>PRK06182 short chain dehydrogenase; Validated
Probab=99.54  E-value=2.1e-14  Score=107.33  Aligned_cols=164  Identities=21%  Similarity=0.214  Sum_probs=117.7

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             8997678827799999999868987999947887658567776203797499976388999999998622-----78717
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEF-----QPDAI   77 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d~V   77 (358)
                      +|||||++=||..++++|+++ |++|++.++.     .+.+..+. ..++..+.+|++|.+.++++++..     ++|++
T Consensus         6 ~lITGassGIG~a~a~~la~~-G~~V~~~~r~-----~~~l~~l~-~~~~~~~~~Dvt~~~~v~~~~~~i~~~~g~iDiL   78 (273)
T PRK06182          6 ALVTGASSGIGKATARKLIAE-GFTVYGAARR-----VDKMEDLA-SLGIHPLALDVTDEASMKAAVATILAEEGRIDVL   78 (273)
T ss_pred             EEEECCCHHHHHHHHHHHHHC-CCEEEEEECC-----HHHHHHHH-HCCCEEEEEECCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             999063209999999999987-9989999798-----99999999-6799799985899999999999999983998877


Q ss_pred             EEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             85123433222----22222222222222220247888651232211247842786305543112222222222222222
Q gi|254780920|r   78 VNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNP  153 (358)
Q Consensus        78 iHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p  153 (358)
                      +|.|+......    +.++-...+++|+.|+.++..++.-.     ..+.+.-++|.+||.+-+-     +.    |  .
T Consensus        79 VNNAG~~~~~~~~~~~~~~~~~~~~vN~~g~~~~~~~~lp~-----m~~~~~G~IvnisS~ag~~-----~~----p--~  142 (273)
T PRK06182         79 VNNAGYGSYGAIEDVPIDEARAQFEVNLFGAARLTQLVLPH-----MRAQRSGRIINITSMGGKI-----YT----P--L  142 (273)
T ss_pred             EECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----HCCCCCCEEEEECCHHHCC-----CC----C--C
T ss_conf             50586777874887319999999998869999999985334-----2148995899986844407-----79----9--9


Q ss_pred             CCCCCCCCCCCEEEECCCCC---CCCCCCCCCCCCCCCC
Q ss_conf             22223332210000001233---3222222222222233
Q gi|254780920|r  154 SSPYSATKASSDYLVLAWGH---TYGIPVLLSNCSNNYG  189 (358)
Q Consensus       154 ~s~Yg~sK~~~E~~~~~~~~---~~~l~~~ilR~~~vyG  189 (358)
                      .+.|+.||.+.+.+.+..+.   .+|+.+.++-|+.|-=
T Consensus       143 ~~~Y~asK~av~~~t~~La~El~~~gI~V~~v~PG~v~T  181 (273)
T PRK06182        143 GAWYHATKFALEGLSDALRLEVAPFGIDVVVIEPGGIKT  181 (273)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHCHHCCEEEEEECCCCCC
T ss_conf             757999999999999999998440387899997389868


No 73 
>PRK12939 short chain dehydrogenase; Provisional
Probab=99.54  E-value=6.4e-15  Score=110.50  Aligned_cols=222  Identities=17%  Similarity=0.158  Sum_probs=142.9

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHH-HHHH-CCCCEEEEECCCCCHHHHHHHHHHC-----CC
Q ss_conf             489976788277999999998689879999478876585677-7620-3797499976388999999998622-----78
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSL-KEIS-QSNLFSFLQVDICDRECIRSALKEF-----QP   74 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~-~~~~-~~~~v~~i~~Di~d~~~l~~~~~~~-----~~   74 (358)
                      .+|||||++=||..+++.|+++ |++|+..++...  ..... +.+. ....+.++++|+++.+.++++++..     ++
T Consensus         9 valVTGgs~GIG~aia~~la~~-Ga~Vvi~~~~~~--~~~~~~~~l~~~g~~~~~~~~Dv~~~~~~~~~~~~~~~~~g~i   85 (250)
T PRK12939          9 RALVTGAARGLGAAFAEALAEA-GATVAFNDGLAA--EARELAAALEAAGGRAHAIAADLADPASVQRFFDAAAAALGGL   85 (250)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHH--HHHHHHHHHHHCCCEEEEEEECCCCHHHHHHHHHHHHHHCCCC
T ss_conf             7999583668999999999987-999999969889--9999999999559909999924899999999999999974999


Q ss_pred             CEEEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             71785123433222----22222222222222220247888651232211247842786305543112222222222222
Q gi|254780920|r   75 DAIVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMP  150 (358)
Q Consensus        75 d~ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~  150 (358)
                      |+++|.|+......    +.++....+++|+.|+..+..++....     .+.+.-++|.+||....-     +      
T Consensus        86 DiLVNNAG~~~~~~~~~~~~e~~~~~~~iNl~~~~~~~k~~~~~m-----~~~~~G~IInisS~~~~~-----~------  149 (250)
T PRK12939         86 DGLVNNAGITNSKSATELDIDTWDAVMNVNVRGTFLMSRAALPHL-----RDSGRGRIVNLASDTALW-----G------  149 (250)
T ss_pred             CEEEECCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHCCCCEEEEECCHHHCC-----C------
T ss_conf             799988778999990349999999999998299999999999999-----984993799980677676-----8------


Q ss_pred             CCCCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222333221000000123332---2222222222223332222222222222222222222222223322113322
Q gi|254780920|r  151 YNPSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVE  227 (358)
Q Consensus       151 ~~p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~  227 (358)
                      ......|+.||.+.+.+.+..+.++   ++++-.+.|+.+--+... ...-+..........|         .+-+...+
T Consensus       150 ~~~~~~Y~asKaal~~ltk~lA~e~a~~~IrvN~V~PG~i~T~~~~-~~~~~e~~~~~~~~~P---------l~R~g~pe  219 (250)
T PRK12939        150 APKLLAYVASKGAVIGMTRSLARELGGRGITVNAIAPGLTATEATA-YVPAEERHAYYLQGRA---------LERLQVPD  219 (250)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCHHHH-CCCCHHHHHHHHHCCC---------CCCCCCHH
T ss_conf             9985889999999999999999996032939998876779870322-5898899999985799---------99980999


Q ss_pred             CCCCCEEECCCC---CCCCCCCCCCCCC
Q ss_conf             220000000122---2222211135786
Q gi|254780920|r  228 DHVRALYLVLKK---GRIGERYNIGGNN  252 (358)
Q Consensus       228 D~a~~i~~~~~~---~~~~~~fNigs~~  252 (358)
                      |++.++..++..   ...|+++++.+|-
T Consensus       220 dia~~v~fL~S~~s~~itG~~i~VDGG~  247 (250)
T PRK12939        220 DVAGAVLFLLSDAARFVTGQLLPVNGGF  247 (250)
T ss_pred             HHHHHHHHHHCCHHCCCCCCEEEECCCH
T ss_conf             9999999994816469058828979584


No 74 
>PRK09242 tropinone reductase; Provisional
Probab=99.53  E-value=8.5e-15  Score=109.75  Aligned_cols=222  Identities=19%  Similarity=0.121  Sum_probs=143.2

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCC--HHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH----C-CC
Q ss_conf             48997678827799999999868987999947887658--56777620379749997638899999999862----2-78
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGN--LNSLKEISQSNLFSFLQVDICDRECIRSALKE----F-QP   74 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~--~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~----~-~~   74 (358)
                      ++|||||++=||..+++.|+++ |++|+..++......  ...+........+.++++|++|.+.+++++..    + ++
T Consensus        12 ~alITGgs~GIG~a~a~~la~~-Ga~V~~~~r~~~~~~~~~~~l~~~~~~~~~~~~~~Dv~~~~~~~~~~~~~~~~~g~i   90 (258)
T PRK09242         12 TALITGASKGIGLAIARELLGL-GADVLIVARDADALAQARDELAEEFPERELHGLAADVSDDEDRRAILDWVEDHWDGL   90 (258)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHHHHHHHHHHHHHCCCCEEEEEEEECCCHHHHHHHHHHHHHHCCCC
T ss_conf             9999484868999999999987-998999969889999999999864479729999930799999999999999974999


Q ss_pred             CEEEEECCCCCCC----CCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             7178512343322----222222222222222220247888651232211247842786305543112222222222222
Q gi|254780920|r   75 DAIVNFAAESHVD----RSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMP  150 (358)
Q Consensus        75 d~ViHlAa~~~~~----~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~  150 (358)
                      |+.+|.|+.....    .+.++-...+++|+.|+..+..++....     .+.+.-++|.+||..-..           +
T Consensus        91 DiLVnnAG~~~~~~~~~~s~~~w~~~~~vNl~~~~~l~~~~~p~m-----~~~~~G~IInisS~~~~~-----------~  154 (258)
T PRK09242         91 HILVNNAGGNITKAAIDYTEDEWRGIFETNLFSAFELSRYAYPLL-----KRHAASSIVNIGSVSGLT-----------H  154 (258)
T ss_pred             CEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHCCCCEEEEEEEHHHCC-----------C
T ss_conf             799989988999980019999999999998199999999999999-----975992799993042116-----------8


Q ss_pred             CCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222233322100000012333---222222222222233322222222--222222222222222222233221133
Q gi|254780920|r  151 YNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLI--PLAITRMIEGSHVFLYGDGQNVRDWLY  225 (358)
Q Consensus       151 ~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i--~~~i~~~~~g~~~~i~g~g~~~Rdfi~  225 (358)
                      .....+|+.+|.+.+.+.+..+.+   +|+++-.+-|+.+-.|...  ..+  +.....+.+.-|+.         -+..
T Consensus       155 ~~~~~~Y~asKaal~~ltr~lA~ela~~gIrVN~V~PG~i~T~~~~--~~~~~~~~~~~~~~~~Pl~---------R~g~  223 (258)
T PRK09242        155 VRSGAPYGMTKAALQQMTRNLAVEWAEDGIRVNAVAPWYIRTRRTS--GPLSDPDYYEQVIERTPMR---------RIGE  223 (258)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEECCCCCHHHH--CCCCCHHHHHHHHHCCCCC---------CCCC
T ss_conf             9875567999999999999999998027989999835889872120--2237999999998579989---------9879


Q ss_pred             CCCCCCCEEECC-CC--CCCCCCCCCCCC
Q ss_conf             222200000001-22--222221113578
Q gi|254780920|r  226 VEDHVRALYLVL-KK--GRIGERYNIGGN  251 (358)
Q Consensus       226 v~D~a~~i~~~~-~~--~~~~~~fNigs~  251 (358)
                      .+|++.++..++ +.  ...|+++.+.+|
T Consensus       224 pediA~~v~fLaSd~s~~iTGq~i~VDGG  252 (258)
T PRK09242        224 PEEVAAAVAFLCLPAASYITGECIAVDGG  252 (258)
T ss_pred             HHHHHHHHHHHHCCHHCCCCCCEEEECCC
T ss_conf             99999999999585324754853898907


No 75 
>PRK08219 short chain dehydrogenase; Provisional
Probab=99.53  E-value=1e-14  Score=109.24  Aligned_cols=204  Identities=15%  Similarity=0.117  Sum_probs=133.0

Q ss_pred             CE-EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC-CCCEEE
Q ss_conf             94-8997678827799999999868987999947887658567776203797499976388999999998622-787178
Q gi|254780920|r    1 MR-LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEF-QPDAIV   78 (358)
Q Consensus         1 Mk-ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~-~~d~Vi   78 (358)
                      || +|||||++=||..++++|+ +.++ |+..++     +...++++........+.+|++|.+.++++++.+ ++|+++
T Consensus         3 mKvalITGas~GIG~aia~~la-~~g~-vv~~~r-----~~~~l~~l~~~~~~~~~~~Dlt~~~~i~~~~~~~~~iD~lV   75 (226)
T PRK08219          3 MPTALITGASRGIGAAIARALA-RTHT-LLLAGR-----PSERLDAVAARLGATTWPADLTDPEAIAAAVEPLDRLDVLV   75 (226)
T ss_pred             CCEEEEECCCHHHHHHHHHHHH-HCCC-EEEEEC-----CHHHHHHHHHHHCCCEEEECCCCHHHHHHHHHHCCCCCEEE
T ss_conf             8999992846499999999999-6998-999989-----88999999997099378605799999999999659988999


Q ss_pred             EECCCCCCCCC----CCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             51234332222----22222222222222202478886512322112478427863055431122222222222222222
Q gi|254780920|r   79 NFAAESHVDRS----ILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPS  154 (358)
Q Consensus        79 HlAa~~~~~~~----~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~  154 (358)
                      |+|+.......    .++-...+++|+.|..++..++...      .+.+.-++|++||.+-+.           +.-..
T Consensus        76 nnAG~~~~~~~~~~~~~~~~~~~~vNl~~~~~l~~~~lp~------m~~~~G~IV~isS~~g~~-----------~~~~~  138 (226)
T PRK08219         76 HNAGVAELGPVAESTVDEWRATLDVNVVAPAELTRLLLPA------LRAARGHVVFINSGAGLN-----------ASPGW  138 (226)
T ss_pred             ECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH------HHHCCCEEEEEECHHHCC-----------CCCCC
T ss_conf             8996899987376999999999998669999999999999------997398499994767648-----------89997


Q ss_pred             CCCCCCCCCCEEEECCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22233322100000012333--2222222222222333222222222222222222222222222332211332222000
Q gi|254780920|r  155 SPYSATKASSDYLVLAWGHT--YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRA  232 (358)
Q Consensus       155 s~Yg~sK~~~E~~~~~~~~~--~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~a~~  232 (358)
                      ++|+.||.+.+.+.+.++.+  .++++..+-|+.|--|          |.+.+.....-..     ...-|+-.+|+|++
T Consensus       139 ~~Y~aSKaAl~~l~~~L~~e~~~~IrVn~I~PG~v~T~----------m~~~~~~~~~~~~-----~~~r~~~PedVA~~  203 (226)
T PRK08219        139 ASYAASKFALRALADALREEEAGNVRVTSVHPGRTATD----------MQRELVAQEGREY-----DPARFLRPETVAAA  203 (226)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCC----------CCHHHHHHHHCCC-----CCCCCCCHHHHHHH
T ss_conf             47999999999999999986699849999970899786----------5355676543037-----87679699999999


Q ss_pred             EEECCCCCCCC
Q ss_conf             00001222222
Q gi|254780920|r  233 LYLVLKKGRIG  243 (358)
Q Consensus       233 i~~~~~~~~~~  243 (358)
                      +..++..+...
T Consensus       204 v~fll~~p~~~  214 (226)
T PRK08219        204 VRFAVDAPRDA  214 (226)
T ss_pred             HHHHHCCCCCC
T ss_conf             99998699875


No 76 
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional
Probab=99.53  E-value=5.3e-15  Score=111.00  Aligned_cols=236  Identities=19%  Similarity=0.196  Sum_probs=142.5

Q ss_pred             CE--EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCC--HHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC----
Q ss_conf             94--8997678827799999999868987999947887658--567776203797499976388999999998622----
Q gi|254780920|r    1 MR--LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGN--LNSLKEISQSNLFSFLQVDICDRECIRSALKEF----   72 (358)
Q Consensus         1 Mk--ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~--~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~----   72 (358)
                      |+  +|||||++=||+.+++.|+++ |++|+..|+......  ...+.......++..+++|++|.++++++++..    
T Consensus         1 mnKvalITG~s~GIG~aia~~la~~-Ga~V~i~~~~~~~~~~~~~~l~~~~~~~~~~~~~~Dv~~~~~v~~~~~~~~~~~   79 (259)
T PRK12384          1 MNKVAVVIGGGQTLGAFLCHGLAEE-GYRVAVADINSEKAANVAQEINAEYGEGMAYGFGADATSEQSVLALSRGVDEIF   79 (259)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             9978999468868999999999987-999999979889999999999862488608999832799999999999999982


Q ss_pred             -CCCEEEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCC
Q ss_conf             -7871785123433222----22222222222222220247888651232211247842786305543112222222222
Q gi|254780920|r   73 -QPDAIVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSE  147 (358)
Q Consensus        73 -~~d~ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E  147 (358)
                       ++|+++|.|+......    +.++....+++|+.|+..+..++.....    .....-++|++||....-         
T Consensus        80 G~iDilVnnAG~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~----~~~~~G~Iv~isS~~~~~---------  146 (259)
T PRK12384         80 GRVDLLVYSAGIAKAAKITDFQLGDFDRSLQVNLVGYFLCAREFSRLMI----RDGIQGRIIQINSKSGKV---------  146 (259)
T ss_pred             CCCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHCCCCEEEEECCHHHCC---------
T ss_conf             9971999899777889914599999999999886442234677636899----738984599983525455---------


Q ss_pred             CCCCCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCC-CCCCCCCCCCC
Q ss_conf             222222222233322100000012333---22222222222223332222222222222222-22222-22222233221
Q gi|254780920|r  148 DMPYNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMI-EGSHV-FLYGDGQNVRD  222 (358)
Q Consensus       148 ~~~~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~-~g~~~-~i~g~g~~~Rd  222 (358)
                        +....+.|+.||.+.+.+.+..+.+   +|+++-.+.|+.+.-.... ..+++.+-.+.- ....+ ..+-+....+-
T Consensus       147 --~~~~~~~Y~asK~al~~ltk~lA~e~a~~gIrVN~I~PG~~~~t~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~Pl~R  223 (259)
T PRK12384        147 --GSKHNSGYSAAKFGGVGLTQSLALDLAEYGITVHSLMLGNLLKSPMF-QSLLPQYAKKLGIKPDEVEQYYIDKVPLKR  223 (259)
T ss_pred             --CCCCCCHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEECCCCCCCHHH-HHHHHHHHHHCCCCHHHHHHHHHHCCCCCC
T ss_conf             --88543067999999999999999996231979999838871567666-665587887729998999999984799899


Q ss_pred             CCCCCCCCCCEEECCCC---CCCCCCCCCCCCCC
Q ss_conf             13322220000000122---22222111357864
Q gi|254780920|r  223 WLYVEDHVRALYLVLKK---GRIGERYNIGGNNE  253 (358)
Q Consensus       223 fi~v~D~a~~i~~~~~~---~~~~~~fNigs~~~  253 (358)
                      +...+|+|+++..++..   ...|+++.+.+|.-
T Consensus       224 ~g~p~diA~~v~fL~S~~a~~iTG~~i~vDGG~~  257 (259)
T PRK12384        224 GCDYQDVLNMLLFYASPKASYCTGQSINVTGGQV  257 (259)
T ss_pred             CCCHHHHHHHHHHHHCCHHCCCCCCEEEECCCHH
T ss_conf             9699999999999958563380387289897833


No 77 
>PRK07024 short chain dehydrogenase; Provisional
Probab=99.53  E-value=3e-14  Score=106.37  Aligned_cols=200  Identities=17%  Similarity=0.140  Sum_probs=131.3

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH----C-CCCE
Q ss_conf             4899767882779999999986898799994788765856777620379749997638899999999862----2-7871
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKE----F-QPDA   76 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~----~-~~d~   76 (358)
                      |||||||+.=||..++++|+++ |++|+.+++...  ....+.......++..+.+|++|.+.+++++++    + .+|+
T Consensus         4 ~VlITGassGIG~a~A~~la~~-G~~v~l~~R~~~--~L~~~~~~~~~~~~~~~~~Dv~d~~~~~~~~~~~~~~~g~iDi   80 (256)
T PRK07024          4 KVFITGASSGIGQALAREYARQ-GATLGLVARRTD--ALQAFAARLPKARVSVYAADVRDADALAAAAADFIAAHGCPDV   80 (256)
T ss_pred             EEEEECCCHHHHHHHHHHHHHC-CCEEEEEECCHH--HHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             8999846029999999999988-998999989889--9999999767997699981179999999999999998399879


Q ss_pred             EEEECCCCCCCCCC--CCC---CCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCC-CCCCCCCCCCCCC
Q ss_conf             78512343322222--222---22222222222024788865123221124784278630554311-2222222222222
Q gi|254780920|r   77 IVNFAAESHVDRSI--LGA---DEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVY-GSLDKGLFSEDMP  150 (358)
Q Consensus        77 ViHlAa~~~~~~~~--~~p---~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vY-g~~~~~~~~E~~~  150 (358)
                      +|+.|+........  .|.   ...+++|+.|..++++.....     ....+.-++|.+||.+-+ |.           
T Consensus        81 linNAGi~~~~~~~~~~d~~~~~~~~~vN~~g~~~~~~~~lp~-----m~~~~~G~Iv~isS~ag~~g~-----------  144 (256)
T PRK07024         81 VIANAGISVGTLTGEGEDLAVFREVMDTNYYGMVATFEPFIAP-----MRAARRGTLVGIASVAGVRGL-----------  144 (256)
T ss_pred             EEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHCCCCCEEEEECCHHHCCCC-----------
T ss_conf             9988855678864453789999999999999999999987687-----502689349984354541689-----------


Q ss_pred             CCCCCCCCCCCCCCEEEECCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222223332210000001233---322222222222223332222222222222222222222222223322113322
Q gi|254780920|r  151 YNPSSPYSATKASSDYLVLAWGH---TYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVE  227 (358)
Q Consensus       151 ~~p~s~Yg~sK~~~E~~~~~~~~---~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~  227 (358)
                       -..+.|+.||.+...+.+..+.   .+|+.++.+.|+.|=-|          |.    .+.+..+.       -.+..+
T Consensus       145 -p~~~~Y~ASKaal~~~~esL~~el~~~gI~V~~i~PG~v~T~----------m~----~~~~~~~p-------~~~~pe  202 (256)
T PRK07024        145 -PGAGAYSASKAAAIKYLESLRVELRPAGVRVVTIAPGYIRTP----------MT----AHNPYPMP-------FLMDAD  202 (256)
T ss_pred             -CCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCC----------CC----CCCCCCCC-------CCCCHH
T ss_conf             -997079999999999999999986577948999971899588----------77----77999998-------768999


Q ss_pred             CCCCCEEECCCCCCC
Q ss_conf             220000000122222
Q gi|254780920|r  228 DHVRALYLVLKKGRI  242 (358)
Q Consensus       228 D~a~~i~~~~~~~~~  242 (358)
                      ++|+.++.++++++.
T Consensus       203 ~vA~~i~~ai~~~~~  217 (256)
T PRK07024        203 RFAARAARAIARGRS  217 (256)
T ss_pred             HHHHHHHHHHHCCCC
T ss_conf             999999999975998


No 78 
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional
Probab=99.53  E-value=9.8e-15  Score=109.38  Aligned_cols=225  Identities=15%  Similarity=0.062  Sum_probs=143.6

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH-CCCCEEEEECCCCCHHHHHHHHHH-----CCCCE
Q ss_conf             899767882779999999986898799994788765856777620-379749997638899999999862-----27871
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS-QSNLFSFLQVDICDRECIRSALKE-----FQPDA   76 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~-~~~~v~~i~~Di~d~~~l~~~~~~-----~~~d~   76 (358)
                      +|||||++=||+.+++.|+++ |++|+..+..+......-.+.+. ...+..++++|++|++.++++++.     .++|+
T Consensus         7 alVTGas~GIG~aia~~la~~-Ga~Vvi~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~G~iDi   85 (250)
T PRK08063          7 ALVTGSSRGIGKAIALRLAKE-GYDIAINYARSRKAAEETANEIEQLGRKALVVKANVGDVEKIKEMFSQIDEHFGRLDV   85 (250)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCE
T ss_conf             999587669999999999988-9989997599989999999999954995899984799999999999999998099889


Q ss_pred             EEEECCCCCCC----CCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             78512343322----22222222222222222024788865123221124784278630554311222222222222222
Q gi|254780920|r   77 IVNFAAESHVD----RSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYN  152 (358)
Q Consensus        77 ViHlAa~~~~~----~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~  152 (358)
                      ++|.|+.....    .+.++....+++|+.|+..+..++...     ..+.+.-++|++||......           ..
T Consensus        86 LVnnAg~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~-----m~~~~~G~IVnisS~~~~~~-----------~~  149 (250)
T PRK08063         86 FVNNAASGVLRPAMELEESHWDWTMNINAKALLFCAQEAAKL-----MEKNGGGKIISLSSLGSIRY-----------LE  149 (250)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCCCEEEEEHHHCCC-----------CC
T ss_conf             998785678899266999999999987403799999999999-----98638986158873310567-----------89


Q ss_pred             CCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222233322100000012333---2222222222222333222222222222222222222222222332211332222
Q gi|254780920|r  153 PSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDH  229 (358)
Q Consensus       153 p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~  229 (358)
                      ....|+.||.+.+.+.+..+.+   +|+++-.+.|+.+-.|......--..+...+...-|+.-         +...+|+
T Consensus       150 ~~~~Y~asKaal~~ltk~lA~ela~~gIrVNaI~PG~i~T~~~~~~~~~~~~~~~~~~~~P~~R---------~g~pedi  220 (250)
T PRK08063        150 NYTTVGVSKAALEALTRYLAVELAPKGIAVNAVSGGAVDTDALKHFPNREELLEDAQANTPAGR---------MVEPEDL  220 (250)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCCCCCHHHHCCCCCHHHHHHHHHCCCCCC---------CCCHHHH
T ss_conf             9604587899999999999999725392899986087987677617984999999986799999---------8699999


Q ss_pred             CCCEEECCCC---CCCCCCCCCCCCCC
Q ss_conf             0000000122---22222111357864
Q gi|254780920|r  230 VRALYLVLKK---GRIGERYNIGGNNE  253 (358)
Q Consensus       230 a~~i~~~~~~---~~~~~~fNigs~~~  253 (358)
                      ++++..++..   ...|+++.+.+|-+
T Consensus       221 a~~v~fL~S~~s~~iTG~~i~VDGG~s  247 (250)
T PRK08063        221 VNAVLFLCSPKADMIRGQTIIVDGGRS  247 (250)
T ss_pred             HHHHHHHHCCHHCCCCCCEEEECCCHH
T ss_conf             999999937453482287088594878


No 79 
>PRK07102 short chain dehydrogenase; Provisional
Probab=99.53  E-value=2.2e-14  Score=107.27  Aligned_cols=201  Identities=16%  Similarity=0.154  Sum_probs=131.2

Q ss_pred             CE-EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHH-HHH--CCCCEEEEECCCCCHHHHHHHHHHC--CC
Q ss_conf             94-899767882779999999986898799994788765856777-620--3797499976388999999998622--78
Q gi|254780920|r    1 MR-LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLK-EIS--QSNLFSFLQVDICDRECIRSALKEF--QP   74 (358)
Q Consensus         1 Mk-ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~-~~~--~~~~v~~i~~Di~d~~~l~~~~~~~--~~   74 (358)
                      || ||||||++=||..++++|.++ |++|+..++...  ...... ++.  ....+..+.+|++|.+.+++++++.  .+
T Consensus         1 MK~vlITGassGIG~a~A~~la~~-G~~v~l~~R~~~--~l~~~~~~l~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~~   77 (243)
T PRK07102          1 MKKILIIGATSDIARACARRYAAA-GARLYLAARDTE--RLERIAADLEARGAVAVATHELDILDTARHAAFLDNLPALP   77 (243)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHHC-CCEEEEEECCHH--HHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHC
T ss_conf             997999157459999999999987-998999989889--99999999985358628998434036999999999987537


Q ss_pred             CEEEEECCCCCCCCC----CCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCC-CCCCCCCCCCCC
Q ss_conf             717851234332222----222222222222222024788865123221124784278630554311-222222222222
Q gi|254780920|r   75 DAIVNFAAESHVDRS----ILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVY-GSLDKGLFSEDM  149 (358)
Q Consensus        75 d~ViHlAa~~~~~~~----~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vY-g~~~~~~~~E~~  149 (358)
                      |.+++.|+.......    .++....+++|+.|+..+..+....     ..+.+.-++|.+||.+-+ |.          
T Consensus        78 d~~v~~aG~~~~~~~~~~~~~~~~~~~~vN~~g~~~l~~~~~~~-----m~~~~~G~Iv~isS~ag~~g~----------  142 (243)
T PRK07102         78 DTVLIAVGTLGDQAACEADPALALREFRTNFEGPIALLTLLANR-----FEARGSGTIVGISSVAGDRGR----------  142 (243)
T ss_pred             CEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHHCCCEEEEEECHHHCCCC----------
T ss_conf             97999730367873023999999999999989999999999999-----887239749998256647789----------


Q ss_pred             CCCCCCCCCCCCCCCEEEECCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222223332210000001233---32222222222222333222222222222222222222222222332211332
Q gi|254780920|r  150 PYNPSSPYSATKASSDYLVLAWGH---TYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYV  226 (358)
Q Consensus       150 ~~~p~s~Yg~sK~~~E~~~~~~~~---~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v  226 (358)
                        .....|+.||.+.+.+.+..+.   .+|+++..+.|+.|--|          +........++           ....
T Consensus       143 --p~~~~Y~aSKaal~~~~~sL~~El~~~gI~V~~v~PG~v~T~----------m~~~~~~~~~~-----------~~~p  199 (243)
T PRK07102        143 --ASNYVYGSAKAALTAFLSGLRNRLFKSGVHVLTVKPGFVDTP----------MTAGLKLPGPL-----------TAQP  199 (243)
T ss_pred             --CCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEECCCCCC----------CCCCCCCCCCC-----------CCCH
T ss_conf             --998269999999999999999985020919999971889675----------66689998877-----------6999


Q ss_pred             CCCCCCEEECCCCCCC
Q ss_conf             2220000000122222
Q gi|254780920|r  227 EDHVRALYLVLKKGRI  242 (358)
Q Consensus       227 ~D~a~~i~~~~~~~~~  242 (358)
                      +++|+.++.++++++.
T Consensus       200 e~vA~~i~~ai~~~k~  215 (243)
T PRK07102        200 EEVAKDIFRAIEKGKD  215 (243)
T ss_pred             HHHHHHHHHHHHCCCC
T ss_conf             9999999999976998


No 80 
>PRK06181 short chain dehydrogenase; Provisional
Probab=99.53  E-value=1.4e-14  Score=108.46  Aligned_cols=211  Identities=17%  Similarity=0.135  Sum_probs=134.9

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHH-HHH-CCCCEEEEECCCCCHHHHHHHHHHC-----CC
Q ss_conf             4899767882779999999986898799994788765856777-620-3797499976388999999998622-----78
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLK-EIS-QSNLFSFLQVDICDRECIRSALKEF-----QP   74 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~-~~~-~~~~v~~i~~Di~d~~~l~~~~~~~-----~~   74 (358)
                      .+|||||+.=||..+++.|.++ |++|+..|+....  .+... ++. ....+..+.+|++|.++++++++..     ++
T Consensus         3 v~lITGassGIG~a~A~~la~~-Ga~vvl~~r~~~~--l~~~~~~l~~~g~~~~~~~~Dvs~~~~~~~~~~~~~~~~G~i   79 (263)
T PRK06181          3 VVIITGASEGIGRALAVRLARA-GARLVLAARNEER--LASLAQELANYGAEALVVATDVSDAEACERLIEAAVAHFGGI   79 (263)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHH--HHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCC
T ss_conf             9999581019999999999987-9989999889999--999999999549967999807999999999999999982996


Q ss_pred             CEEEEECCCCCCCCCC--CCC---CCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             7178512343322222--222---22222222222024788865123221124784278630554311222222222222
Q gi|254780920|r   75 DAIVNFAAESHVDRSI--LGA---DEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDM  149 (358)
Q Consensus        75 d~ViHlAa~~~~~~~~--~~p---~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~  149 (358)
                      |+++|.|+........  .+.   ...+++|+.|+.++..++.-..      +...-++|.+||.+-+-.          
T Consensus        80 DiLVNNAGi~~~~~~~~~~~~~~~~~~~~vN~~g~~~~~~~~lp~m------~~~~G~IvnisS~ag~~~----------  143 (263)
T PRK06181         80 DILVNNAGMTMWSRFDELTDLSVLEDVMRVNYLGAVYCTHAALPHL------KASQGQIVVVSSLAGLTG----------  143 (263)
T ss_pred             CEEEECCCCCCCCCHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHH------HHCCCEEEEEECHHHCCC----------
T ss_conf             4899878567888723268699999999998299999999999998------638937999947555277----------


Q ss_pred             CCCCCCCCCCCCCCCEEEECCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222223332210000001233---32222222222222333222222222222222222222222222332211332
Q gi|254780920|r  150 PYNPSSPYSATKASSDYLVLAWGH---TYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYV  226 (358)
Q Consensus       150 ~~~p~s~Yg~sK~~~E~~~~~~~~---~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v  226 (358)
                       .-..+.|+.||.+..-+.+..+.   .+|+.+..+-|+.|--|-          ..++..+..-.....+......+..
T Consensus       144 -~p~~~~Y~aSK~av~~~t~~la~El~~~gIrVn~v~PG~v~T~~----------~~~~~~~~~~~~~~~~~~~~~~~~p  212 (263)
T PRK06181        144 -VPTRSGYAASKHALHGFFDSLRIELADTGVAVTVVCPGFVATDI----------RKRALDGDGKPLGKSPMQEGKIMSA  212 (263)
T ss_pred             -CCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCC----------CHHHCCCCCCCCCCCCCCCCCCCCH
T ss_conf             -89973599999999999999999847559399999728898974----------7001444555234674435678999


Q ss_pred             CCCCCCEEECCCCCCC
Q ss_conf             2220000000122222
Q gi|254780920|r  227 EDHVRALYLVLKKGRI  242 (358)
Q Consensus       227 ~D~a~~i~~~~~~~~~  242 (358)
                      +++|+.++.++++++.
T Consensus       213 e~vA~~i~~ai~~~k~  228 (263)
T PRK06181        213 EECAEMMLPAIARRKR  228 (263)
T ss_pred             HHHHHHHHHHHHCCCC
T ss_conf             9999999999966997


No 81 
>PRK07035 short chain dehydrogenase; Provisional
Probab=99.52  E-value=1.3e-14  Score=108.69  Aligned_cols=220  Identities=19%  Similarity=0.206  Sum_probs=139.2

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHH-HHH-HCCCCEEEEECCCCCHHHHHHHHHHC-----CC
Q ss_conf             489976788277999999998689879999478876585677-762-03797499976388999999998622-----78
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSL-KEI-SQSNLFSFLQVDICDRECIRSALKEF-----QP   74 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~-~~~-~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~   74 (358)
                      .+|||||++=||+.+++.|+++ |++|+..++...  ..... +++ ....+...+.+|++|.+.++++++..     ++
T Consensus        10 valITGas~GIG~aia~~la~~-Ga~V~i~~r~~~--~l~~~~~~i~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~~G~i   86 (252)
T PRK07035         10 IALVTGASRGIGEAIAKLLAQQ-GAHVIVSSRKLD--GCQAVADAIVAAGGKAEALACHIGEMEQIDALFAQIRERHGRL   86 (252)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHH--HHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC
T ss_conf             8999588749999999999987-998999979889--9999999999649957999824899999999999999982997


Q ss_pred             CEEEEECCCCCC--C---CCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             717851234332--2---22222222222222222024788865123221124784278630554311222222222222
Q gi|254780920|r   75 DAIVNFAAESHV--D---RSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDM  149 (358)
Q Consensus        75 d~ViHlAa~~~~--~---~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~  149 (358)
                      |+++|.|+....  +   .+.++....+++|+.|+..+..++...     ..+.+.-++|++||...+.           
T Consensus        87 DilVnnAg~~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~-----m~~~~~G~IvnisS~~~~~-----------  150 (252)
T PRK07035         87 DILVNNAAANPYFGHILDTDLGAFQKTVDVNIRGYFFMSVEAGKL-----MKEQGGGSIVNVASVNGVS-----------  150 (252)
T ss_pred             CEEEECCCCCCCCCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHH-----HHHCCCCEEEEECCHHHCC-----------
T ss_conf             789876855888888200999999999998712431000453699-----9966997499972544368-----------


Q ss_pred             CCCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222233322100000012333---222222222222233322222222--22222222222222222223322113
Q gi|254780920|r  150 PYNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLI--PLAITRMIEGSHVFLYGDGQNVRDWL  224 (358)
Q Consensus       150 ~~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i--~~~i~~~~~g~~~~i~g~g~~~Rdfi  224 (358)
                      +......|+.+|.+.+.+.+..+.+   +|+++-.+-|+.+-.+...  .+.  +.+.......-|         .+-+.
T Consensus       151 ~~~~~~~Y~asKaal~~ltr~lA~ela~~gIrVN~V~PG~i~T~~~~--~~~~~~~~~~~~~~~~P---------l~R~g  219 (252)
T PRK07035        151 PGDFQGIYSITKAAVISMTKAFAKECAPFGIRVNALLPGLTDTKFAS--ALFKNDAILKQALAHIP---------LRRHA  219 (252)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCHHHH--CCCCCHHHHHHHHHCCC---------CCCCC
T ss_conf             89874889999999999999999986032959999962878874243--02489999999985699---------99982


Q ss_pred             CCCCCCCCEEECCCC---CCCCCCCCCCCC
Q ss_conf             322220000000122---222221113578
Q gi|254780920|r  225 YVEDHVRALYLVLKK---GRIGERYNIGGN  251 (358)
Q Consensus       225 ~v~D~a~~i~~~~~~---~~~~~~fNigs~  251 (358)
                      ..+|+++++..++..   ...|+++.+.+|
T Consensus       220 ~pedia~~v~fL~S~~a~~iTG~~i~VDGG  249 (252)
T PRK07035        220 EPSEMAGAVLYLVSDASSYTTGECLNVDGG  249 (252)
T ss_pred             CHHHHHHHHHHHHCCHHCCCCCCEEEECCC
T ss_conf             999999999999685422936864886949


No 82 
>PRK07060 short chain dehydrogenase; Provisional
Probab=99.52  E-value=1.4e-14  Score=108.52  Aligned_cols=218  Identities=19%  Similarity=0.188  Sum_probs=143.7

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC-CCCEEEEE
Q ss_conf             48997678827799999999868987999947887658567776203797499976388999999998622-78717851
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEF-QPDAIVNF   80 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~-~~d~ViHl   80 (358)
                      ++|||||++=||+.+++.|+++ |++|+..|+.     ...++.+........+++|+++...++++++.+ ++|+++|.
T Consensus        11 ~~lVTG~~~GIG~aia~~la~~-Ga~V~~~~r~-----~~~~~~~~~~~~~~~~~~Dv~~~~~v~~~~~~~g~iDilVnn   84 (245)
T PRK07060         11 SVLVTGASSGIGRACAVALAAR-GARVVAAARN-----QADLDRLAGETGCEPLRLDVGDDAAIRAALAGAGAFDGLVNC   84 (245)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECC-----HHHHHHHHHHHCCEEEEEECCCHHHHHHHHHHCCCCCEEEEC
T ss_conf             8999477768999999999987-9999999799-----899999998639879998079999999999965999899989


Q ss_pred             CCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCC-CCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             23433222----2222222222222222024788865123221124-784278630554311222222222222222222
Q gi|254780920|r   81 AAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDK-KDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSS  155 (358)
Q Consensus        81 Aa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~-~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~s  155 (358)
                      |+......    +.++....+++|+.|+..+..++-..     ..+ .+.-++|++||.+-+-     +      .....
T Consensus        85 AG~~~~~~~~~~~~e~~~~~~~vNl~~~~~~~k~~~~~-----m~~~~~~G~IInisS~~~~~-----~------~~~~~  148 (245)
T PRK07060         85 AGIASLESAIDMTAAGFDRVMAVNARGALLVARHVARA-----MIRAGRGGSIVNVSSQAALV-----G------LPDHL  148 (245)
T ss_pred             CCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHHCCCCEEEEEECCCCCC-----C------CCCCH
T ss_conf             88799999013999999999999709999999999999-----99808980799986643257-----8------99747


Q ss_pred             CCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22333221000000123332---222222222222333222222222--2222222222222222223322113322220
Q gi|254780920|r  156 PYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIP--LAITRMIEGSHVFLYGDGQNVRDWLYVEDHV  230 (358)
Q Consensus       156 ~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~--~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~a  230 (358)
                      .|+.+|.+.+.+.+..+.++   |+++-.+-|+.+.-|...  ...+  ..........|+         .-+...+|+|
T Consensus       149 ~Y~asKaav~~ltkslA~el~~~gIRVN~I~PG~i~T~~~~--~~~~~~~~~~~~~~~~pl---------~R~g~peeiA  217 (245)
T PRK07060        149 AYCASKAALDAATRVLCVELGPHGIRVNSVNPTVTLTPMAE--FAWSDPQKSEPMLAAIPL---------GRFAEVDDVA  217 (245)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCHHHH--HHCCCHHHHHHHHHCCCC---------CCCCCHHHHH
T ss_conf             89999999999999999996101929999976989876676--424899999999955999---------9978899999


Q ss_pred             CCEEECCCC---CCCCCCCCCCCCC
Q ss_conf             000000122---2222211135786
Q gi|254780920|r  231 RALYLVLKK---GRIGERYNIGGNN  252 (358)
Q Consensus       231 ~~i~~~~~~---~~~~~~fNigs~~  252 (358)
                      .++..++..   ...|+++.|.+|-
T Consensus       218 ~~v~fL~S~~ss~iTG~~i~VDGG~  242 (245)
T PRK07060        218 APILFLLSDAASMVSGVSLPVDGGY  242 (245)
T ss_pred             HHHHHHHCCHHCCCCCCEEEECCCH
T ss_conf             9999995864258148428869563


No 83 
>PRK06180 short chain dehydrogenase; Provisional
Probab=99.52  E-value=2e-14  Score=107.51  Aligned_cols=167  Identities=14%  Similarity=0.133  Sum_probs=117.2

Q ss_pred             CE-EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC-----CC
Q ss_conf             94-8997678827799999999868987999947887658567776203797499976388999999998622-----78
Q gi|254780920|r    1 MR-LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEF-----QP   74 (358)
Q Consensus         1 Mk-ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~   74 (358)
                      || ||||||+.=||..+++.|+++ |++|++.+|...  ....+.. ....++..+.+|++|.+.++++++..     .+
T Consensus         4 ~KvvlITGassGIG~aiA~~l~~~-G~~Vi~~~R~~~--~l~~l~~-~~~~~~~~~~~Dvtd~~~v~~~v~~~~~~~G~i   79 (277)
T PRK06180          4 MKTWLITGVSSGFGRALAQAALAA-GHRVVGTVRSAA--ARRDFEA-LHPGRALARVLDVTDFDAIDGVVADAEATVGPI   79 (277)
T ss_pred             CCEEEECCCCCHHHHHHHHHHHHC-CCEEEEEECCHH--HHHHHHH-HCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCC
T ss_conf             988999178739999999999987-999999989999--9999998-679957999983799999999999999981998


Q ss_pred             CEEEEECCCCCCCCC----CCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             717851234332222----2222222222222220247888651232211247842786305543112222222222222
Q gi|254780920|r   75 DAIVNFAAESHVDRS----ILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMP  150 (358)
Q Consensus        75 d~ViHlAa~~~~~~~----~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~  150 (358)
                      |+++|.|+.......    .++....+++|+.|+.++..++.-.     ..+.+.-++|.+||.+-+-           +
T Consensus        80 DvLVNNAG~~~~~~~e~~~~~~~~~~~~vN~~g~~~~~~a~lp~-----m~~~~~G~IvnisS~ag~~-----------~  143 (277)
T PRK06180         80 DVLVNNAGYGHEGAIEESPLAEMRRQFEVNVFGAVAMIKAVLPG-----MRARRRGHIVNITSMGGLI-----------T  143 (277)
T ss_pred             CEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHCCCHH-----HHHCCCCEEEEECCHHHCC-----------C
T ss_conf             69998997788886333999999999988537765442004888-----8965896577535466525-----------7


Q ss_pred             CCCCCCCCCCCCCCEEEECCCCC---CCCCCCCCCCCCCC
Q ss_conf             22222223332210000001233---32222222222222
Q gi|254780920|r  151 YNPSSPYSATKASSDYLVLAWGH---TYGIPVLLSNCSNN  187 (358)
Q Consensus       151 ~~p~s~Yg~sK~~~E~~~~~~~~---~~~l~~~ilR~~~v  187 (358)
                      .-..+.|+.||.+.+-+.+..+.   .+|+++.++-|+.+
T Consensus       144 ~p~~~~Y~aSK~Al~~lt~sLa~El~~~gIrVn~V~PG~v  183 (277)
T PRK06180        144 MPGIAYYCGSKFALEGISEALAKEVAPFGIHVTAVEPGSF  183 (277)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCCC
T ss_conf             9998279999999999999999984323868999970787


No 84 
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated
Probab=99.52  E-value=1.1e-14  Score=109.11  Aligned_cols=223  Identities=13%  Similarity=0.111  Sum_probs=138.6

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH-----CCCCE
Q ss_conf             4899767882779999999986898799994788765856777620379749997638899999999862-----27871
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKE-----FQPDA   76 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~-----~~~d~   76 (358)
                      .+|||||++-||..+++.|+++ |++|+++|..........+.  ....++..+++|++|.+.++++++.     .++|+
T Consensus        12 ~alITGas~GIG~aia~~la~~-Ga~Vv~~~~~~~~~~~~~~~--~~~~~~~~~~~D~~~~~~v~~~~~~~~~~~G~iDi   88 (253)
T PRK08993         12 VAVVTGCDTGLGQGMALGLAEA-GCDIVGINIVEPTETIEQVT--ALGRRFLSLTADLRKIDGIPALLERAVAEFGHIDI   88 (253)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEECCCCHHHHHHHHH--HCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCEE
T ss_conf             8999388768999999999987-99999955877499999999--65995799980379999999999999998499729


Q ss_pred             EEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             785123433222----2222222222222222024788865123221124784278630554311222222222222222
Q gi|254780920|r   77 IVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYN  152 (358)
Q Consensus        77 ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~  152 (358)
                      ++|.|+......    +.++....+++|+.|+..+..++....    ..+...-++|++||...+-..           .
T Consensus        89 lVnnAG~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~~----~~~~~~G~IvnisS~~~~~~~-----------~  153 (253)
T PRK08993         89 LVNNAGLIRREDAIEFSEKDWDDVMNLNIKSVFFMSQAAAKHF----IAQGNGGKIINIASMLSFQGG-----------I  153 (253)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH----HHCCCCCCCEEEEEECCCCCC-----------C
T ss_conf             9989977889980129999999999988544356678768999----972778852389861003688-----------9


Q ss_pred             CCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222233322100000012333---2222222222222333222222222222222222222222222332211332222
Q gi|254780920|r  153 PSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDH  229 (358)
Q Consensus       153 p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~  229 (358)
                      ....|+.||.+.+.+.+..+.+   +|+++-.+-|+.+-.+....-..-..........-|+         .-+...+|+
T Consensus       154 ~~~~Y~asKaal~~ltr~lA~e~a~~gIrVN~I~PG~v~T~~~~~~~~~~~~~~~~~~~~p~---------~R~g~peei  224 (253)
T PRK08993        154 RVPSYTASKSGVMGVTRLMANEWAKHNINVNAIAPGYMATNNTQQLRADEQRSAEILDRIPA---------GRWGLPSDL  224 (253)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCHHHHCCCHHHHHHHHHCCCC---------CCCCCHHHH
T ss_conf             86567999999999999999996233959999964878677554303798999999955999---------998199999


Q ss_pred             CCCEEECCCCC---CCCCCCCCCCC
Q ss_conf             00000001222---22221113578
Q gi|254780920|r  230 VRALYLVLKKG---RIGERYNIGGN  251 (358)
Q Consensus       230 a~~i~~~~~~~---~~~~~fNigs~  251 (358)
                      +.++..++...   ..|.++.+.+|
T Consensus       225 A~~v~fL~S~~a~~iTG~~i~VDGG  249 (253)
T PRK08993        225 MGPVVFLASSASDYINGYTIAVDGG  249 (253)
T ss_pred             HHHHHHHHCCHHCCCCCCEEEECCC
T ss_conf             9999999584322825853898957


No 85 
>PRK07677 short chain dehydrogenase; Provisional
Probab=99.52  E-value=1.8e-14  Score=107.69  Aligned_cols=225  Identities=20%  Similarity=0.225  Sum_probs=142.7

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHH-HHHH-CCCCEEEEECCCCCHHHHHHHHHH----C-CC
Q ss_conf             489976788277999999998689879999478876585677-7620-379749997638899999999862----2-78
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSL-KEIS-QSNLFSFLQVDICDRECIRSALKE----F-QP   74 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~-~~~~-~~~~v~~i~~Di~d~~~l~~~~~~----~-~~   74 (358)
                      .+|||||++=||..++++|+++ |.+|+..|+...  ..... +.+. ....+.++++|++|.+.+++++++    + ++
T Consensus         5 ~alVTGgs~GIG~aia~~la~~-Ga~V~i~~r~~~--~l~~~~~~i~~~g~~~~~~~~Dv~~~~~v~~~v~~~~~~~g~i   81 (254)
T PRK07677          5 VVIITGGSSGMGKAMAKRFAEE-GANVVITGRTKE--KLEEAKLEIEQFPGQVLTVQMDVRNPDDVQKMIEQIDEKFGRI   81 (254)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHH--HHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC
T ss_conf             8999587678999999999987-999999969999--9999999998569909999803899999999999999983998


Q ss_pred             CEEEEECCCCCC----CCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             717851234332----2222222222222222220247888651232211247842786305543112222222222222
Q gi|254780920|r   75 DAIVNFAAESHV----DRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMP  150 (358)
Q Consensus        75 d~ViHlAa~~~~----~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~  150 (358)
                      |+++|.|+....    +.+.++....+++|+.|+..+..++.....    .....-++|.+||...+.           +
T Consensus        82 DiLVnNAg~~~~~~~~~~t~~~~~~~~~vnl~g~~~~~~~~~~~m~----~~~~~G~IInisS~~~~~-----------~  146 (254)
T PRK07677         82 DALINNAAGNFICPAEDLSVNGWKSVIDIVLNGTFYCSQAVGKYWI----EKGIKGNIINMVATYAWD-----------A  146 (254)
T ss_pred             CEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHCCCCEEEEEEECCCCC-----------C
T ss_conf             8899757557788826599999999999972318899999999999----828995399995110056-----------8


Q ss_pred             CCCCCCCCCCCCCCEEEECCCC----CCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222333221000000123----3322222222222223332222222--222222222222222222223322113
Q gi|254780920|r  151 YNPSSPYSATKASSDYLVLAWG----HTYGIPVLLSNCSNNYGPYHFPEKL--IPLAITRMIEGSHVFLYGDGQNVRDWL  224 (358)
Q Consensus       151 ~~p~s~Yg~sK~~~E~~~~~~~----~~~~l~~~ilR~~~vyGp~~~~~~~--i~~~i~~~~~g~~~~i~g~g~~~Rdfi  224 (358)
                      ..+..+|+.+|.+.+.+.+..+    .+||+++-++-|+.+.-+... ..+  -+.+...+.+.-|+         +-+.
T Consensus       147 ~~~~~~y~asKaal~~ltk~lA~ela~~~gIrvN~I~PG~i~~~~~~-~~~~~~~~~~~~~~~~~Pl---------~R~g  216 (254)
T PRK07677        147 GAGVIHSAAAKAGVLAMTRTLAVEWGRKYGIRVNAIAPGPIERTGGA-DKLWISEEAAKRTIQSVPL---------GRLG  216 (254)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCCHH-HHCCCCHHHHHHHHHCCCC---------CCCC
T ss_conf             89828899999999999999999857233989999942767776403-2324999999999857999---------9984


Q ss_pred             CCCCCCCCEEECCCC---CCCCCCCCCCCCCCC
Q ss_conf             322220000000122---222221113578642
Q gi|254780920|r  225 YVEDHVRALYLVLKK---GRIGERYNIGGNNER  254 (358)
Q Consensus       225 ~v~D~a~~i~~~~~~---~~~~~~fNigs~~~~  254 (358)
                      -.+|+++++..++..   ...|+.+.|.+|..+
T Consensus       217 ~pediA~~v~fL~S~~asyiTG~~i~VDGG~~l  249 (254)
T PRK07677        217 TPEEIAGLAYYLLSDEAAYINGTCITMDGGQWL  249 (254)
T ss_pred             CHHHHHHHHHHHHCCHHCCCCCCEEEECCCCCC
T ss_conf             999999999999587324824872886899010


No 86 
>PRK08277 D-mannonate oxidoreductase; Provisional
Probab=99.52  E-value=1.1e-14  Score=109.12  Aligned_cols=224  Identities=17%  Similarity=0.186  Sum_probs=139.7

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH-CCCCEEEEECCCCCHHHHHHHHHHC-----CCC
Q ss_conf             4899767882779999999986898799994788765856777620-3797499976388999999998622-----787
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS-QSNLFSFLQVDICDRECIRSALKEF-----QPD   75 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~-~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d   75 (358)
                      .+|||||++-||..+++.|+++ |.+|+..|+..... ..-.+++. ....+.++++|++|.+.++++++..     ++|
T Consensus        12 valVTGas~GIG~aia~~la~~-Ga~V~i~~~~~~~~-~~~~~~l~~~g~~~~~~~~Dvtd~~~v~~~~~~~~~~~G~iD   89 (278)
T PRK08277         12 VAVITGGGGVLGGAMAKELARA-GAKVAILDRNQEKA-EAVVEEIKANGGEAIALKADVLDKESLEQARQQILKDFGRCD   89 (278)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHHH-HHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             8999586748999999999987-99899997988999-999999984599099998248999999999999999849988


Q ss_pred             EEEEECCCCCCC-------------------CCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCC
Q ss_conf             178512343322-------------------2222222222222222202478886512322112478427863055431
Q gi|254780920|r   76 AIVNFAAESHVD-------------------RSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEV  136 (358)
Q Consensus        76 ~ViHlAa~~~~~-------------------~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~v  136 (358)
                      +++|.|+..++.                   .+.++....+++|+.|+..+..++...     ..+.+.-++|.+||...
T Consensus        90 iLVNnAG~~~p~~~~~~~~~~~~~~~~~~~d~~~e~w~~~~~vNl~g~~~~~~~~~~~-----m~~~~~G~IInisS~~~  164 (278)
T PRK08277         90 ILINGAGGNHPGATTDNEFHELPPETKTFFDLDEDGFEFVFDLNLLGTLLPTQVFAKD-----MIEQKGGNIINISSMNA  164 (278)
T ss_pred             EEEECCCCCCCCCCCCCCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEEECCHHH
T ss_conf             8998898767666323321224545576311999999999999759999999999999-----98769965999813664


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCC-----CCCCCCCCCCCCCC
Q ss_conf             122222222222222222222333221000000123332---2222222222223332222-----22222222222222
Q gi|254780920|r  137 YGSLDKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFP-----EKLIPLAITRMIEG  208 (358)
Q Consensus       137 Yg~~~~~~~~E~~~~~p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~-----~~~i~~~i~~~~~g  208 (358)
                      +.     |      ......|+.||.+...+.+..+.++   |+++-.+-|+.+..|....     +........++...
T Consensus       165 ~~-----~------~~~~~~Y~asKaav~~lTk~lA~e~a~~gIrVNaIaPG~i~T~~~~~~~~~~~~~~~~~~~~~~~~  233 (278)
T PRK08277        165 FT-----P------LTKVPAYSAAKAAISNFTQWLAVEFAKVGIRVNAIAPGFFLTEQNRALLLNEDGSPTERANKILAH  233 (278)
T ss_pred             CC-----C------CCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHHHHCCCCCCHHHHHHHHHHC
T ss_conf             77-----8------898655799999999999999999653594999985288877266776418667879999999847


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCEEECCC-C---CCCCCCCCCCCCC
Q ss_conf             222222222332211332222000000012-2---2222211135786
Q gi|254780920|r  209 SHVFLYGDGQNVRDWLYVEDHVRALYLVLK-K---GRIGERYNIGGNN  252 (358)
Q Consensus       209 ~~~~i~g~g~~~Rdfi~v~D~a~~i~~~~~-~---~~~~~~fNigs~~  252 (358)
                      -|         .+-+...+|++.++..++. .   ...|+++.+.+|-
T Consensus       234 ~P---------l~R~g~pedia~~v~fLaS~~as~yiTG~~i~VDGG~  272 (278)
T PRK08277        234 TP---------MGRFGKPEELLGTLLWLADEDASSFVTGVVLPVDGGF  272 (278)
T ss_pred             CC---------CCCCCCHHHHHHHHHHHHCCCHHCCCCCCEEEECCCH
T ss_conf             99---------8898499999999999909805277338728869254


No 87 
>PRK05693 short chain dehydrogenase; Provisional
Probab=99.52  E-value=2.6e-14  Score=106.83  Aligned_cols=163  Identities=17%  Similarity=0.186  Sum_probs=116.2

Q ss_pred             CE-EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH-----CCC
Q ss_conf             94-899767882779999999986898799994788765856777620379749997638899999999862-----278
Q gi|254780920|r    1 MR-LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKE-----FQP   74 (358)
Q Consensus         1 Mk-ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~-----~~~   74 (358)
                      || ||||||++=||..++++|.+ .|++|++..+     +...++++. ..++..+++|++|.+.++++++.     .++
T Consensus         1 MKvvlITGassGIG~alA~~la~-~G~~V~~~~R-----~~~~l~~l~-~~~~~~~~~Dvtd~~~i~~~~~~~~~~~g~i   73 (274)
T PRK05693          1 MPVVLITGCSSGIGRALADAFKA-AGYEVWATAR-----KAEDVEALA-AAGFTAVQLDVNDGAALARLAEELEAEHQGL   73 (274)
T ss_pred             CCEEEECCCCCHHHHHHHHHHHH-CCCEEEEEEC-----CHHHHHHHH-HCCCCEEEEECCCHHHHHHHHHHHHHHCCCC
T ss_conf             99899948885899999999998-7999999979-----999999998-4899189984699899999999999972997


Q ss_pred             CEEEEECCCCCCCCC----CCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             717851234332222----2222222222222220247888651232211247842786305543112222222222222
Q gi|254780920|r   75 DAIVNFAAESHVDRS----ILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMP  150 (358)
Q Consensus        75 d~ViHlAa~~~~~~~----~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~  150 (358)
                      |+++|.|+.......    .++-...+++|+.|...+..+..-.      .+.+.-++|.+||.+-+     .++    |
T Consensus        74 DiLVNNAG~~~~g~~~~~~~~~~~~~~~vN~~g~~~~~~~~lP~------m~~~~G~IVnisS~ag~-----~~~----p  138 (274)
T PRK05693         74 DVLINNAGYGAMGPLLDGGVEAMRRQFETNVFAVVGVTRALFPL------LRRSRGLVVNIGSVSGV-----LVT----P  138 (274)
T ss_pred             CEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------HHHCCCEEEEEECCHHC-----CCC----C
T ss_conf             68998886778875898768999999999819999999999999------97589679998140532-----689----9


Q ss_pred             CCCCCCCCCCCCCCEEEECCCCC---CCCCCCCCCCCCCC
Q ss_conf             22222223332210000001233---32222222222222
Q gi|254780920|r  151 YNPSSPYSATKASSDYLVLAWGH---TYGIPVLLSNCSNN  187 (358)
Q Consensus       151 ~~p~s~Yg~sK~~~E~~~~~~~~---~~~l~~~ilR~~~v  187 (358)
                        -.+.|+.||.+.+-+.+..+.   .+|++++.+-|+.+
T Consensus       139 --~~~~Y~aSK~Al~~~s~sLr~El~~~gI~V~~v~PG~i  176 (274)
T PRK05693        139 --FAGAYCASKAAVHALSDALRLELAPFGVQVMEVQPGAI  176 (274)
T ss_pred             --CCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCC
T ss_conf             --97379999999999999999984202878999971888


No 88 
>PRK07890 short chain dehydrogenase; Provisional
Probab=99.51  E-value=1.1e-14  Score=109.14  Aligned_cols=224  Identities=14%  Similarity=0.091  Sum_probs=143.7

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHH----C-CCC
Q ss_conf             489976788277999999998689879999478876585677762-0379749997638899999999862----2-787
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEI-SQSNLFSFLQVDICDRECIRSALKE----F-QPD   75 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~-~~~~~v~~i~~Di~d~~~l~~~~~~----~-~~d   75 (358)
                      .+|||||++=||+.+++.|+++ |.+|+..++..... ..-.+++ .......++.+|++|.+.++++++.    + ++|
T Consensus         7 ~alVTG~s~GIG~aia~~la~~-Ga~V~i~~r~~~~l-~~~~~~i~~~g~~~~~~~~Dv~~~~~~~~~v~~~~~~fG~iD   84 (258)
T PRK07890          7 VVVVSGVGPGLGTTLAVRAARE-GADVVLAARTAERL-DEVAKQIDDLGRRALAVVTDITDEAQVANLVDAALERFGRVD   84 (258)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHHH-HHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             8999685658999999999987-99899997989999-999999996499589998169999999999999999849998


Q ss_pred             EEEEECCCCCCCC-----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             1785123433222-----22222222222222220247888651232211247842786305543112222222222222
Q gi|254780920|r   76 AIVNFAAESHVDR-----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMP  150 (358)
Q Consensus        76 ~ViHlAa~~~~~~-----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~  150 (358)
                      +++|.|+......     ..++....+++|+.|+.++..++....     ...+ -++|++||...+..           
T Consensus        85 iLVnnAg~~~~~~~~~~~~~e~~~~~~~~nl~~~~~~~k~~~p~m-----~~~~-G~IVnisS~~~~~~-----------  147 (258)
T PRK07890         85 VLVNNAFRVPSMKPLAGADFDHWRDVIETNVLGTLRLTQAFTPAL-----AESG-GSVVMINSMVLRHS-----------  147 (258)
T ss_pred             EEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHCC-CEEEEEECHHHCCC-----------
T ss_conf             999868667899980029999999999987599999999889999-----9769-85999825654888-----------


Q ss_pred             CCCCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCC--------CCC-CCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222333221000000123332---22222222222233322222--------222-22222222222222222223
Q gi|254780920|r  151 YNPSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPE--------KLI-PLAITRMIEGSHVFLYGDGQ  218 (358)
Q Consensus       151 ~~p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~--------~~i-~~~i~~~~~g~~~~i~g~g~  218 (358)
                      .....+|+.+|.+.+.+.+..+.++   |+++-.+-|+.+.+|.....        ... ..+.......-|+       
T Consensus       148 ~~~~~~Y~~sKaal~~ltk~lA~ela~~gIrVN~V~PG~i~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pl-------  220 (258)
T PRK07890        148 QPKYGAYKMAKGALLAASQSLATELGPQGIRVNSVAPGYIWGDPLQGYFDHQAGKYGTTVEEIYAATAANSDL-------  220 (258)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHCCCC-------
T ss_conf             9997789999999999999999997140959999951878875256688766654299989999999707999-------


Q ss_pred             CCCCCCCCCCCCCCEEECCCC---CCCCCCCCCCCCCC
Q ss_conf             322113322220000000122---22222111357864
Q gi|254780920|r  219 NVRDWLYVEDHVRALYLVLKK---GRIGERYNIGGNNE  253 (358)
Q Consensus       219 ~~Rdfi~v~D~a~~i~~~~~~---~~~~~~fNigs~~~  253 (358)
                        .-+.-.+|+|.++..++..   ...|..+.+.+|+-
T Consensus       221 --~R~g~p~diA~~v~fL~Sd~a~~iTG~~i~VDGG~~  256 (258)
T PRK07890        221 --KRLPTDDEVASAVLFLASDLASAITGQTLDVNCGEF  256 (258)
T ss_pred             --CCCCCHHHHHHHHHHHHCCHHCCCCCCEEEECCCCC
T ss_conf             --999799999999999958532394387478668906


No 89 
>PRK07831 short chain dehydrogenase; Provisional
Probab=99.51  E-value=2.6e-14  Score=106.73  Aligned_cols=225  Identities=14%  Similarity=0.081  Sum_probs=143.6

Q ss_pred             EEEEECCCC-HHHHHHHHHHHHHCCCEEEEEECCCCCCC--HHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH-----CC
Q ss_conf             489976788-27799999999868987999947887658--56777620379749997638899999999862-----27
Q gi|254780920|r    2 RLIVTGGAG-FIGSALCRYLVNDLKIQVLVIDKLTYAGN--LNSLKEISQSNLFSFLQVDICDRECIRSALKE-----FQ   73 (358)
Q Consensus         2 kILItG~tG-fIGs~l~~~Ll~~~~~~V~~~d~~~~~~~--~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~-----~~   73 (358)
                      ++|||||+| =||..+++.|+++ |.+|+..|+......  ...+........+..+.+|++|+++++++++.     .+
T Consensus        18 valVTGgsg~GIG~a~a~~la~~-Ga~V~i~d~~~~~~~e~~~~~~~~~g~~~v~~~~~Dvt~~~~v~~~v~~~~~~~G~   96 (261)
T PRK07831         18 VVVVTAAAGTGIGSATARRALEE-GADVVISDIHERRLGETADELAAELGLGRVEGVVCDVTSEAQVDALIDAAVERLGR   96 (261)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHC-CCEEEEEECCHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHHCC
T ss_conf             49994999647899999999987-99899980877778999999998438772899975689999999999999998299


Q ss_pred             CCEEEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             871785123433222----2222222222222222024788865123221124784278630554311222222222222
Q gi|254780920|r   74 PDAIVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDM  149 (358)
Q Consensus        74 ~d~ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~  149 (358)
                      +|+++|.|+......    +.++....+++|+.|+.++..++.....    .....-++|.+||..-+-           
T Consensus        97 iDiLVNNAG~~~~~~~~e~~~e~w~~~~~vNl~g~~~~~~~~~p~m~----~~~~gG~IinisS~~~~~-----------  161 (261)
T PRK07831         97 LDVLVNNAGLGGQTPVVDMTDDEWSRVLDVTLTGTFRATRAALRYMR----AAPHGGVIVNNASVLGWR-----------  161 (261)
T ss_pred             CCEEEECCCCCCCCCHHHCCHHHHHHHHHHCCHHHHHHHHHHHHHHH----HCCCCCEEEECCCCCCCC-----------
T ss_conf             86999888668998814499999999861321519999999999999----769997898454403056-----------


Q ss_pred             CCCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222233322100000012333---2222222222222333222222222222222222222222222332211332
Q gi|254780920|r  150 PYNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYV  226 (358)
Q Consensus       150 ~~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v  226 (358)
                      +..+...|+.||.+...+.+..+.+   +|+++-.+-|+.+..|.... ..-+.+...+....|+         .-+...
T Consensus       162 ~~~~~~~Y~asKaav~~lTk~lA~e~a~~gIrVNaI~PG~i~t~~~~~-~~~~~~~~~~~~~~p~---------gR~g~p  231 (261)
T PRK07831        162 AQHSQAHYAAAKAGVMALTRCSAIEAAEYGVRINAVAPSIARHKFLKK-VTSAELLDRLASGEAF---------GRAAEP  231 (261)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHC-CCCHHHHHHHHCCCCC---------CCCCCH
T ss_conf             788743689999999999999999984529089999558767702221-3999999998707997---------897599


Q ss_pred             CCCCCCEEECCCC---CCCCCCCCCCCCC
Q ss_conf             2220000000122---2222211135786
Q gi|254780920|r  227 EDHVRALYLVLKK---GRIGERYNIGGNN  252 (358)
Q Consensus       227 ~D~a~~i~~~~~~---~~~~~~fNigs~~  252 (358)
                      +|++.++..++..   ...|+++.|.+|.
T Consensus       232 ediA~~v~fLaSd~s~~iTGq~i~V~gg~  260 (261)
T PRK07831        232 WEVAAVIAFLASDYSSYLTGEVVSVSSQH  260 (261)
T ss_pred             HHHHHHHHHHHCHHHCCCCCEEEEECCCC
T ss_conf             99999999995815469757388988997


No 90 
>PRK08263 short chain dehydrogenase; Provisional
Probab=99.51  E-value=2.8e-14  Score=106.54  Aligned_cols=163  Identities=18%  Similarity=0.204  Sum_probs=116.5

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH--CCCCEEEEECCCCCHHHHHHHHHH-----CCCC
Q ss_conf             899767882779999999986898799994788765856777620--379749997638899999999862-----2787
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS--QSNLFSFLQVDICDRECIRSALKE-----FQPD   75 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~--~~~~v~~i~~Di~d~~~l~~~~~~-----~~~d   75 (358)
                      +|||||+.=||..+++.|+++ |++|++.++.     ...+..+.  ...++..+.+|++|.+.++++++.     .++|
T Consensus         6 ~lITGassGIG~a~A~~la~~-G~~Vv~~~R~-----~~~l~~l~~~~~~~~~~~~~Dvtd~~~v~~~v~~~~~~~G~iD   79 (275)
T PRK08263          6 WFITGASRGFGREWTEAALER-GDRVVATARD-----TATLADLAERYGDALLPLALDVTDRAAVFAAVEQAVKHFGRLD   79 (275)
T ss_pred             EEEECCCHHHHHHHHHHHHHC-CCEEEEEECC-----HHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCC
T ss_conf             999467439999999999987-9989999798-----9999999997599679999648999999999999999849987


Q ss_pred             EEEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             1785123433222----222222222222222202478886512322112478427863055431122222222222222
Q gi|254780920|r   76 AIVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPY  151 (358)
Q Consensus        76 ~ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~  151 (358)
                      +++|.|+......    +.++....+++|+.|+.++..++.-.     ..+.+.-++|.+||.+-+-.           .
T Consensus        80 iLVNNAG~~~~~~~~e~~~~~~~~~~~vNl~g~~~~~~a~lp~-----m~~~~~G~IvnisS~ag~~~-----------~  143 (275)
T PRK08263         80 IVVNNAGYGLFGMIEEVTESEARAQIDTNVFGALWVTQAVLPY-----LRAQRSGHIIQISSIGGISA-----------F  143 (275)
T ss_pred             EEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHCCH-----HHHCCCCEEEEECCHHHCCC-----------C
T ss_conf             8998886678887476999999999998619999987642613-----35169977999457010567-----------9


Q ss_pred             CCCCCCCCCCCCCEEEECCCCC---CCCCCCCCCCCCCC
Q ss_conf             2222223332210000001233---32222222222222
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGH---TYGIPVLLSNCSNN  187 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~---~~~l~~~ilR~~~v  187 (358)
                      -..++|+.||.+.+-+.+..+.   .+|+++.++-|+.+
T Consensus       144 p~~~~Y~ASK~Al~~lt~sLa~El~~~gIrVn~V~PG~v  182 (275)
T PRK08263        144 PMVGIYHASKWALEGFSEALAQEVAHFGIKVTLVEPGGY  182 (275)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCCC
T ss_conf             997079999999999999999984033968999970887


No 91 
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated
Probab=99.51  E-value=2e-14  Score=107.49  Aligned_cols=223  Identities=17%  Similarity=0.098  Sum_probs=144.7

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH-CCCCEEEEECCCCCHHHHHHHHHH-----CCCCE
Q ss_conf             899767882779999999986898799994788765856777620-379749997638899999999862-----27871
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS-QSNLFSFLQVDICDRECIRSALKE-----FQPDA   76 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~-~~~~v~~i~~Di~d~~~l~~~~~~-----~~~d~   76 (358)
                      +|||||++=||+.+++.|+++ |.+|+..|+.... -..-.+.+. ...++..+++|++|.+.++++++.     .++|+
T Consensus        14 alVTGas~GIG~aia~~la~~-Ga~V~i~~~~~~~-~~~~~~~l~~~g~~~~~~~~Dv~~~~~~~~~v~~~~~~~G~iDi   91 (255)
T PRK06113         14 AIITGAGAGIGKEIAITFATA-GASVVVSDINADA-ANHVVDEIQQLGGQAFACRCDITSEQELSALADFAVSKLGKVDI   91 (255)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHH-HHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             999588778999999999987-9999999698899-99999999965990899983689999999999999998199889


Q ss_pred             EEEECCCCCCC---CCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             78512343322---222222222222222220247888651232211247842786305543112222222222222222
Q gi|254780920|r   77 IVNFAAESHVD---RSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNP  153 (358)
Q Consensus        77 ViHlAa~~~~~---~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p  153 (358)
                      ++|-|+...+.   .+.++....++.|+.|+.++..++....     .+.+.-++|.+||.....           +...
T Consensus        92 lVnNAG~~~~~~~d~~~~~~~~~~~~Nl~~~~~~~~~~~p~m-----~~~~~G~IInisS~~~~~-----------~~~~  155 (255)
T PRK06113         92 LVNNAGGGGPKPFDMPMADFRRAYELNVFSFFHLSQLVAPEM-----EKNGGGVILTITSMAAEN-----------KNIN  155 (255)
T ss_pred             EEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHCCCCEEEEEEEHHHCC-----------CCCC
T ss_conf             998788789987759999999999996499999999999988-----871896799984465468-----------8998


Q ss_pred             CCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222333221000000123332---2222222222223332222222222222222222222222223322113322220
Q gi|254780920|r  154 SSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV  230 (358)
Q Consensus       154 ~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~a  230 (358)
                      ...|+.+|.+...+.+..+.++   ++++-++=|+.+-.+... ..+-|.+.....+.-|         .+-+...+|+|
T Consensus       156 ~~~Y~asKaav~~ltk~lA~ela~~gIrVN~V~PG~i~T~~~~-~~~~~~~~~~~~~~~P---------l~R~g~pediA  225 (255)
T PRK06113        156 MTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALK-SVITPEIEQKMLQHTP---------IRRLGQPQDIA  225 (255)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCHHH-HCCCHHHHHHHHHCCC---------CCCCCCHHHHH
T ss_conf             5208999999999999999998264949999864889870222-0179999999985799---------88982999999


Q ss_pred             CCEEECCCC---CCCCCCCCCCCCCC
Q ss_conf             000000122---22222111357864
Q gi|254780920|r  231 RALYLVLKK---GRIGERYNIGGNNE  253 (358)
Q Consensus       231 ~~i~~~~~~---~~~~~~fNigs~~~  253 (358)
                      .++..++..   ...|+++.+.+|.-
T Consensus       226 ~~v~fL~S~~a~~itG~~i~VDGG~v  251 (255)
T PRK06113        226 NAALFLCSPAASWVSGQILTVSGGGV  251 (255)
T ss_pred             HHHHHHHCCHHCCCCCCEEEECCCCC
T ss_conf             99999948142796688699578964


No 92 
>PRK06179 short chain dehydrogenase; Provisional
Probab=99.51  E-value=3.8e-14  Score=105.78  Aligned_cols=161  Identities=21%  Similarity=0.255  Sum_probs=114.9

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             8997678827799999999868987999947887658567776203797499976388999999998622-----78717
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEF-----QPDAI   77 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d~V   77 (358)
                      +|||||++=||..+++.|+++ |++|++.++.     .   .......+++++.+|++|.+.++++++..     ++|++
T Consensus         7 alITGassGIG~a~A~~la~~-G~~V~~~~r~-----~---~~~~~~~~~~~~~~Dvtd~~~v~~~~~~~~~~~g~iDiL   77 (270)
T PRK06179          7 ALVTGASSGIGRATAEALARA-GYRVFGTSRN-----P---ARATPIPGVELLELDVTDDASVQAAVQEVIARAGRIDVL   77 (270)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECC-----H---HHHHCCCCCEEEEEECCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             999072469999999999987-9999999689-----7---773054897899910799999999999999983998889


Q ss_pred             EEECCCCCCCCC----CCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             851234332222----2222222222222220247888651232211247842786305543112222222222222222
Q gi|254780920|r   78 VNFAAESHVDRS----ILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNP  153 (358)
Q Consensus        78 iHlAa~~~~~~~----~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p  153 (358)
                      +|.|+.......    .++....+++|+.|+.++..++.-.     ..+.+.-++|.+||..-+-           +.-.
T Consensus        78 VNNAGi~~~~~~~~~~~~~~~~~~~vN~~g~~~~~~~~lp~-----m~~~~~G~IvnisS~~g~~-----------~~p~  141 (270)
T PRK06179         78 VNNAGVGLLGAAEETSIAQAQALFDTNVFGILRMTNAVLPH-----MRAQGSGRIINISSVLGFL-----------PAPY  141 (270)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HCCCCCCEEEEECCHHHHC-----------CCCC
T ss_conf             98986667887575989999999887448999999874202-----2017995899986856627-----------7899


Q ss_pred             CCCCCCCCCCCEEEECCCCC---CCCCCCCCCCCCCCC
Q ss_conf             22223332210000001233---322222222222223
Q gi|254780920|r  154 SSPYSATKASSDYLVLAWGH---TYGIPVLLSNCSNNY  188 (358)
Q Consensus       154 ~s~Yg~sK~~~E~~~~~~~~---~~~l~~~ilR~~~vy  188 (358)
                      .+.|+.||.+.+.+.+..+.   .+|+++.++-|+.|-
T Consensus       142 ~~~Y~aSK~al~~~t~sla~El~~~gIrVn~v~PG~v~  179 (270)
T PRK06179        142 MALYAASKHAVEGYSESLDHEVRQFGIRVSLVEPAYTR  179 (270)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEECCCC
T ss_conf             70799999999999999999850129689999847891


No 93 
>PRK12827 short chain dehydrogenase; Provisional
Probab=99.51  E-value=1.6e-14  Score=108.11  Aligned_cols=222  Identities=20%  Similarity=0.159  Sum_probs=142.2

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCH--HHHHH-H-HCCCCEEEEECCCCCHHHHHHHHHHC-----C
Q ss_conf             89976788277999999998689879999478876585--67776-2-03797499976388999999998622-----7
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNL--NSLKE-I-SQSNLFSFLQVDICDRECIRSALKEF-----Q   73 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~--~~~~~-~-~~~~~v~~i~~Di~d~~~l~~~~~~~-----~   73 (358)
                      +|||||++=||+.+++.|+++ |.+|+.+|+.......  ..... + ....++.++++|++|.+.++++++..     +
T Consensus         9 alVTGas~GIG~aia~~la~~-Ga~V~i~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~v~~~~~~~G~   87 (251)
T PRK12827          9 VLITGGSGGLGRAIAVRLAAD-GADVIVLDIHPMRGRAEAEAVAALIEAAGGKALGLAFDVRDFAATRAALDAGVEEFGR   87 (251)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEEEECCCCHHHHHHHHHHHHHHCCC
T ss_conf             999682558999999999987-9989998488853289999999999964984999990389999999999999998399


Q ss_pred             CCEEEEECCCCCCC----CCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             87178512343322----22222222222222222024788865123221124784278630554311222222222222
Q gi|254780920|r   74 PDAIVNFAAESHVD----RSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDM  149 (358)
Q Consensus        74 ~d~ViHlAa~~~~~----~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~  149 (358)
                      +|+++|.|+.....    .+.++....+++|+.|+..+..++.....    ...+.-++|.+||....-           
T Consensus        88 iDiLVNnAG~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~~~m~----~~~~~G~IInisS~~~~~-----------  152 (251)
T PRK12827         88 LDILVNNAGIATDAAFAELSIEEWDDVIDVNLDGFFNVTQAALPPMI----RARRGGRIVNIASVAGVR-----------  152 (251)
T ss_pred             CCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHCCCCEEEEEECHHHCC-----------
T ss_conf             97999899889999903499999999999985999999999999999----838994699982533355-----------


Q ss_pred             CCCCCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222222333221000000123332---222222222222333222222222222222222222222222332211332
Q gi|254780920|r  150 PYNPSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYV  226 (358)
Q Consensus       150 ~~~p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v  226 (358)
                      +.....+|+.||.+...+.+..+.++   |+++-.+-|+.+--|...  ...+....++.+.-|+.         -+...
T Consensus       153 ~~~~~~~Y~asKaav~~lTr~lA~e~a~~gIrVNaV~PG~i~T~~~~--~~~~~~~~~~~~~~Pl~---------R~g~p  221 (251)
T PRK12827        153 GNRGQVNYAASKAGLIGLTKTLANELAPRGITVNAVAPGAINTPMAD--NAAMTGGEHALNPVPVQ---------RLGEP  221 (251)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHH--CCCHHHHHHHHHCCCCC---------CCCCH
T ss_conf             78986889999999999999999996504969999964889872011--03876999998479988---------97789


Q ss_pred             CCCCCCEEECCCC---CCCCCCCCCCCC
Q ss_conf             2220000000122---222221113578
Q gi|254780920|r  227 EDHVRALYLVLKK---GRIGERYNIGGN  251 (358)
Q Consensus       227 ~D~a~~i~~~~~~---~~~~~~fNigs~  251 (358)
                      +|+|.++..++..   ...|+++.+.+|
T Consensus       222 ediA~~v~fLaSd~s~~iTG~~i~VDGG  249 (251)
T PRK12827        222 DEVAALVAFLVSDAASYVTGQVIPVDGG  249 (251)
T ss_pred             HHHHHHHHHHHCCHHCCCCCCEEEECCC
T ss_conf             9999999999583324965864875368


No 94 
>PRK06101 short chain dehydrogenase; Provisional
Probab=99.51  E-value=3.4e-14  Score=106.06  Aligned_cols=197  Identities=19%  Similarity=0.242  Sum_probs=131.4

Q ss_pred             CE-EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH-CCCCEEEEECCCCCHHHHHHHHHHC--CCCE
Q ss_conf             94-899767882779999999986898799994788765856777620-3797499976388999999998622--7871
Q gi|254780920|r    1 MR-LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS-QSNLFSFLQVDICDRECIRSALKEF--QPDA   76 (358)
Q Consensus         1 Mk-ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~-~~~~v~~i~~Di~d~~~l~~~~~~~--~~d~   76 (358)
                      || ||||||++=||..++++|+++ |++|+..++.     ...++++. ....+..+.+|++|.+.+++++.+.  .+|.
T Consensus         1 MktvlITGassGIG~a~A~~la~~-G~~Vi~~~R~-----~~~l~~~~~~~~~~~~~~~Dvtd~~~~~~~~~~~~~~~d~   74 (241)
T PRK06101          1 MTSVLITGATSGIGKQLALDYAKA-GWKVIACGRN-----EAVLDELHDQSSNIFTLAFDVTDYEETKAALSQLPFIPEL   74 (241)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHHC-CCEEEEEECC-----HHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHCCCCCE
T ss_conf             998999224049999999999987-9989999899-----9999999973288048985226799999999971877778


Q ss_pred             EEEECCCCCCC-CCCCC---CCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             78512343322-22222---222222222222024788865123221124784278630554311222222222222222
Q gi|254780920|r   77 IVNFAAESHVD-RSILG---ADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYN  152 (358)
Q Consensus        77 ViHlAa~~~~~-~~~~~---p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~  152 (358)
                      +++.|+..... ....+   -...+++|+.|+.++.+++....      +.+ .+++.+||.+-+-.           .-
T Consensus        75 ~i~naG~~~~~~~~~~~~~~~~~~~~vN~~g~~~~~~~~~p~m------~~~-~~iv~isS~a~~~~-----------~p  136 (241)
T PRK06101         75 WIFNAGDCEYMDDGIVDAQLMARVFNVNVVGVANCIEACQPHF------QRG-HRVVIVGSIASELA-----------LP  136 (241)
T ss_pred             EEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH------HHC-CCEEEECCCCCCCC-----------CC
T ss_conf             9998866676873448999999999998899999999999998------738-95057754010568-----------89


Q ss_pred             CCCCCCCCCCCCEEEECCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222223332210000001233---32222222222222333222222222222222222222222222332211332222
Q gi|254780920|r  153 PSSPYSATKASSDYLVLAWGH---TYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDH  229 (358)
Q Consensus       153 p~s~Yg~sK~~~E~~~~~~~~---~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~  229 (358)
                      ....|+.||.+...+.+..+.   .+|+++..+.|+.|--|-.          .+    ..+..   +    -.+..+++
T Consensus       137 ~~~~Y~ASKaal~~~~~sLa~el~~~gI~V~~V~PG~v~T~m~----------~~----~~~~~---p----~~~~~e~~  195 (241)
T PRK06101        137 RAEAYGASKAAVSYFARTLALDLKKKGIKVVTVFPGFVATPLT----------DK----NTFAM---P----MIITVEQA  195 (241)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCC----------CC----CCCCC---C----CCCCHHHH
T ss_conf             8468899999999999999998525495899997189938887----------78----99889---8----75799999


Q ss_pred             CCCEEECCCCCCC
Q ss_conf             0000000122222
Q gi|254780920|r  230 VRALYLVLKKGRI  242 (358)
Q Consensus       230 a~~i~~~~~~~~~  242 (358)
                      |+.++.++++++.
T Consensus       196 A~~i~~~i~~~k~  208 (241)
T PRK06101        196 SQAIRKQLAAGKS  208 (241)
T ss_pred             HHHHHHHHHCCCC
T ss_conf             9999999974997


No 95 
>PRK07707 consensus
Probab=99.51  E-value=1.3e-14  Score=108.70  Aligned_cols=222  Identities=17%  Similarity=0.112  Sum_probs=142.7

Q ss_pred             CE--EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC--CCCE
Q ss_conf             94--8997678827799999999868987999947887658567776203797499976388999999998622--7871
Q gi|254780920|r    1 MR--LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEF--QPDA   76 (358)
Q Consensus         1 Mk--ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~--~~d~   76 (358)
                      ||  +|||||++=||..+++.|+++ |++|+...+... .....+...........+++|+++.+.+++++++.  .+|+
T Consensus         1 M~KvalVTG~s~GIG~aia~~la~~-Ga~V~i~~~~~~-~~~~~~~~~~~~~~~~~v~~Dl~~~~~~~~~~~~~~~~iD~   78 (239)
T PRK07707          1 MKKYALVTGASGGIGQAISKQLAQD-GYTVYLHYNNNE-EKVNELQEELGEVIPVPVQADLASPDGAEKLWSQIEHPLDA   78 (239)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHC-CCEEEEECCCCH-HHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHCCCCCE
T ss_conf             9989999668878999999999987-998999839998-99999999844366069998689999999999985788999


Q ss_pred             EEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             785123433222----2222222222222222024788865123221124784278630554311222222222222222
Q gi|254780920|r   77 IVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYN  152 (358)
Q Consensus        77 ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~  152 (358)
                      ++|.|+......    +.++....+++|+.|+..+...+...     ..+.+.-++|.+||....-           +..
T Consensus        79 lVnnAG~~~~~~~~~~~~e~~~~~~~~nl~~~~~~~~~~~p~-----m~~~~~G~II~isS~~~~~-----------g~~  142 (239)
T PRK07707         79 IVYNSGKSIFGLVTDVTNDELNDMVQLHVKSPYKLLSMLLPS-----MIQRKSGNIVAVSSIWGQI-----------GAS  142 (239)
T ss_pred             EEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEEECCHHHCC-----------CCC
T ss_conf             998999999987010999999999999989999999999899-----9876996799973788747-----------687


Q ss_pred             CCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222233322100000012333---2222222222222333222222222222222222222222222332211332222
Q gi|254780920|r  153 PSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDH  229 (358)
Q Consensus       153 p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~  229 (358)
                      +...|+.+|.+.+.+.+.++++   +|+++-.+-|+.+--|..  ..+.+.....+.+.-|+.         -+...+|+
T Consensus       143 ~~~~Y~asKaav~~ltr~lA~ela~~gIrVN~I~PG~i~T~~~--~~~~~~~~~~~~~~~plg---------R~g~pedi  211 (239)
T PRK07707        143 CEVLYSMVKGAQNSFVKALAKELAPSGIRVNAVAPGAIETEML--NVFSEEDKEEIAEEIPLG---------RLGLPEEV  211 (239)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCHHH--HHCCHHHHHHHHHCCCCC---------CCCCHHHH
T ss_conf             5168899999999999999999766396999997488987233--313999999998569999---------98589999


Q ss_pred             CCCEEECCCC---CCCCCCCCCCCC
Q ss_conf             0000000122---222221113578
Q gi|254780920|r  230 VRALYLVLKK---GRIGERYNIGGN  251 (358)
Q Consensus       230 a~~i~~~~~~---~~~~~~fNigs~  251 (358)
                      |+++..++..   ...|.++.+.+|
T Consensus       212 A~~v~FL~S~~a~~iTG~~l~VdGG  236 (239)
T PRK07707        212 AKTVSFLLSPGASYITGQIISVNGG  236 (239)
T ss_pred             HHHHHHHHCCHHCCCCCCEEEECCC
T ss_conf             9999999587224751863885879


No 96 
>PRK06124 gluconate 5-dehydrogenase; Provisional
Probab=99.51  E-value=1.9e-14  Score=107.56  Aligned_cols=226  Identities=16%  Similarity=0.108  Sum_probs=145.2

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHHC-----CCC
Q ss_conf             489976788277999999998689879999478876585677762-03797499976388999999998622-----787
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEI-SQSNLFSFLQVDICDRECIRSALKEF-----QPD   75 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~-~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d   75 (358)
                      .+|||||++-||..+++.|+++ |.+|+..++.... -..-.+++ .....+.++.+|++|.+.++++++..     ++|
T Consensus        16 ~alITGgs~GIG~~ia~~la~~-Ga~V~i~~r~~~~-~~~~~~~l~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~~g~iD   93 (259)
T PRK06124         16 VALVTGSARGLGLEIARALAEA-GAHVLVNGRNAAR-VEAAVAALRAAGGAAEALVFDISDEEAVAAAFARIDAEHGRLD   93 (259)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHH-HHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCC
T ss_conf             8999286748999999999987-9999999698899-9999999996599589999517999999999999999759997


Q ss_pred             EEEEECCCCCCC----CCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             178512343322----2222222222222222202478886512322112478427863055431122222222222222
Q gi|254780920|r   76 AIVNFAAESHVD----RSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPY  151 (358)
Q Consensus        76 ~ViHlAa~~~~~----~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~  151 (358)
                      +.+|.|+.....    .+.++-...+++|+.|+..+..++...     ..+.+.-++|++||..-.     .+      .
T Consensus        94 iLVnnAG~~~~~~~~~~~~e~~~~~~~~Nl~g~~~~~q~~~~~-----M~~~~~G~IInisS~~~~-----~~------~  157 (259)
T PRK06124         94 ILVNNVGARNRRPLAELDDAEIRALLETDLVAPILLSRLAAQR-----MVRQGYGRIIAITSIAGE-----VA------R  157 (259)
T ss_pred             EEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEEECCCCCC-----CC------C
T ss_conf             9998988899999066999999999999849999999999999-----877699369997233004-----67------9


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222233322100000012333---222222222222233322222222222222222222222222233221133222
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVED  228 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D  228 (358)
                      .....|+.||.+.+.+.+..+.+   +|+++-.+-|+.+.-+.......-+.+...+.+.-|+         +-+.-.+|
T Consensus       158 ~~~~~Y~asKaal~~ltr~lA~ela~~gIrVN~I~PG~i~T~~~~~~~~~~~~~~~~~~~~Pl---------~R~g~ped  228 (259)
T PRK06124        158 AGDAVYPAAKQGLTGLMRALAAEFGPHGITSNAIAPGYFATETNAAMAADPEVGEWLRARTPL---------GRWGRPEE  228 (259)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCHHHHCCCHHHHHHHHHCCCC---------CCCCCHHH
T ss_conf             983789999999999999999996513979999975889773221112799999999857998---------99859999


Q ss_pred             CCCCEEECCC---CCCCCCCCCCCCCCCC
Q ss_conf             2000000012---2222221113578642
Q gi|254780920|r  229 HVRALYLVLK---KGRIGERYNIGGNNER  254 (358)
Q Consensus       229 ~a~~i~~~~~---~~~~~~~fNigs~~~~  254 (358)
                      ++.++..++.   ....|+++.+.+|-++
T Consensus       229 ia~~v~fL~Sd~ssyiTG~~i~VDGG~sv  257 (259)
T PRK06124        229 IAGAAVFLASPAASYVNGHVLAVDGGYSV  257 (259)
T ss_pred             HHHHHHHHHCCHHCCCCCCEEEECCCCCC
T ss_conf             99999999584435863853886988318


No 97 
>PRK07326 short chain dehydrogenase; Provisional
Probab=99.51  E-value=2.4e-14  Score=107.04  Aligned_cols=201  Identities=21%  Similarity=0.145  Sum_probs=135.0

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH----C-CCCEE
Q ss_conf             899767882779999999986898799994788765856777620379749997638899999999862----2-78717
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKE----F-QPDAI   77 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~----~-~~d~V   77 (358)
                      +|||||++=||..+++.|+++ |++|+..++...  ............++..+.+|++|.+.++++++.    + ++|++
T Consensus         8 alITGas~GIG~aiA~~la~~-Ga~V~i~~r~~~--~l~~~~~~l~~~~~~~~~~Dv~d~~~v~~~v~~~~~~~G~iDiL   84 (235)
T PRK07326          8 ALVTGGSKGIGFAVAEALAAA-GYRVAICARDES--ELEAAAQELGKRNVLGLACDVRDEADVRQAVDAHVEAFGGLDIL   84 (235)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHH--HHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCEEE
T ss_conf             999382679999999999987-999999989889--99999998423986999963899999999999999982996699


Q ss_pred             EEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             85123433222----22222222222222220247888651232211247842786305543112222222222222222
Q gi|254780920|r   78 VNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNP  153 (358)
Q Consensus        78 iHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p  153 (358)
                      +|.|+......    +.++....+++|+.|+..+..++...     ..+.+.-++|.+||.+-+.           +...
T Consensus        85 VNNAGi~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~~p~-----m~~~~~G~IinisS~ag~~-----------~~~~  148 (235)
T PRK07326         85 VNNAGVGHFAPVEELTLEEWRLVIDTNLTGAFYTIKAAVPA-----LLKRGGGYIVNISSLAGKN-----------PFAG  148 (235)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEEEECHHHHC-----------CCCC
T ss_conf             98887789988265999999999999879999999999999-----9971998899983655507-----------5899


Q ss_pred             CCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222233322100000012333---22222222222223332222222222222222222222222223322113322220
Q gi|254780920|r  154 SSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV  230 (358)
Q Consensus       154 ~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~a  230 (358)
                      .+.|+.||.+.+.+.+..+.+   +|+++..+-|+.|-=+          |.... .         ++....++..+|+|
T Consensus       149 ~~~Y~asK~al~~lt~~la~El~~~gIrVn~v~PG~v~T~----------~~~~~-~---------~~~~~~~l~PedVA  208 (235)
T PRK07326        149 GAAYNASKFGLLGLSEALMLDLRDYDVRVSTIMPGSVATH----------FNGHP-P---------GEDDAWKIQPEDVA  208 (235)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCEECC----------CCCCC-C---------CCCCCCCCCHHHHH
T ss_conf             8369999999999999999984746949999980589078----------88999-8---------62211379999999


Q ss_pred             CCEEECCCCCCC
Q ss_conf             000000122222
Q gi|254780920|r  231 RALYLVLKKGRI  242 (358)
Q Consensus       231 ~~i~~~~~~~~~  242 (358)
                      ++++.++..+..
T Consensus       209 ~av~flls~P~~  220 (235)
T PRK07326        209 QAVLDLLRMPPR  220 (235)
T ss_pred             HHHHHHHCCCCC
T ss_conf             999999849899


No 98 
>PRK05872 short chain dehydrogenase; Provisional
Probab=99.51  E-value=2.7e-14  Score=106.68  Aligned_cols=210  Identities=20%  Similarity=0.150  Sum_probs=138.4

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH--CCCCEEEEECCCCCHHHHHHHHHHC-----CCC
Q ss_conf             899767882779999999986898799994788765856777620--3797499976388999999998622-----787
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS--QSNLFSFLQVDICDRECIRSALKEF-----QPD   75 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~--~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d   75 (358)
                      +|||||++=||..+++.|.++ |++|+.+|+.     ...++...  ...+..++.+|++|.+.++++++..     .+|
T Consensus        12 alITGassGIG~aiA~~la~~-Ga~Vvl~dr~-----~~~l~~~~~~lg~~~~~~~~DVtd~~~v~~~v~~i~~~~G~iD   85 (296)
T PRK05872         12 VFVTGAARGVGAELARRLHAR-GAKVALVDLE-----EAELAALAAELGDRVLTVVADVTDLAAMQAAAEEAVERFGGID   85 (296)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECC-----HHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCC
T ss_conf             999271058999999999987-9989999899-----9999999998388738999827999999999999999719987


Q ss_pred             EEEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             1785123433222----222222222222222202478886512322112478427863055431122222222222222
Q gi|254780920|r   76 AIVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPY  151 (358)
Q Consensus        76 ~ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~  151 (358)
                      ++++.|+......    +.++....+++|+.|+.++..++.-..     .+.+ -++|.+||.+-+...           
T Consensus        86 iLVnNAGi~~~~~~~~~~~e~~~~v~dVNl~G~~~~~ra~lp~m-----~~~~-G~IVnisS~ag~~~~-----------  148 (296)
T PRK05872         86 VVVANAGIASYGSVLQVDPAAFRRVIDVNLLGVFHTVRATLPAV-----IERR-GYVLQVSSLAAFAAA-----------  148 (296)
T ss_pred             EEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHCC-CEEEEEECHHHHCCC-----------
T ss_conf             87655625799764219989972584244599999999999999-----9779-989999605432458-----------


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CC-CCCCCCCCCCC
Q ss_conf             22222233322100000012333---22222222222223332222222222222222222222--22-22233221133
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVF--LY-GDGQNVRDWLY  225 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~--i~-g~g~~~Rdfi~  225 (358)
                      -..+.|+.||.+.+.+.+..+.+   +|+.+.++-|+.|-=|          |++.+....+..  +. .-+...+.-..
T Consensus       149 p~~~aY~ASKaav~~~t~sLa~Ela~~GIrVn~V~PG~V~T~----------m~r~a~~~~~~~~~~~~~~p~p~~~~~~  218 (296)
T PRK05872        149 PGMAPYCASKAGVEAFANALRLEVAHRGVSVGSAYLSWIDTD----------LVRDADADLPAFRELRARLPWPLNRTTS  218 (296)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCCCCCC----------CCCCCCCCCCHHHHHHCCCCCCCCCCCC
T ss_conf             998079999999999999999984001938999970889775----------6747664575567886128998788659


Q ss_pred             CCCCCCCEEECCCCCCCCCCC
Q ss_conf             222200000001222222211
Q gi|254780920|r  226 VEDHVRALYLVLKKGRIGERY  246 (358)
Q Consensus       226 v~D~a~~i~~~~~~~~~~~~f  246 (358)
                      ++++|++++.++++.+.. +|
T Consensus       219 ~~~~a~~i~~~i~r~~~~-v~  238 (296)
T PRK05872        219 VEKCAAAFVDGIERRARR-VY  238 (296)
T ss_pred             HHHHHHHHHHHHHCCCCE-EE
T ss_conf             999999999998448856-99


No 99 
>PRK06483 short chain dehydrogenase; Provisional
Probab=99.50  E-value=1.6e-14  Score=108.00  Aligned_cols=218  Identities=16%  Similarity=0.164  Sum_probs=133.0

Q ss_pred             CE--EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC-----C
Q ss_conf             94--8997678827799999999868987999947887658567776203797499976388999999998622-----7
Q gi|254780920|r    1 MR--LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEF-----Q   73 (358)
Q Consensus         1 Mk--ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~-----~   73 (358)
                      |+  ||||||++=||..++++|+++ |++|++.++...    .....+ ...+...+++|++|++.++++++..     .
T Consensus         1 M~ktVlVTGas~GIG~aiA~~la~~-Ga~Vvi~~r~~~----~~~~~l-~~~~~~~~~~Dv~~~~~v~~~~~~~~~~~g~   74 (236)
T PRK06483          1 MSAPILITGAGQRIGLALAKHLLAQ-GQPVIVSYRSHY----PAIDEL-RQAGATCIQADFSTNAGIMAFIDELKQHTDG   74 (236)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCCH----HHHHHH-HHCCCEEEEECCCCHHHHHHHHHHHHHHHCC
T ss_conf             9987999789988999999999988-998999959847----999999-8569989992279999999999999998399


Q ss_pred             CCEEEEECCCCCCCCC----CCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             8717851234332222----222222222222222024788865123221124784278630554311222222222222
Q gi|254780920|r   74 PDAIVNFAAESHVDRS----ILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDM  149 (358)
Q Consensus        74 ~d~ViHlAa~~~~~~~----~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~  149 (358)
                      +|+++|.|+.......    .++-...+++|+.+...+..++....   .....+...+|++||....-.          
T Consensus        75 id~lVnNAg~~~~~~~~~~~~~~~~~~~~vn~~~~~~~~~~~~~~l---~~~~~~~~~Ii~isS~~~~~g----------  141 (236)
T PRK06483         75 LRAIIHNASDWLAESPGAPLADVLARMMQIHVNAPYLLNLALEDLL---RGHGHAASDIIHITDYVVEKG----------  141 (236)
T ss_pred             CCEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH---HHCCCCCCCCCCCCCHHHHCC----------
T ss_conf             7599977744678883438899999999973358999999989999---975888667765422656424----------


Q ss_pred             CCCCCCCCCCCCCCCEEEECCCCCCCC--CCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222223332210000001233322--222222222223-33222222222222222222222222222332211332
Q gi|254780920|r  150 PYNPSSPYSATKASSDYLVLAWGHTYG--IPVLLSNCSNNY-GPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYV  226 (358)
Q Consensus       150 ~~~p~s~Yg~sK~~~E~~~~~~~~~~~--l~~~ilR~~~vy-Gp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v  226 (358)
                       ......|+.||.+.+.+.+.++.+++  +++-.+.|+.+. .+.+.     +.+..+.+...++..+         .-.
T Consensus       142 -~~~~~~Y~asKaal~~ltr~lA~ela~~IrVN~V~PG~i~~~~~~~-----~~~~~~~~~~~~~~r~---------~~p  206 (236)
T PRK06483        142 -SDKHIAYAASKAALDNMTLSFAAKLAPEVKVNSIAPALILFNEGDD-----AAYRQKALAKSLLKIE---------PGE  206 (236)
T ss_pred             -CCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECEEECCCCCC-----HHHHHHHHHHCCCCCC---------CCH
T ss_conf             -8884789999999999999999997589989999607062189998-----9999999861888899---------898


Q ss_pred             CCCCCCEEECCCC-CCCCCCCCCCCCC
Q ss_conf             2220000000122-2222211135786
Q gi|254780920|r  227 EDHVRALYLVLKK-GRIGERYNIGGNN  252 (358)
Q Consensus       227 ~D~a~~i~~~~~~-~~~~~~fNigs~~  252 (358)
                      +|+++++..+++. ...|+++.+.+|.
T Consensus       207 ~eia~~v~fL~ss~~iTG~~i~VDGG~  233 (236)
T PRK06483        207 EEIIQLVDYLLDSCYVTGRSLPVDGGR  233 (236)
T ss_pred             HHHHHHHHHHHHCCCCCCCEEEECCCC
T ss_conf             999999999993899889818879461


No 100
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase. Members of this protein family are the enzyme 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase. The enzymatic properties were confirmed experimentally in Rhodopseudomonas palustris; the enzyme is homotetrameric, and not sensitive to oxygen. This enzyme is part of proposed pathway for degradation of benzoyl-CoA to 3-hydroxypimeloyl-CoA that differs from the analogous in Thauera aromatica. It also may occur in degradation of the non-aromatic compound cyclohexane-1-carboxylate.
Probab=99.50  E-value=1.4e-14  Score=108.46  Aligned_cols=227  Identities=19%  Similarity=0.171  Sum_probs=140.9

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHHC-----CCC
Q ss_conf             489976788277999999998689879999478876585677762-03797499976388999999998622-----787
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEI-SQSNLFSFLQVDICDRECIRSALKEF-----QPD   75 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~-~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d   75 (358)
                      .+|||||++-||..+++.|+++ |.+|+..|+...... .-...+ ....+..++++|++|++.++++++..     ++|
T Consensus         5 valITG~s~GIG~aia~~la~~-Ga~V~i~~r~~~~~~-~~~~~l~~~g~~~~~~~~Dv~d~~~v~~~v~~~~~~~G~iD   82 (250)
T TIGR03206         5 TAIVTGGGGGIGGATCRRFAEE-GAKVAVFDLNREAAE-KVAADIRAKGGNAQAFACDITDRDSVDTAVAAAEQALGPVD   82 (250)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHHHH-HHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCC
T ss_conf             9999685768999999999987-999999979889999-99999995399289999448999999999999999759997


Q ss_pred             EEEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             1785123433222----222222222222222202478886512322112478427863055431122222222222222
Q gi|254780920|r   76 AIVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPY  151 (358)
Q Consensus        76 ~ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~  151 (358)
                      +++|.|+......    ..++....+++|+.|+.++..++...     ..+.+.-++|++||..-..           +.
T Consensus        83 ilvnnAg~~~~~~~~~~~~~~w~~~~~vNl~g~~~~~~~~~p~-----m~~~~~G~IVnisS~~~~~-----------~~  146 (250)
T TIGR03206        83 VLVNNAGWDKFGPFTKTEPPLWERLIAINLTGALHMHHAVLPG-----MVERGAGRIVNIASDAARV-----------GS  146 (250)
T ss_pred             EEEECCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEEECCHHHCC-----------CC
T ss_conf             9998988899989034999999999999829999999999999-----9974991799965577576-----------89


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCC
Q ss_conf             222222333221000000123332---222222222222333222222222222222222222-2222223322113322
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHV-FLYGDGQNVRDWLYVE  227 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~-~i~g~g~~~Rdfi~v~  227 (358)
                      .+..+|+.||.+...+.+..+.++   |+++-.+-|+.+--|      ++..+.....+.+.. ..+.......-+...+
T Consensus       147 ~~~~~Y~asKaav~~ltk~lA~ela~~gIrVNaV~PG~i~T~------~~~~~~~~~~~~e~~~~~~~~~~Pl~R~g~pe  220 (250)
T TIGR03206       147 SGEAVYAACKGGLVAFSKTMAREHARHGITVNVVCPGPTDTA------LLDDICGGAENPEKLREAFTRAIPLGRLGQPD  220 (250)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCH------HHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHH
T ss_conf             985889999999999999999996532918999976888867------78987644388699999998479989983999


Q ss_pred             CCCCCEEECCCC---CCCCCCCCCCCCC
Q ss_conf             220000000122---2222211135786
Q gi|254780920|r  228 DHVRALYLVLKK---GRIGERYNIGGNN  252 (358)
Q Consensus       228 D~a~~i~~~~~~---~~~~~~fNigs~~  252 (358)
                      |++.++..++..   ...|.++.+.+|-
T Consensus       221 diA~~v~fL~Sd~s~~itG~~i~VDGG~  248 (250)
T TIGR03206       221 DLPGAILFFSSDDASFITGQVLSVSGGL  248 (250)
T ss_pred             HHHHHHHHHHCCHHCCCCCCEEEECCCE
T ss_conf             9999999995834338458838868690


No 101
>PRK08085 gluconate 5-dehydrogenase; Provisional
Probab=99.50  E-value=1.5e-14  Score=108.18  Aligned_cols=224  Identities=14%  Similarity=0.148  Sum_probs=142.2

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH-CCCCEEEEECCCCCHHHHHHHHHH----C-CCC
Q ss_conf             4899767882779999999986898799994788765856777620-379749997638899999999862----2-787
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS-QSNLFSFLQVDICDRECIRSALKE----F-QPD   75 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~-~~~~v~~i~~Di~d~~~l~~~~~~----~-~~d   75 (358)
                      .+|||||++=||+.+++.|+++ |.+|+..|+.... -..-...+. ......++++|++|.+.+++++..    + ++|
T Consensus        11 ~alVTG~~~GIG~aiA~~la~~-Ga~Vvi~~~~~~~-~~~~~~~l~~~g~~~~~~~~Dvtd~~~v~~~v~~~~~~~G~iD   88 (254)
T PRK08085         11 NILITGSAQGIGFLLATGLAEY-GAEIIINDITAER-AEKAVAKLRQEGIKAHAAAFNVTHKQEIEAAIEHIEKDIGPID   88 (254)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHH-HHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             8999685678999999999986-9999999698899-9999999984498189998268999999999999999839986


Q ss_pred             EEEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCC-CCCCCCCCCCCCCC
Q ss_conf             1785123433222----222222222222222202478886512322112478427863055431-12222222222222
Q gi|254780920|r   76 AIVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEV-YGSLDKGLFSEDMP  150 (358)
Q Consensus        76 ~ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~v-Yg~~~~~~~~E~~~  150 (358)
                      +++|.|+......    +.++....+++|+.|+..+..++....     .+.+.-++|.+||.+- .|.           
T Consensus        89 ilVnNAG~~~~~~~~~~~~e~w~~~~~vNl~g~f~~~q~~~~~m-----~~~~~G~IInisS~~~~~~~-----------  152 (254)
T PRK08085         89 VLINNAGIQRRHPFTEFPEQEWNDVIAVNQTAVFLVSQAVARYM-----VKRQAGKIINICSMQSELGR-----------  152 (254)
T ss_pred             EEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHCCCCEEEEEEEHHHCCCC-----------
T ss_conf             99989867888770109899999999998499999999985998-----87399729999773014478-----------


Q ss_pred             CCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222233322100000012333---222222222222233322222222--222222222222222222233221133
Q gi|254780920|r  151 YNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLI--PLAITRMIEGSHVFLYGDGQNVRDWLY  225 (358)
Q Consensus       151 ~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i--~~~i~~~~~g~~~~i~g~g~~~Rdfi~  225 (358)
                       .....|+.||.+.+.+.+..+.+   +++++-.+-|+.+-.|....  ..  +.+...+....|         .+-+..
T Consensus       153 -~~~~~Y~asKaai~~ltr~lA~e~a~~~IrvN~IaPG~i~T~~~~~--~~~~~~~~~~~~~~~P---------l~R~g~  220 (254)
T PRK08085        153 -DTITPYAASKGAVKMLTRGMCVELARHNIQVNGIAPGYFKTEMTKA--LVEDEAFTAWLCKRTP---------AARWGD  220 (254)
T ss_pred             -CCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHH--HCCCHHHHHHHHHCCC---------CCCCCC
T ss_conf             -9856789999999999999999967279699999768898710210--0379999999985799---------889889


Q ss_pred             CCCCCCCEEECCCC---CCCCCCCCCCCCCCCC
Q ss_conf             22220000000122---2222211135786420
Q gi|254780920|r  226 VEDHVRALYLVLKK---GRIGERYNIGGNNERK  255 (358)
Q Consensus       226 v~D~a~~i~~~~~~---~~~~~~fNigs~~~~s  255 (358)
                      .+|++.++..++..   ...|+++++.+|-.++
T Consensus       221 pedia~~~~fLaS~~ss~iTG~~i~VDGG~~~~  253 (254)
T PRK08085        221 PQELIGAAVFLSSKASDFVNGHLLFVDGGMLVA  253 (254)
T ss_pred             HHHHHHHHHHHHCCHHCCCCCCEEEECCCEEEE
T ss_conf             999999999995752248658749988988865


No 102
>PRK05650 short chain dehydrogenase; Provisional
Probab=99.50  E-value=4.8e-14  Score=105.14  Aligned_cols=210  Identities=17%  Similarity=0.052  Sum_probs=131.5

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHH-HHHH-CCCCEEEEECCCCCHHHHHHHHHH-----CCC
Q ss_conf             489976788277999999998689879999478876585677-7620-379749997638899999999862-----278
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSL-KEIS-QSNLFSFLQVDICDRECIRSALKE-----FQP   74 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~-~~~~-~~~~v~~i~~Di~d~~~l~~~~~~-----~~~   74 (358)
                      |||||||+.=||..+++.|.+ .|++|+..|+....  .... ..+. ....+.++.+|++|+++++.+++.     ..+
T Consensus         2 rVlITGassGIG~alA~~la~-~G~~V~l~~r~~~~--l~~~~~~l~~~g~~~~~~~~Dvt~~~~~~~~~~~v~~~~g~i   78 (270)
T PRK05650          2 RVMITGAASGLGRAIALRWAR-EGWRLALADVNEEG--GEETLKELREAGGDGFYQRCDVRDYSQLTALAQACEEKWGGI   78 (270)
T ss_pred             EEEEECCCCHHHHHHHHHHHH-CCCEEEEEECCHHH--HHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC
T ss_conf             799988764999999999998-89989999798899--999999998449928999845899999999999999983997


Q ss_pred             CEEEEECCCCCCCCC----CCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             717851234332222----2222222222222220247888651232211247842786305543112222222222222
Q gi|254780920|r   75 DAIVNFAAESHVDRS----ILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMP  150 (358)
Q Consensus        75 d~ViHlAa~~~~~~~----~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~  150 (358)
                      |++++.|+.......    .++....+++|+.|+.++..+..-.     ..+.+.-++|.+||.+-+-..          
T Consensus        79 DiLVNNAGi~~~g~~~~~~~e~~~~~~~vNl~g~~~~~~~~lp~-----m~~~~~G~IvnisS~ag~~~~----------  143 (270)
T PRK05650         79 DVIVNNAGVASGGFFEELSLEDWDWQIAINLMGVVKGCKAFLPL-----FKEQGKGRIVNIASMAGLMQG----------  143 (270)
T ss_pred             CEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEEECCHHHCCCC----------
T ss_conf             78962476679986201999999999999659999999999976-----755699589998585552899----------


Q ss_pred             CCCCCCCCCCCCCCEEEECCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCC
Q ss_conf             2222222333221000000123---3322222222222223332222222222222222222222--2222233221133
Q gi|254780920|r  151 YNPSSPYSATKASSDYLVLAWG---HTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVF--LYGDGQNVRDWLY  225 (358)
Q Consensus       151 ~~p~s~Yg~sK~~~E~~~~~~~---~~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~--i~g~g~~~Rdfi~  225 (358)
                       --.+.|+.||.+..-+.+..+   ..+|+.+.++-|+.|--|-.          .+.....+..  ..+ .-..+.-+.
T Consensus       144 -p~~~~Y~asK~av~~~tesL~~El~~~gI~V~~v~PG~v~T~~~----------~~~~~~~~~~~~~~~-~~~~~~~~~  211 (270)
T PRK05650        144 -PAMSSYNVAKAGVVALSETLLVELADDEIGVHVVCPSFFQTNLL----------DSFRGPNPAMKAQVG-KLLEKSPIT  211 (270)
T ss_pred             -CCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCC----------CCCCCCCCHHHHHHH-HHHHCCCCC
T ss_conf             -99667999999999999999998532196899997388986656----------577888804678887-664148999


Q ss_pred             CCCCCCCEEECCCCCC
Q ss_conf             2222000000012222
Q gi|254780920|r  226 VEDHVRALYLVLKKGR  241 (358)
Q Consensus       226 v~D~a~~i~~~~~~~~  241 (358)
                      .+|+|+.++.++++++
T Consensus       212 ~e~vA~~i~~~i~~~~  227 (270)
T PRK05650        212 AADIADYIYQQVAKGE  227 (270)
T ss_pred             HHHHHHHHHHHHHCCC
T ss_conf             9999999999997599


No 103
>PRK08017 short chain dehydrogenase; Provisional
Probab=99.50  E-value=6e-14  Score=104.55  Aligned_cols=211  Identities=18%  Similarity=0.079  Sum_probs=132.3

Q ss_pred             CE--EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH------C
Q ss_conf             94--899767882779999999986898799994788765856777620379749997638899999999862------2
Q gi|254780920|r    1 MR--LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKE------F   72 (358)
Q Consensus         1 Mk--ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~------~   72 (358)
                      |+  ||||||++=||..++++|+++ |++|++.++.     ...+.... ...++.+.+|++|.+.+++++.+      .
T Consensus         1 M~K~vlITGassGIG~a~A~~la~~-G~~V~~~~r~-----~~~l~~~~-~~~~~~~~~D~~~~~~~~~~~~~~~~~~~g   73 (256)
T PRK08017          1 MQKSVLITGCSSGIGLESALELKRQ-GFRVLAGCRK-----PDDVARMN-SMGFTGVLIDLDSPESVDRAADEVIALTDN   73 (256)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHC-CCEEEEEECC-----HHHHHHHH-HCCCCEEEEECCCHHHHHHHHHHHHHHHCC
T ss_conf             9978999658768999999999987-9999999699-----89999998-569946998358989999999999998489


Q ss_pred             CCCEEEEECCCCCCC----CCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCC
Q ss_conf             787178512343322----2222222222222222202478886512322112478427863055431122222222222
Q gi|254780920|r   73 QPDAIVNFAAESHVD----RSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSED  148 (358)
Q Consensus        73 ~~d~ViHlAa~~~~~----~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~  148 (358)
                      ..|.++|.|+.....    .+.++....+++|+.|+.++..++...     ....+.-++|++||.+-+-.         
T Consensus        74 ~id~linnAG~~~~~~~~~~~~~~~~~~~~vN~~g~~~~~~~~lp~-----m~~~~~G~IV~isS~ag~~~---------  139 (256)
T PRK08017         74 RLYGIFNNAGFGVYGPLSTISRQQMEQQFSANFFGAHQLTMRLLPA-----MLPHGEGRIVMTSSVMGLIS---------  139 (256)
T ss_pred             CEEEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHCCHH-----HHHCCCCEEEEEECHHHCCC---------
T ss_conf             7489998896677888587664533467632113320276641712-----21048944999957666488---------


Q ss_pred             CCCCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222222233322100000012333---222222222222233322222222222222222222222222233221133
Q gi|254780920|r  149 MPYNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLY  225 (358)
Q Consensus       149 ~~~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~  225 (358)
                        ....+.|+.||.+.+.+.+..+.+   +|+.+..+.|+.|--|-.  ++     +.+....++...  .+...+-.+.
T Consensus       140 --~p~~~~Y~asKaal~~~~~sL~~El~~~gI~V~~V~PG~v~T~~~--~~-----~~~~~~~~~~~~--~~~~~~~~~~  208 (256)
T PRK08017        140 --TPGRGAYAASKYALEAWSDALRMELRHSGIKVSLIEPGPIRTRFT--DN-----VNQTQSDKPVEN--PGIAARFTLG  208 (256)
T ss_pred             --CCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHH--CC-----CCCCCCCCCCCC--CCHHHCCCCC
T ss_conf             --999748999999999999999998462192899997289977201--05-----251133354435--1023114799


Q ss_pred             CCCCCCCEEECCCCCCCC
Q ss_conf             222200000001222222
Q gi|254780920|r  226 VEDHVRALYLVLKKGRIG  243 (358)
Q Consensus       226 v~D~a~~i~~~~~~~~~~  243 (358)
                      .+++|+.++.++++++..
T Consensus       209 pe~vA~~i~~ai~~~~~~  226 (256)
T PRK08017        209 PEAVVDKVRHAFESPKPK  226 (256)
T ss_pred             HHHHHHHHHHHHHCCCCE
T ss_conf             999999999999569983


No 104
>PRK07069 short chain dehydrogenase; Validated
Probab=99.50  E-value=2.3e-14  Score=107.13  Aligned_cols=224  Identities=16%  Similarity=0.129  Sum_probs=137.1

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHH---HCCCCEEEEECCCCCHHHHHHHHHH----C-C
Q ss_conf             489976788277999999998689879999478876585677762---0379749997638899999999862----2-7
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEI---SQSNLFSFLQVDICDRECIRSALKE----F-Q   73 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~---~~~~~v~~i~~Di~d~~~l~~~~~~----~-~   73 (358)
                      |.|||||++=||..+++.|+++ |.+|+..|+........-.+.+   ........+++|++|.+.++++++.    + .
T Consensus         1 ~AlVTGgs~GIG~aia~~la~~-Ga~V~i~d~~~~~~~~~~~~~l~~~~~~~~~~~~~~Dv~~~~~v~~~v~~~~~~~G~   79 (251)
T PRK07069          1 RAFITGAAGGLGRAIARRMAEQ-GARVFLTDINDAAALDAFAAEINAAHGEGVAFAAVQDVTDEAQWQALLAQAADAMGG   79 (251)
T ss_pred             CEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHHHHHHCCC
T ss_conf             9799855788999999999986-999999968943589999999986159963999957799999999999999998299


Q ss_pred             CCEEEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             871785123433222----2222222222222222024788865123221124784278630554311222222222222
Q gi|254780920|r   74 PDAIVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDM  149 (358)
Q Consensus        74 ~d~ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~  149 (358)
                      +|+++|.|+......    +.++....+++|+.|+..+.+++....     .+.+.-++|.+||..-+-..         
T Consensus        80 iDilVNnAGi~~~~~~~~~~~~~w~~~~~vNl~g~f~~~~~~~p~m-----~~~~~G~IVnisS~~~~~~~---------  145 (251)
T PRK07069         80 LSVLVNNAGVGSFGAIEQIELDEWRRVMAINVESIVLGCKHALPYL-----RASQPASIVNISSVAAFKAE---------  145 (251)
T ss_pred             CCEEEECCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHCCCCEEEEECCHHHCCCC---------
T ss_conf             9899989999999990349999999999999789999999999999-----96699789992867545779---------


Q ss_pred             CCCCCCCCCCCCCCCEEEECCCCCCCC-----CCCCCCCCCCCCCCCCCC--CCC-CCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222223332210000001233322-----222222222223332222--222-222222222222222222223322
Q gi|254780920|r  150 PYNPSSPYSATKASSDYLVLAWGHTYG-----IPVLLSNCSNNYGPYHFP--EKL-IPLAITRMIEGSHVFLYGDGQNVR  221 (358)
Q Consensus       150 ~~~p~s~Yg~sK~~~E~~~~~~~~~~~-----l~~~ilR~~~vyGp~~~~--~~~-i~~~i~~~~~g~~~~i~g~g~~~R  221 (358)
                        .-...|+.||.+...+.+..+.+++     +++-.+-|+.+-.|....  ... -....+++.+.-|         .+
T Consensus       146 --~~~~~Y~asKaal~~ltk~lA~el~~~gi~IrvN~i~Pg~i~T~~~~~~~~~~~~~~~~~~~~~~~P---------l~  214 (251)
T PRK07069        146 --PDYTAYNASKAAVASLTKSIALDCARRGLDVRCNSIHPAFIRTGIVDPIFRRLGEEEATRKLARGIP---------LG  214 (251)
T ss_pred             --CCCHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEECCCCCHHHHHHHHHCCCHHHHHHHHHCCC---------CC
T ss_conf             --9966899999999999999999987719968999988686886355788761384999999985799---------99


Q ss_pred             CCCCCCCCCCCEEECCCC---CCCCCCCCCCCC
Q ss_conf             113322220000000122---222221113578
Q gi|254780920|r  222 DWLYVEDHVRALYLVLKK---GRIGERYNIGGN  251 (358)
Q Consensus       222 dfi~v~D~a~~i~~~~~~---~~~~~~fNigs~  251 (358)
                      -+...+|+++++..++..   .-.|+++.+.+|
T Consensus       215 R~g~pedia~~v~fL~Sd~s~~iTG~~i~VDGG  247 (251)
T PRK07069        215 RLGEPDDVAHAVLYLASDESRFVTGAELVIDGG  247 (251)
T ss_pred             CCCCHHHHHHHHHHHHCCHHCCCCCCEEEECCC
T ss_conf             985899999999999585424825861773824


No 105
>pfam08659 KR KR domain. This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain. It uses NADPH to reduce the keto group to a hydroxy group.
Probab=99.49  E-value=4.3e-14  Score=105.43  Aligned_cols=163  Identities=21%  Similarity=0.282  Sum_probs=113.3

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCE-EEEEECCCCCCC--HHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHHC-----
Q ss_conf             48997678827799999999868987-999947887658--5677762-03797499976388999999998622-----
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQ-VLVIDKLTYAGN--LNSLKEI-SQSNLFSFLQVDICDRECIRSALKEF-----   72 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~-V~~~d~~~~~~~--~~~~~~~-~~~~~v~~i~~Di~d~~~l~~~~~~~-----   72 (358)
                      .||||||++=||..++++|+++ |.+ |+.+++......  ...++.+ ....++.++++|++|++.++++++..     
T Consensus         2 tvlITGas~GIG~aia~~la~~-Ga~~vvl~~r~~~~~~~~~~~~~~l~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g   80 (181)
T pfam08659         2 TYLVTGGLGGLGLELARWLAER-GARHLVLLSRSGAPDPEAEALLAELEARGAEVTVVACDVSDRDAVAALLAEIRADGP   80 (181)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCCEEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHCC
T ss_conf             8999687878999999999987-997899986897662999999999996599699997568999999988865798739


Q ss_pred             CCCEEEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCC-CCCCCCCCCCCC
Q ss_conf             7871785123433222----22222222222222220247888651232211247842786305543-112222222222
Q gi|254780920|r   73 QPDAIVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDE-VYGSLDKGLFSE  147 (358)
Q Consensus        73 ~~d~ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~-vYg~~~~~~~~E  147 (358)
                      .+|.+||.|+......    +.++-...+++|+.|+.++..+.+.         ....+||++||.+ .+|.+       
T Consensus        81 ~id~lvnnAG~~~~~~~~~~~~~~~~~~~~vnv~g~~~l~~~~~~---------~~~~~IV~iSS~ag~~g~~-------  144 (181)
T pfam08659        81 PLRGVIHAAGVLRDALLANMTAEDFARVLAPKVTGAWNLHEATRD---------RPLDFFVLFSSIAGVLGSP-------  144 (181)
T ss_pred             CEEEEEEECCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHH---------HCCCCCCEECCHHHCCCCC-------
T ss_conf             848999544667885688828999999999998999999999651---------0344000230076647899-------


Q ss_pred             CCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222222333221000000123332222222222222
Q gi|254780920|r  148 DMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLLSNCSNN  187 (358)
Q Consensus       148 ~~~~~p~s~Yg~sK~~~E~~~~~~~~~~~l~~~ilR~~~v  187 (358)
                           ..+.|+.+|.+.+-+++.++.+ |+++..+-|+.+
T Consensus       145 -----~~~~Y~AsKa~l~~la~~l~~~-Girvn~iapG~i  178 (181)
T pfam08659       145 -----GQANYAAANAFLDALAHYRRAQ-GLPATSINWGPW  178 (181)
T ss_pred             -----CCHHHHHHHHHHHHHHHHHHHC-CCCEEEEECCCC
T ss_conf             -----9489999999999999999865-992999858876


No 106
>PRK05993 short chain dehydrogenase; Provisional
Probab=99.49  E-value=9.4e-14  Score=103.37  Aligned_cols=162  Identities=18%  Similarity=0.122  Sum_probs=115.6

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH------CCCCE
Q ss_conf             899767882779999999986898799994788765856777620379749997638899999999862------27871
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKE------FQPDA   76 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~------~~~d~   76 (358)
                      ||||||+.=||..++++|.++ |++|++.++.     ...+..+ ..++++.+.+|++|.+.++++++.      .+.|+
T Consensus         7 vlITGassGIG~alA~~la~~-G~~V~~~~R~-----~~~l~~l-~~~~~~~~~~Dv~d~~~v~~~v~~~~~~~~g~id~   79 (277)
T PRK05993          7 ILITGCSSGIGAYCAHALQKR-GWRVFATCRK-----PEDIAAL-EAEGLEAFYLDYAEPESIAALVAQVLELSGGKLDA   79 (277)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECC-----HHHHHHH-HHCCCEEEEEECCCHHHHHHHHHHHHHHHCCCEEE
T ss_conf             999256869999999999987-9999999799-----9999999-84898199972667799999999999980897069


Q ss_pred             EEEECCCCCCCCCC----CCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             78512343322222----22222222222222024788865123221124784278630554311222222222222222
Q gi|254780920|r   77 IVNFAAESHVDRSI----LGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYN  152 (358)
Q Consensus        77 ViHlAa~~~~~~~~----~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~  152 (358)
                      ++|.|+......-.    ++-...+++|+.|+.++..++.-.     ..+.+.-++|++||..-+-           +.-
T Consensus        80 lvNnAg~~~~g~~e~~~~~~~~~~~~vN~~g~~~~~~~~lP~-----m~~~~~G~IVnisSi~g~~-----------~~p  143 (277)
T PRK05993         80 LFNNGAYGQPGAVEDLPVEALRAQFEANFFGWHDLTRRIIPV-----MRKQGHGRIVQCSSILGLV-----------PMK  143 (277)
T ss_pred             EEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----HCCCCCCEEEEECCHHHCC-----------CCC
T ss_conf             996664356770888679999999887018999999997233-----1348983899988844488-----------899


Q ss_pred             CCCCCCCCCCCCEEEECCCCC---CCCCCCCCCCCCCC
Q ss_conf             222223332210000001233---32222222222222
Q gi|254780920|r  153 PSSPYSATKASSDYLVLAWGH---TYGIPVLLSNCSNN  187 (358)
Q Consensus       153 p~s~Yg~sK~~~E~~~~~~~~---~~~l~~~ilR~~~v  187 (358)
                      ..+.|+.||.+.+-+.+.++.   .+|++++++-|+.|
T Consensus       144 ~~~~Y~aSK~Av~~~~~sLr~El~~~gI~V~~i~PG~v  181 (277)
T PRK05993        144 YRGAYNASKFAIEGLSDTLRMELQGSGIHVSLIEPGPI  181 (277)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCC
T ss_conf             98389999999999999999985632868999964888


No 107
>PRK07985 oxidoreductase; Provisional
Probab=99.49  E-value=5.1e-14  Score=104.98  Aligned_cols=223  Identities=16%  Similarity=0.115  Sum_probs=144.3

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHC--CCCEEEEECCCCCHHHHHHHHHHC-----CC
Q ss_conf             48997678827799999999868987999947887658567776203--797499976388999999998622-----78
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQ--SNLFSFLQVDICDRECIRSALKEF-----QP   74 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~--~~~v~~i~~Di~d~~~l~~~~~~~-----~~   74 (358)
                      .+|||||++=||..+++.|++. |.+|+..++...........+...  ..+..++++|+++.+.++.+++..     ++
T Consensus        51 valVTGas~GIG~aiA~~lA~~-GA~Vvi~~~~~~~~~a~~~~~~~~~~g~~~~~~~~Dvs~~~~v~~lv~~~~~~fG~i  129 (294)
T PRK07985         51 KALVTGGDSGIGRAAAIAYARE-GADVAISYLPVEEEDAQDVKKIIEECGRKAVLLPGDLSDEKFARSLVHEAHKALGGL  129 (294)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC
T ss_conf             7999172669999999999987-999999429966678999999999729958999767899999999999999985998


Q ss_pred             CEEEEECCCCCC-C----CCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             717851234332-2----22222222222222222024788865123221124784278630554311222222222222
Q gi|254780920|r   75 DAIVNFAAESHV-D----RSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDM  149 (358)
Q Consensus        75 d~ViHlAa~~~~-~----~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~  149 (358)
                      |+.++.|+.... +    .+.++....+++|+.|+..+..++....      +. .-++|.+||...+..          
T Consensus       130 DiLVnnAG~~~~~~~~~~~s~e~~~~~~~vNl~g~~~~~qaa~p~m------~~-gGsIInisS~~~~~~----------  192 (294)
T PRK07985        130 DIMALVAGKQVAIPDIADLTSEQFQKTFAINVFALFWLTQEAIPLL------PK-GASIITTSSIQAYQP----------  192 (294)
T ss_pred             CEEEEECCCCCCCCCHHHCCHHHHHHHHHHHCHHHHHHHHHHHHHH------CC-CCEEEEECCHHHCCC----------
T ss_conf             8899806666688883658999999999986534788888767764------24-877999666465278----------


Q ss_pred             CCCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222233322100000012333---2222222222222333222222222222222222222222222332211332
Q gi|254780920|r  150 PYNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYV  226 (358)
Q Consensus       150 ~~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v  226 (358)
                       ......|+.||.+.+.+.+..+.+   +|+++-.+-|+.|.-+...........+..+.+.-|         .+-+...
T Consensus       193 -~p~~~~Y~asKaav~~lTrslA~Ela~~gIRVN~IaPG~i~T~~~~~~~~~~~~~~~~~~~~P---------l~R~g~p  262 (294)
T PRK07985        193 -SPHLLDYAATKAAILNYSRGLAKQVAEKGIRVNIVAPGPIWTALQISGGQTQDKIPQFGQQTP---------MKRAGQP  262 (294)
T ss_pred             -CCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCHHCCCCCHHHHHHHHHCCC---------CCCCCCH
T ss_conf             -887307799999999999999999653392999996387877102027999999999985699---------8899399


Q ss_pred             CCCCCCEEECCCC---CCCCCCCCCCCCC
Q ss_conf             2220000000122---2222211135786
Q gi|254780920|r  227 EDHVRALYLVLKK---GRIGERYNIGGNN  252 (358)
Q Consensus       227 ~D~a~~i~~~~~~---~~~~~~fNigs~~  252 (358)
                      +|+|.++..++..   ...|+++.|.+|.
T Consensus       263 eDIA~av~fLaS~~a~~ITGq~i~VDGG~  291 (294)
T PRK07985        263 AELAPVYVYLASQESSYVTAEVHGVCGGE  291 (294)
T ss_pred             HHHHHHHHHHHCCHHCCCCCCEEEECCCC
T ss_conf             99999999995824367267227988760


No 108
>PRK09186 flagellin modification protein A; Provisional
Probab=99.49  E-value=3.2e-14  Score=106.26  Aligned_cols=227  Identities=19%  Similarity=0.180  Sum_probs=141.3

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH--CCCCEEEEECCCCCHHHHHHHHHH-----CCC
Q ss_conf             4899767882779999999986898799994788765856777620--379749997638899999999862-----278
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS--QSNLFSFLQVDICDRECIRSALKE-----FQP   74 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~--~~~~v~~i~~Di~d~~~l~~~~~~-----~~~   74 (358)
                      .+|||||+|=||..+++.|+++ |.+|+..|+..... ....+.+.  ...++.++++|++|.+.++++++.     ..+
T Consensus         6 ~~lVTGgs~GIG~aia~~la~~-Ga~V~~~~~~~~~~-~~~~~~l~~~~~~~v~~~~~Dvt~~~~v~~~~~~~~~~~g~i   83 (255)
T PRK09186          6 TILITGAGGLIGSALVKAILEA-GGIVIAADINKEAL-NKLLESLGTIEKTKLTLVELDITDQESLEEFLSKSQERYGKI   83 (255)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHHH-HHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCC
T ss_conf             8999795868999999999987-99999996988999-999999987059807999846899999999999999981997


Q ss_pred             CEEEEECCCCCCC-------CCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCC-CCCCCC
Q ss_conf             7178512343322-------22222222222222222024788865123221124784278630554311222-222222
Q gi|254780920|r   75 DAIVNFAAESHVD-------RSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSL-DKGLFS  146 (358)
Q Consensus        75 d~ViHlAa~~~~~-------~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~-~~~~~~  146 (358)
                      |+++|+|+.....       .+.++....+++|+.|+..+..++...     ..+.+.-++|.+||..  |.. +....-
T Consensus        84 d~lVnnA~~~~~~~~~~~~~~~~~~~~~~~~vnl~~~~~~~~~~~~~-----m~~~~~G~IVnisSi~--g~~~~~~~~~  156 (255)
T PRK09186         84 DGAVNCAYPRNKQYGKKFFDVSLDDFNENLSLHLGSSFLFSQQFAKY-----FKKQGGGSLVNISSIY--GVVAPKFEIY  156 (255)
T ss_pred             CEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCCEEEECCHH--HHCCCCCCCC
T ss_conf             78997576678767777010999999999999839999999999998-----8742897389956678--7347642112


Q ss_pred             CCCCCCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222222233322100000012333---2222222222222333222222222222222222222222222332211
Q gi|254780920|r  147 EDMPYNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDW  223 (358)
Q Consensus       147 E~~~~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdf  223 (358)
                      +..+..+...|+.+|.+.+.+.+..+.+   +|+++-.+-|+.+....      ...+..+..+..+         .+.+
T Consensus       157 ~g~~~~~~~~Y~asKaal~~ltr~lA~e~a~~gIrVN~VaPG~i~~~~------~~~~~~~~~~~~~---------~~~~  221 (255)
T PRK09186        157 EGTSMTSPVEYAAIKSGIIHLTKYLAKYFKDSNIRVNCVSPGGILDNQ------PEAFLNAYKKSCN---------GKGM  221 (255)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCC------CHHHHHHHHHHCC---------CCCC
T ss_conf             687654467679988999999999999967589899998557688999------8999999986355---------7799


Q ss_pred             CCCCCCCCCEEECCCC---CCCCCCCCCCCCC
Q ss_conf             3322220000000122---2222211135786
Q gi|254780920|r  224 LYVEDHVRALYLVLKK---GRIGERYNIGGNN  252 (358)
Q Consensus       224 i~v~D~a~~i~~~~~~---~~~~~~fNigs~~  252 (358)
                      ...+|++.++..++..   .-.|+.+.+.+|-
T Consensus       222 ~~p~dia~~v~fL~Sd~s~~iTGq~i~VDGG~  253 (255)
T PRK09186        222 LDPEDICGSLVFLLSDQSKYITGQNIIVDDGF  253 (255)
T ss_pred             CCHHHHHHHHHHHHCCHHCCCCCCEEEECCCC
T ss_conf             89999999999995705368018528838580


No 109
>PRK07577 short chain dehydrogenase; Provisional
Probab=99.49  E-value=2.1e-14  Score=107.37  Aligned_cols=214  Identities=19%  Similarity=0.180  Sum_probs=141.4

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH----CCCCEE
Q ss_conf             4899767882779999999986898799994788765856777620379749997638899999999862----278717
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKE----FQPDAI   77 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~----~~~d~V   77 (358)
                      ++|||||++-||..+++.|+++ |++|+.+++...       +    .-..+++.+|++|.+.++++++.    +.+|++
T Consensus         5 ~alITGas~GIG~aia~~la~~-G~~Vv~~~r~~~-------~----~~~~~~~~~D~~d~~~~~~~~~~~~~~~~id~L   72 (234)
T PRK07577          5 TVLVTGATKGIGLALSLRLANL-GHQVIGIARSAI-------D----DFPGELFACDLADIEQTAATLAQINEIHPVDAI   72 (234)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCCC-------C----CCCCEEEEEECCCHHHHHHHHHHHHHHCCCCEE
T ss_conf             8999377888999999999987-999999634754-------4----789769999579999999999999976999899


Q ss_pred             EEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             85123433222----22222222222222220247888651232211247842786305543112222222222222222
Q gi|254780920|r   78 VNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNP  153 (358)
Q Consensus        78 iHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p  153 (358)
                      +|.|+......    ..++....+++|+.|...+..++....     ...+.-++|++||.+++|.+            .
T Consensus        73 VnnAG~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m-----~~~~~G~IInisS~~~~~~~------------~  135 (234)
T PRK07577         73 VNNVGIALPQPLGKIDLAALQDVYDLNVRAAVQVTQAFLEGM-----KLREQGRIVNICSRAIFGAL------------D  135 (234)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHCCCCCEEEEECHHCCCCC------------C
T ss_conf             989988999880559999999999999799999999999998-----87489867999601102788------------7


Q ss_pred             CCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222333221000000123332---222222222222333222222-222222222222222222222332211332222
Q gi|254780920|r  154 SSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEK-LIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDH  229 (358)
Q Consensus       154 ~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~-~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~  229 (358)
                      ...|+.||.+.+.+.+.++.++   |+++-.+-|+.+--+.-.... .-+....+....-|+.         -+...+|+
T Consensus       136 ~~~Y~asKaal~~ltkslA~ela~~gIrVNaV~PG~i~T~~~~~~~~~~~~~~~~~~~~~P~~---------R~g~p~ei  206 (234)
T PRK07577        136 RTSYSAAKSALVGCTRTWALELAEYGITVNAVAPGPIETELFRQTRPVGSEEEKRVLASIPMR---------RLGTPEEV  206 (234)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCHHHHHCCCCCHHHHHHHHHCCCCC---------CCCCHHHH
T ss_conf             477899999999999999999865596999995488977355422758889999998579999---------98889999


Q ss_pred             CCCEEECCCC---CCCCCCCCCCCCCC
Q ss_conf             0000000122---22222111357864
Q gi|254780920|r  230 VRALYLVLKK---GRIGERYNIGGNNE  253 (358)
Q Consensus       230 a~~i~~~~~~---~~~~~~fNigs~~~  253 (358)
                      ++.+..++..   ...|+++.+.+|.+
T Consensus       207 a~~v~fL~s~~s~~itGq~i~VdGG~s  233 (234)
T PRK07577        207 AAAIAFLLSDDAGFITGQVLGVDGGGS  233 (234)
T ss_pred             HHHHHHHHCCHHCCCCCCEEEECCCCC
T ss_conf             999999958521581282478488958


No 110
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=99.49  E-value=2e-14  Score=107.45  Aligned_cols=214  Identities=19%  Similarity=0.162  Sum_probs=141.8

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC-CCCEEEEE
Q ss_conf             48997678827799999999868987999947887658567776203797499976388999999998622-78717851
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEF-QPDAIVNF   80 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~-~~d~ViHl   80 (358)
                      .+|||||++=||..+++.|+++ |++|+++|+...         .....++.++++|++|. .++++++.+ ++|+++|.
T Consensus         7 ~alVTGas~GIG~aia~~~a~~-Ga~V~~~d~~~~---------~~~~~~~~~~~~Dv~~~-~v~~~~~~~g~iDiLvNn   75 (237)
T PRK06550          7 TVLVTGAASGIGLAQARAFLEQ-GAHVYGVDKSDK---------PDLSGNFHFIQLDLSSD-KLEPLFKVVPSVDILCNT   75 (237)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHH---------HHCCCCEEEEECCCCHH-HHHHHHHHCCCCCEEEEC
T ss_conf             9999374779999999999987-999999708612---------43069738998638889-999999975999799989


Q ss_pred             CCCCCC-----CCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCC-CCCCCCCCCCCCCCCCCC
Q ss_conf             234332-----22222222222222222202478886512322112478427863055431-122222222222222222
Q gi|254780920|r   81 AAESHV-----DRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEV-YGSLDKGLFSEDMPYNPS  154 (358)
Q Consensus        81 Aa~~~~-----~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~v-Yg~~~~~~~~E~~~~~p~  154 (358)
                      |+....     +.+.++....+++|+.|+..+..++...     ..+.+.-++|.+||.+- .|.            ...
T Consensus        76 AGi~~~~~~~~~~~~e~w~~~~~vNl~~~~~~~~~~~p~-----m~~~~~G~IVnisS~~g~~~~------------~~~  138 (237)
T PRK06550         76 AGILDDYKPLLDTSDEEWQHIFDINLFSTFLLTRAYLPQ-----MLEKKSGVIINMCSIAGFVAG------------GGG  138 (237)
T ss_pred             CCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHHCCEEEEEECCHHHCCCC------------CCC
T ss_conf             888999999055999999999999729999999999999-----998099189995463435579------------986


Q ss_pred             CCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22233322100000012333---2222222222222333222222222-2222222222222222223322113322220
Q gi|254780920|r  155 SPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIP-LAITRMIEGSHVFLYGDGQNVRDWLYVEDHV  230 (358)
Q Consensus       155 s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~-~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~a  230 (358)
                      ..|+.||.+...+.+..+.+   +|+++-.+-|+.+--|.......-+ .+...+.+.-|         .+-|...+|+|
T Consensus       139 ~~Y~asKaal~~lTrslA~ela~~gIrVNaVaPG~i~T~m~~~~~~~~~~~~~~~~~~~P---------l~R~g~p~eiA  209 (237)
T PRK06550        139 VAYTASKHALAGFTKQLALDYAKDGIQVFGIAPGAIKTPMNAADFAEPGGMADWVARETP---------IKRWAEPEEVA  209 (237)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCHHHHCCCCHHHHHHHHHCCC---------CCCCCCHHHHH
T ss_conf             889999999999999999996501959999976889873201003596999999985699---------99978899999


Q ss_pred             CCEEECCCC---CCCCCCCCCCCCC
Q ss_conf             000000122---2222211135786
Q gi|254780920|r  231 RALYLVLKK---GRIGERYNIGGNN  252 (358)
Q Consensus       231 ~~i~~~~~~---~~~~~~fNigs~~  252 (358)
                      .++..++..   ...|+++.+.+|-
T Consensus       210 ~~v~FLaSd~as~iTG~~i~VDGG~  234 (237)
T PRK06550        210 ELTLFLASGKADYMQGTIVPIDGGW  234 (237)
T ss_pred             HHHHHHHCCHHCCCCCCEEEECCCC
T ss_conf             9999995855338148628968273


No 111
>PRK07067 sorbitol dehydrogenase; Provisional
Probab=99.49  E-value=3.1e-14  Score=106.28  Aligned_cols=232  Identities=17%  Similarity=0.122  Sum_probs=143.8

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             8997678827799999999868987999947887658567776203797499976388999999998622-----78717
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEF-----QPDAI   77 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d~V   77 (358)
                      +|||||++=||..+++.|+++ |.+|+..|+....  ...... ....+..++++|++|.+.++++++..     ++|++
T Consensus         8 alVTGas~GIG~aia~~la~~-Ga~V~i~d~~~~~--~~~~~~-~~g~~~~~~~~Dvt~~~~v~~~v~~~~~~~G~iDiL   83 (256)
T PRK07067          8 ALLTGAASGIGEAVAQRYLRE-GARVVLADIKPAR--AALAAL-EIGPAAVAVSLDVTRQDSIDRIVAAAVERFGGIDIL   83 (256)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHH--HHHHHH-HHCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             999376778999999999987-9999999798899--999999-819975999984899999999999999981999899


Q ss_pred             EEECCCCCCC----CCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             8512343322----222222222222222220247888651232211247842786305543112222222222222222
Q gi|254780920|r   78 VNFAAESHVD----RSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNP  153 (358)
Q Consensus        78 iHlAa~~~~~----~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p  153 (358)
                      +|.|+.....    .+.++....+++|+.|+..+..++-....    .+...-++|.+||...+-           +...
T Consensus        84 VNNAGi~~~~~~~~~~~e~~~~~~~vNl~g~f~~~~~~~~~m~----~~~~~G~IVnisS~~g~~-----------~~~~  148 (256)
T PRK07067         84 VNNAALFDMAPILEISRDVYDRLFAVNVKGLFFLMQAVAQHMV----EQGRGGKIINMASQAGRR-----------GEAL  148 (256)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHH----HCCCCCEEEEEEEHHHCC-----------CCCC
T ss_conf             9899889998813499999999999851778999999999999----808995599984164366-----------8988


Q ss_pred             CCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222233322100000012333---222222222222233322-2222222222222222222222222332211332222
Q gi|254780920|r  154 SSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYH-FPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDH  229 (358)
Q Consensus       154 ~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~-~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~  229 (358)
                      .++|+.||.+...+.+..+.+   +|+++-.+-|+.+..|.- ..+...... .....++...........+-+...+|+
T Consensus       149 ~~~Y~asKaav~~lTr~lA~ela~~gIrVNaV~PG~i~T~m~~~~~~~~~~~-~~~~~~~~~~~~~~~~PlgR~g~pedv  227 (256)
T PRK07067        149 VSHYCATKAAVISYTQSAALALARHGINVNAIAPGVVDTPMWDQVDALFARY-ENRPPGEKKRLVGEAVPLGRMGVPDDL  227 (256)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCHHHHHHHHHHH-CCCCHHHHHHHHHHCCCCCCCCCHHHH
T ss_conf             6689999999999999999997042928999954888886144566776553-169979999999827998998689999


Q ss_pred             CCCEEECCCC---CCCCCCCCCCCCCCC
Q ss_conf             0000000122---222221113578642
Q gi|254780920|r  230 VRALYLVLKK---GRIGERYNIGGNNER  254 (358)
Q Consensus       230 a~~i~~~~~~---~~~~~~fNigs~~~~  254 (358)
                      +.++..+...   ...|+++.+.+|.-+
T Consensus       228 A~~v~fLaSd~a~~iTG~~l~VDGG~~m  255 (256)
T PRK07067        228 TGAALFLASADADYIVAQTLNVDGGNWM  255 (256)
T ss_pred             HHHHHHHHCCHHCCCCCCEEEECCCHHC
T ss_conf             9999999586432805881787956220


No 112
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional
Probab=99.49  E-value=8.1e-14  Score=103.77  Aligned_cols=230  Identities=18%  Similarity=0.143  Sum_probs=143.3

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHHC-----CCC
Q ss_conf             489976788277999999998689879999478876585677762-03797499976388999999998622-----787
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEI-SQSNLFSFLQVDICDRECIRSALKEF-----QPD   75 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~-~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d   75 (358)
                      .+|||||++=||..++++|+++ |++|+..|+....... ....+ ....++.++++|+++.+.++++++..     ++|
T Consensus         6 ~alITGas~GIG~aia~~la~~-Ga~V~~~~~~~~~~~~-~~~~~~~~g~~~~~~~~D~~~~~~v~~~~~~~~~~~g~iD   83 (258)
T PRK12429          6 TALVTGAASGIGLEIALALAKE-GAKVVIADLNDEAAAK-AAEAIKKAGGKAIGVAMDVTDEEAINAGIDKVVETFGGVD   83 (258)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHHHHH-HHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             8999488758999999999987-9999999798899999-9999984499189998358999999999999999829970


Q ss_pred             EEEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             1785123433222----222222222222222202478886512322112478427863055431122222222222222
Q gi|254780920|r   76 AIVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPY  151 (358)
Q Consensus        76 ~ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~  151 (358)
                      +++|.|+......    +.++....+++|+.|+.++..++...     ..+.+.-++|++||..-+-           +.
T Consensus        84 iLVnnAG~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~p~-----m~~~~~G~Iv~isS~~~~~-----------~~  147 (258)
T PRK12429         84 ILVNNAGIQHVAPIEDFPTEKWKKMIAIMLDGAFLTTKAALPH-----MKAQKWGRIINMASVHGLV-----------GS  147 (258)
T ss_pred             EEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHEEEHHHHHHH-----HHHCCCCEEEEECCHHHCC-----------CC
T ss_conf             9998998889988155999999999997623212200677776-----6435992899987755466-----------89


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCC--CCCCCCCCCCCCCC
Q ss_conf             22222233322100000012333---2222222222222333222222222222222-222222--22222233221133
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRM-IEGSHV--FLYGDGQNVRDWLY  225 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~-~~g~~~--~i~g~g~~~Rdfi~  225 (358)
                      ....+|+.||.+.+.+.+.++.+   +|+++-.+-|+.+-.|.-.  ..++...... ......  .........+-+.-
T Consensus       148 ~~~~~Y~asKaal~~lt~~lA~e~~~~gIrvN~V~PG~i~T~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~P~~R~g~  225 (258)
T PRK12429        148 AGKAAYVSAKHGLIGLTKVVALEGATHGVTVNAICPGYVDTPLVR--KQIPDLAKERGISEEEVLEDVLLPLVPQKRFTT  225 (258)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCHH--HHHHHHHHHCCCCHHHHHHHHHHHCCCCCCCCC
T ss_conf             997589999999999999999985320979999974879871022--133678977399979999999972799899849


Q ss_pred             CCCCCCCEEECCCC---CCCCCCCCCCCC
Q ss_conf             22220000000122---222221113578
Q gi|254780920|r  226 VEDHVRALYLVLKK---GRIGERYNIGGN  251 (358)
Q Consensus       226 v~D~a~~i~~~~~~---~~~~~~fNigs~  251 (358)
                      .+|+++++..++..   ...|+++.|.+|
T Consensus       226 p~dia~~v~fL~S~~s~~itGq~i~VDGG  254 (258)
T PRK12429        226 VEEIADLALFLASFAAKGVTGQAWVVDGG  254 (258)
T ss_pred             HHHHHHHHHHHHCCHHCCCCCCEEEECCC
T ss_conf             99999999999480754901763896946


No 113
>PRK08213 gluconate 5-dehydrogenase; Provisional
Probab=99.49  E-value=4.1e-14  Score=105.55  Aligned_cols=225  Identities=16%  Similarity=0.120  Sum_probs=142.5

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHH-HHHH-CCCCEEEEECCCCCHHHHHHHHHHC-----CC
Q ss_conf             489976788277999999998689879999478876585677-7620-3797499976388999999998622-----78
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSL-KEIS-QSNLFSFLQVDICDRECIRSALKEF-----QP   74 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~-~~~~-~~~~v~~i~~Di~d~~~l~~~~~~~-----~~   74 (358)
                      .+|||||++=||..+++.|+++ |.+|+..|+....  .... ..+. ...++.++++|++|.+.++++++..     ++
T Consensus        14 valVTG~s~GIG~aia~~la~~-Ga~V~i~~~~~~~--~~~~~~~l~~~g~~~~~~~~Dv~~~~~v~~~v~~~~~~~G~i   90 (259)
T PRK08213         14 TALVTGGSRGLGLQIAEALGEA-GARVVLSARKAEE--LEEAAAHLEALGIDALWLAADVADEADIERLAEETLERFGHI   90 (259)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHH--HHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC
T ss_conf             8999487768999999999986-9999999798899--999999999549958999826899999999999999983999


Q ss_pred             CEEEEECCCCCCC----CCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCC-CCCCCCCCCCCCC
Q ss_conf             7178512343322----2222222222222222202478886512322112478427863055431-1222222222222
Q gi|254780920|r   75 DAIVNFAAESHVD----RSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEV-YGSLDKGLFSEDM  149 (358)
Q Consensus        75 d~ViHlAa~~~~~----~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~v-Yg~~~~~~~~E~~  149 (358)
                      |+++|.|+.....    .+.++....+++|+.|+..+..++-...    ..+.+.-++|.+||.+- .|.+..       
T Consensus        91 DiLVNNAG~~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~~~~----m~~~~~G~IVnisS~ag~~g~~~~-------  159 (259)
T PRK08213         91 DILVNNAGATWGAPAEDHPVEAWDKVMNLNVRGTFLLSQAVAKRS----MIPRGYGRIINVASIAGLGGNPPG-------  159 (259)
T ss_pred             CEEEECCCCCCCCCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHH----HHHCCCCEEEEEEEHHHCCCCCCC-------
T ss_conf             899989977889864569999999999884411999999999999----985799459999352116678865-------


Q ss_pred             CCCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222233322100000012333---2222222222222333222222222222222222222222222332211332
Q gi|254780920|r  150 PYNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYV  226 (358)
Q Consensus       150 ~~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v  226 (358)
                       ..+...|+.||.+...+.+..+.+   +|+++-.+-|+.+--|..  ....+....+....-|+         +-+...
T Consensus       160 -~~~~~aY~asKaav~~ltr~lA~e~a~~gIrVNaIaPG~i~T~~~--~~~~~~~~~~~~~~~Pl---------~R~g~p  227 (259)
T PRK08213        160 -SMDTIAYNTSKGAVINFTRALAAEWGPHGIRVNAIAPGFFPTKMT--RGTLERLGEELLAHTPL---------GRLGDD  227 (259)
T ss_pred             -CCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCC--CCCCHHHHHHHHHCCCC---------CCCCCH
T ss_conf             -413499999999999999999999610391999997798988552--10149999999857999---------999199


Q ss_pred             CCCCCCEEECCCC---CCCCCCCCCCCCC
Q ss_conf             2220000000122---2222211135786
Q gi|254780920|r  227 EDHVRALYLVLKK---GRIGERYNIGGNN  252 (358)
Q Consensus       227 ~D~a~~i~~~~~~---~~~~~~fNigs~~  252 (358)
                      +|++.++..+...   ...|+++.+.+|-
T Consensus       228 eeia~~v~fLaSd~as~iTG~~i~VDGG~  256 (259)
T PRK08213        228 EDLKGAALLLASDASKHITGQILAVDGGV  256 (259)
T ss_pred             HHHHHHHHHHHCCHHCCCCCCEEEECCCH
T ss_conf             99999999996825358548717758363


No 114
>PRK06841 short chain dehydrogenase; Provisional
Probab=99.48  E-value=3.9e-14  Score=105.72  Aligned_cols=220  Identities=18%  Similarity=0.152  Sum_probs=143.3

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             8997678827799999999868987999947887658567776203797499976388999999998622-----78717
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEF-----QPDAI   77 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d~V   77 (358)
                      +|||||++=||..+++.|+++ |.+|+..|+...   ......-....++..+++|++|.++++++++..     ++|++
T Consensus        18 alVTGas~GIG~aiA~~la~~-Ga~V~i~d~~~~---~~~~~~~~~~~~~~~~~~Dvt~~~~v~~~v~~~~~~~g~iDiL   93 (255)
T PRK06841         18 AVVTGGASGIGHAIAELFAAK-GARVALLDRSED---VAEVAAQLLGGNAKGLVCDVSDSQSVEAAVAAAISAFGRIDIL   93 (255)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHH---HHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             999796778999999999987-999999969878---9999998459966999984699999999999999981998799


Q ss_pred             EEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCC-CCCCCCCCCCCCCCC
Q ss_conf             85123433222----2222222222222222024788865123221124784278630554311-222222222222222
Q gi|254780920|r   78 VNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVY-GSLDKGLFSEDMPYN  152 (358)
Q Consensus        78 iHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vY-g~~~~~~~~E~~~~~  152 (358)
                      +|.|+......    +.++....+++|+.|+..+..++...     ..+.+.-++|.+||..-. |.            .
T Consensus        94 VNNAGi~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~~~-----m~~~~~G~IInisS~~~~~~~------------~  156 (255)
T PRK06841         94 VNSAGVALLAPAEDVSEADWDKTIDINLKGSFLMAQAVGRH-----MIAAGGGKIVNLASQAGVVAL------------E  156 (255)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEEEECHHHCCCC------------C
T ss_conf             98997899998044999999999998559999999999999-----998299659999466656689------------9


Q ss_pred             CCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222233322100000012333---2222222222222333222222222222222222222222222332211332222
Q gi|254780920|r  153 PSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDH  229 (358)
Q Consensus       153 p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~  229 (358)
                      ....|+.||.+...+.+..+.+   +|+++-.+-|+.+--|.... ..-.....++...-|         .+-+...+|+
T Consensus       157 ~~~~Y~asKaav~~ltrslA~ela~~gIrVNaVaPG~i~T~~~~~-~~~~~~~~~~~~~~P---------l~R~g~pedi  226 (255)
T PRK06841        157 RHVAYCASKAGVVGMTKVLALEWGPHGITVNAISPTVVLTELGKK-AWAGEKGERAKKLIP---------AGRFAYPEEI  226 (255)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCHHHH-CCCCHHHHHHHHCCC---------CCCCCCHHHH
T ss_conf             858899999999999999999970309599998538897703433-247488999985599---------9997789999


Q ss_pred             CCCEEECCCC---CCCCCCCCCCCCCC
Q ss_conf             0000000122---22222111357864
Q gi|254780920|r  230 VRALYLVLKK---GRIGERYNIGGNNE  253 (358)
Q Consensus       230 a~~i~~~~~~---~~~~~~fNigs~~~  253 (358)
                      +.++..++..   ...|.++.+.+|-+
T Consensus       227 A~~v~fLaSd~ss~iTG~~i~VDGG~t  253 (255)
T PRK06841        227 AAAALFLASDAAAMITGENLVIDGGYT  253 (255)
T ss_pred             HHHHHHHHCCHHCCCCCCEEEECCCCC
T ss_conf             999999968732385587089586805


No 115
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional
Probab=99.48  E-value=4.1e-14  Score=105.59  Aligned_cols=220  Identities=15%  Similarity=0.170  Sum_probs=139.4

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             89976788277999999998689879999478876585677762-03797499976388999999998622-----7871
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEI-SQSNLFSFLQVDICDRECIRSALKEF-----QPDA   76 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~-~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d~   76 (358)
                      +|||||++=||..+++.|+++ |++|+..|+....  ......+ ....++..+++|+++.+.++++++..     ++|+
T Consensus        11 alITGas~GIG~aiA~~la~~-Ga~V~~~~r~~~~--~~~~~~~~~~~~~~~~~~~Dv~~~~~~~~~~~~~~~~~G~iDi   87 (260)
T PRK12823         11 AVVTGAAQGIGRGVALRAAAE-GARVVLVDRSELV--HEVAAELVAAGGEALALTADLETYAGAQAVMAAAVEAFGRIDV   87 (260)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHH--HHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             999488678999999999987-9999999694689--9999999854994899981268858999999999998399879


Q ss_pred             EEEECCCCCCCC-----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             785123433222-----222222222222222202478886512322112478427863055431122222222222222
Q gi|254780920|r   77 IVNFAAESHVDR-----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPY  151 (358)
Q Consensus        77 ViHlAa~~~~~~-----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~  151 (358)
                      ++|.|+......     ..++....+++|+.|+..+..++...     ..+.+.-++|++||.+..+.            
T Consensus        88 LVnnag~~~~~~~~~~~~~~~~~~~~~~nl~~~~~~~~~~~p~-----m~~~~~G~Ii~isS~~~~~~------------  150 (260)
T PRK12823         88 LINNVGGTIWAKPFEEYEEEQIEAEIRRSLFPTLWCCRAVLPH-----MLAQGGGAIVNVSSIATRGI------------  150 (260)
T ss_pred             EEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHHCCCEEEEECHHHCCCC------------
T ss_conf             9977522457898265999999999999854068999999999-----99816967999820220588------------


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCC-CCC----------CCCCCCCCCCCCCCCCCCC
Q ss_conf             22222233322100000012333---222222222222233322222-222----------2222222222222222222
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPE-KLI----------PLAITRMIEGSHVFLYGDG  217 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~-~~i----------~~~i~~~~~g~~~~i~g~g  217 (358)
                       ...+|+.||.+.+.+.+..+.+   +|+++-.+-|+.+-.|..... ...          ..++.+....-|       
T Consensus       151 -~~~~Y~asKaal~~ltr~lA~ela~~gIrVN~I~PG~~~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p-------  222 (260)
T PRK12823        151 -NRVPYSAAKGGVNALTASLAFEYAEHGIRVNAVAPGGTEAPPRRVPRNAAPQSEQEKAWYQQIVDQTLDSSL-------  222 (260)
T ss_pred             -CCCHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEECCCCCCCHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCC-------
T ss_conf             -751269999999999999999961529699999358677633332101343346678789999999863699-------


Q ss_pred             CCCCCCCCCCCCCCCEEECCCC---CCCCCCCCCCCCC
Q ss_conf             3322113322220000000122---2222211135786
Q gi|254780920|r  218 QNVRDWLYVEDHVRALYLVLKK---GRIGERYNIGGNN  252 (358)
Q Consensus       218 ~~~Rdfi~v~D~a~~i~~~~~~---~~~~~~fNigs~~  252 (358)
                        ..-+...+|+|.++..++..   ...|+.+.+.+|+
T Consensus       223 --l~R~g~peevA~~v~fL~S~~s~~iTG~~i~VDGG~  258 (260)
T PRK12823        223 --MKRYGTIDEQVAAILFLASDEASYITGSVLPVGGGD  258 (260)
T ss_pred             --CCCCCCHHHHHHHHHHHHCCHHCCCCCCEEEECCCC
T ss_conf             --889869999999999995854248047868868598


No 116
>PRK06947 glucose-1-dehydrogenase; Provisional
Probab=99.48  E-value=6.6e-14  Score=104.29  Aligned_cols=226  Identities=16%  Similarity=0.127  Sum_probs=140.1

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHC-CCCEEEEECCCCCHHHHHHHHHH-----CCCCE
Q ss_conf             8997678827799999999868987999947887658567776203-79749997638899999999862-----27871
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQ-SNLFSFLQVDICDRECIRSALKE-----FQPDA   76 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~-~~~v~~i~~Di~d~~~l~~~~~~-----~~~d~   76 (358)
                      +|||||++=||+.+++.|+++ |++|...++........-...+.. ..+..++++|++|.+++++++++     .++|+
T Consensus         9 alVTGa~~GIG~aia~~la~~-Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvs~~~~v~~~~~~~~~~~G~iD~   87 (252)
T PRK06947          9 VLITGASRGIGRATAVLAAAR-GWSVGINYARDAAAAEETADAVRAAGGRACVVAGDVANEADVIAMFDAVQAAFGRLDA   87 (252)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             999388358999999999987-9989998089878999999999964992899984799999999999999998499889


Q ss_pred             EEEECCCCCCCC-----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCC-CCCCCCCCCCCCC
Q ss_conf             785123433222-----2222222222222222024788865123221124784278630554311-2222222222222
Q gi|254780920|r   77 IVNFAAESHVDR-----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVY-GSLDKGLFSEDMP  150 (358)
Q Consensus        77 ViHlAa~~~~~~-----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vY-g~~~~~~~~E~~~  150 (358)
                      +++.|+...+..     +.++-...+++|+.|+..+..++-....-  ......-++|++||.... |.           
T Consensus        88 lVnNAG~~~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~~~~m~~--~~~~~~g~IinisS~~~~~~~-----------  154 (252)
T PRK06947         88 LVNNAGIVAPSMPLADMDAARLRRMFDTNVLGAYLCAREAARRLST--DRGGRGGAIVNVSSIASRLGS-----------  154 (252)
T ss_pred             EEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HCCCCCCEEEEEEEHHHCCCC-----------
T ss_conf             9987643579998123999999999999857999999999999998--457998589998566545588-----------


Q ss_pred             CCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222233322100000012333---22222222222223332222222222222222222222222223322113322
Q gi|254780920|r  151 YNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVE  227 (358)
Q Consensus       151 ~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~  227 (358)
                      +.+...|+.||.+.+.+.+..+.+   +|+++-.+-|+.+--|..... .-|....++...-|+.         -+...+
T Consensus       155 ~~~~~~Y~~sK~al~~ltr~lA~e~a~~gIrvN~IaPG~i~T~~~~~~-~~~~~~~~~~~~~Pl~---------R~g~p~  224 (252)
T PRK06947        155 PNEYVDYAGSKGAVDTLTLGLAKELGPHGVRVNAVRPGLIETEIHASG-GQPGRAARLGAQTPLG---------RAGEAD  224 (252)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEECCCCCCCCCCC-CCHHHHHHHHHCCCCC---------CCCCHH
T ss_conf             873066799999999999999999746292899897115877542236-9969999998379999---------981999


Q ss_pred             CCCCCEEECCCC---CCCCCCCCCCCCC
Q ss_conf             220000000122---2222211135786
Q gi|254780920|r  228 DHVRALYLVLKK---GRIGERYNIGGNN  252 (358)
Q Consensus       228 D~a~~i~~~~~~---~~~~~~fNigs~~  252 (358)
                      |+++++..++..   ...|+++.|.+|+
T Consensus       225 dIa~~v~fL~Sd~s~~iTGq~i~VdGG~  252 (252)
T PRK06947        225 EVAEAIVWLLSDAASYVTGALLDVGGGR  252 (252)
T ss_pred             HHHHHHHHHHCCHHCCCCCCEEEECCCC
T ss_conf             9999999996871148658537848999


No 117
>PRK08251 short chain dehydrogenase; Provisional
Probab=99.48  E-value=1.1e-13  Score=102.86  Aligned_cols=200  Identities=16%  Similarity=0.142  Sum_probs=129.2

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHH-HH---HCCCCEEEEECCCCCHHHHHHHHHH-----C
Q ss_conf             4899767882779999999986898799994788765856777-62---0379749997638899999999862-----2
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLK-EI---SQSNLFSFLQVDICDRECIRSALKE-----F   72 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~-~~---~~~~~v~~i~~Di~d~~~l~~~~~~-----~   72 (358)
                      +||||||++=||..++++|+++ |++|+..++...  ..+.+. ++   ....++.++.+|++|.+.+++++++     .
T Consensus         4 ~vlITGAssGIG~alA~~la~~-G~~v~l~~r~~~--~l~~~~~el~~~~~~~~v~~~~~Dvsd~~~v~~~~~~~~~~~g   80 (248)
T PRK08251          4 KILITGASSGLGAGMAREFAAK-GRDLALCARRTD--RLEELKAELLARYPGIKVAVAALDVNDHDQVFEVFAEFSDELG   80 (248)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHH--HHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHHC
T ss_conf             8999478639999999999987-998999989888--9999999998737997399997867868999999999999809


Q ss_pred             CCCEEEEECCCCCCCCC----CCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCC-CCCCCCCCCC
Q ss_conf             78717851234332222----222222222222222024788865123221124784278630554311-2222222222
Q gi|254780920|r   73 QPDAIVNFAAESHVDRS----ILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVY-GSLDKGLFSE  147 (358)
Q Consensus        73 ~~d~ViHlAa~~~~~~~----~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vY-g~~~~~~~~E  147 (358)
                      .+|++++.|+.......    .+.....+++|+.|+..++.++...     ..+.+.-++|.+||.+-+ |.        
T Consensus        81 ~iD~lvnNAGi~~~~~~~~~~~~~~~~~~~vN~~g~~~~~~~~l~~-----m~~~~~G~Iv~isS~ag~~~~--------  147 (248)
T PRK08251         81 GLDRVIVNAGIGKGARLGTGKFWANKATAETNFVAALAQCEAAMEI-----FREQGSGHLVLISSVSAVRGL--------  147 (248)
T ss_pred             CCCEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCCEEEEECHHHCCCC--------
T ss_conf             9989998576578866555999999999999829999999999876-----554058729999574442678--------


Q ss_pred             CCCCCCCCCCCCCCCCCEEEECCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222222333221000000123---3322222222222223332222222222222222222222222223322113
Q gi|254780920|r  148 DMPYNPSSPYSATKASSDYLVLAWG---HTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWL  224 (358)
Q Consensus       148 ~~~~~p~s~Yg~sK~~~E~~~~~~~---~~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi  224 (358)
                         +...+.|+.||.+...+.+..+   ..+|+.+.++.|+.|--+          |..+. ...|+           .+
T Consensus       148 ---p~~~~~Y~aSKaal~~~~~~L~~El~~~gI~V~~i~PG~v~T~----------m~~~~-~~~~~-----------~~  202 (248)
T PRK08251        148 ---PGAKTAYAASKAGLASLGEGLRAEYAKTPIKVSTIEPGYIRSE----------MNEKA-KSTPF-----------MV  202 (248)
T ss_pred             ---CCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCC----------CCCCC-CCCCC-----------CC
T ss_conf             ---9974789999999999999999984666929999986899852----------24488-87998-----------78


Q ss_pred             CCCCCCCCEEECCCCCCC
Q ss_conf             322220000000122222
Q gi|254780920|r  225 YVEDHVRALYLVLKKGRI  242 (358)
Q Consensus       225 ~v~D~a~~i~~~~~~~~~  242 (358)
                      ..+++|+.++.+++++..
T Consensus       203 ~~e~~A~~i~~ai~~~~~  220 (248)
T PRK08251        203 DTETGVKAMVKAIEKEPG  220 (248)
T ss_pred             CHHHHHHHHHHHHHCCCC
T ss_conf             999999999999983997


No 118
>PRK07041 short chain dehydrogenase; Provisional
Probab=99.48  E-value=6e-14  Score=104.54  Aligned_cols=218  Identities=16%  Similarity=0.117  Sum_probs=137.0

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC-CCCEEEEE
Q ss_conf             48997678827799999999868987999947887658567776203797499976388999999998622-78717851
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEF-QPDAIVNF   80 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~-~~d~ViHl   80 (358)
                      ++|||||++=||..+++.|+++ |++|+..++.... -..-.+++....++..+.+|++|.+.+++++++. ++|++++.
T Consensus         9 ~~lITGgs~GIG~aia~~la~~-Ga~V~i~~r~~~~-l~~~~~~~~~~~~~~~~~~Dv~~~~~v~~~~~~~g~~d~lv~n   86 (240)
T PRK07041          9 KVLVVGGSSGIGLAAARAFAAR-GADVTIASRSRER-LAAAARALGGPRPVRTAALDITDEAAVDAFFAEAGPFDHVVIT   86 (240)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHH-HHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHCCCCEEEEC
T ss_conf             8999577888999999999987-9999999598899-9999998478886699984799999999999970987889982


Q ss_pred             CCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             23433222----22222222222222220247888651232211247842786305543112222222222222222222
Q gi|254780920|r   81 AAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSP  156 (358)
Q Consensus        81 Aa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~s~  156 (358)
                      |+......    ..++....+++|+.|+..+..+++.         ...-++|++||...+-     |      ......
T Consensus        87 ag~~~~~~~~~~~~~~~~~~~~~n~~~~~~~~~~~~~---------~~~G~Ii~iss~~~~~-----~------~~~~~~  146 (240)
T PRK07041         87 AADTAGGPVRALPLAAAQAAMDSKFWGAYRVARAARI---------APGGSLTFVSGFLAVR-----P------SASGVL  146 (240)
T ss_pred             CCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHH---------HCCCEEEEECCHHHCC-----C------CCCCHH
T ss_conf             3447999810299999999999888999999999997---------1696799964433147-----7------886178


Q ss_pred             CCCCCCCCEEEECCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             23332210000001233322-222222222223332222222222----2222222222222222233221133222200
Q gi|254780920|r  157 YSATKASSDYLVLAWGHTYG-IPVLLSNCSNNYGPYHFPEKLIPL----AITRMIEGSHVFLYGDGQNVRDWLYVEDHVR  231 (358)
Q Consensus       157 Yg~sK~~~E~~~~~~~~~~~-l~~~ilR~~~vyGp~~~~~~~i~~----~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~a~  231 (358)
                      |+.+|.+.+.+.+..+.+++ +++-.+-|+.+--|..  ..+.+.    +...+.+.-|+         +-+.-.+|+++
T Consensus       147 Y~asKaal~~ltr~lA~ela~IrVN~IaPG~i~T~~~--~~~~~~~~~~~~~~~~~~iPl---------~R~g~pedia~  215 (240)
T PRK07041        147 QGAINAALEALARGLALELAPVRVNAVSPGLVDTPLW--SKLAGDARAAMFAAAAERLPA---------RRVGQPEDVAN  215 (240)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCHHH--HHCCCHHHHHHHHHHHHCCCC---------CCCCCHHHHHH
T ss_conf             8887679999999999982892899984187677366--531711389999999845999---------99849999999


Q ss_pred             CEEECCCC-CCCCCCCCCCCCC
Q ss_conf             00000122-2222211135786
Q gi|254780920|r  232 ALYLVLKK-GRIGERYNIGGNN  252 (358)
Q Consensus       232 ~i~~~~~~-~~~~~~fNigs~~  252 (358)
                      ++..++.. ...|+++.+.+|.
T Consensus       216 ~v~fL~s~~~itG~~i~VDGG~  237 (240)
T PRK07041        216 AIVFLAANGFATGSTVLVDGGG  237 (240)
T ss_pred             HHHHHHHCCCCCCCEEEECCCH
T ss_conf             9999984788789827858772


No 119
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed
Probab=99.47  E-value=5.1e-14  Score=105.00  Aligned_cols=217  Identities=16%  Similarity=0.146  Sum_probs=144.1

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH--CCCCEEEEECCCCCHHHHHHHHH----HC-CC
Q ss_conf             4899767882779999999986898799994788765856777620--37974999763889999999986----22-78
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS--QSNLFSFLQVDICDRECIRSALK----EF-QP   74 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~--~~~~v~~i~~Di~d~~~l~~~~~----~~-~~   74 (358)
                      .+|||||++=||..+++.|.++ |..|...|+.     ...++...  ...++.++++|++|.+.++.+++    ++ ++
T Consensus         8 ~alITG~s~GIG~aia~~~a~~-Ga~V~i~~~~-----~~~~~~~~~~~~~~~~~~~~Dv~~~~~v~~~~~~~~~~~g~i   81 (245)
T PRK12936          8 KALVTGASGGIGEEIARLLHAQ-GAIVGLHGTR-----VEKLEALAAELGERVKIFPANLSDRDEVKALGQKAEADLEGV   81 (245)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECC-----HHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             8999274768999999999986-9999998299-----999999999838966999913799999999999999975999


Q ss_pred             CEEEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCC-CCCCCCCCCCCCC
Q ss_conf             71785123433222----222222222222222202478886512322112478427863055431-1222222222222
Q gi|254780920|r   75 DAIVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEV-YGSLDKGLFSEDM  149 (358)
Q Consensus        75 d~ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~v-Yg~~~~~~~~E~~  149 (358)
                      |++++.|+......    +.++....+++|+.|+..+..++...     ..+.+.-++|.+||.+- .|.          
T Consensus        82 DiLINnAG~~~~~~~~~~~~e~w~~~~~vNl~~~f~~~~~~~~~-----m~k~~~G~IInisS~a~~~~~----------  146 (245)
T PRK12936         82 DILVNNAGITKDGLFVRMSDEDWDAVLEVNLTAVFRLTRELTHP-----MMRRRYGRIINITSVVGVTGN----------  146 (245)
T ss_pred             CEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEEECCHHHCCCC----------
T ss_conf             69998998899998120999999999999819999999999999-----987488559997345535689----------


Q ss_pred             CCCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222233322100000012333---2222222222222333222222222222222222222222222332211332
Q gi|254780920|r  150 PYNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYV  226 (358)
Q Consensus       150 ~~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v  226 (358)
                        ...++|+.||.+...+.+..+.+   +|+++-.+-|+.+-.|..  +.+.+.........         ...+-+...
T Consensus       147 --~~~~~Y~asKaai~~ltrslA~ela~~gIrVN~IaPG~i~T~~~--~~~~~~~~~~~~~~---------~Pl~R~g~p  213 (245)
T PRK12936        147 --PGQANYCASKAGMIGFSKSLAQEIATRNVTVNCVAPGFIESAMT--GKLNDKQKEAIMGA---------IPMKRMGTG  213 (245)
T ss_pred             --CCCHHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCC--CCCCHHHHHHHHHC---------CCCCCCCCH
T ss_conf             --98589999999999999999999705292999997576886310--00399999999856---------998898299


Q ss_pred             CCCCCCEEECCCC---CCCCCCCCCCCCC
Q ss_conf             2220000000122---2222211135786
Q gi|254780920|r  227 EDHVRALYLVLKK---GRIGERYNIGGNN  252 (358)
Q Consensus       227 ~D~a~~i~~~~~~---~~~~~~fNigs~~  252 (358)
                      +|++.++..++..   .-.|+++.+.+|-
T Consensus       214 ~dia~~v~fL~S~~a~~iTGq~i~VdGG~  242 (245)
T PRK12936        214 AEVASAVAYLASDEAAYVTGQTLHVNGGM  242 (245)
T ss_pred             HHHHHHHHHHHCCHHCCCCCCEEEECCCH
T ss_conf             99999999996834348468717978785


No 120
>PRK06172 short chain dehydrogenase; Provisional
Probab=99.47  E-value=4.9e-14  Score=105.11  Aligned_cols=222  Identities=17%  Similarity=0.098  Sum_probs=142.2

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHH-----CCCCE
Q ss_conf             89976788277999999998689879999478876585677762-0379749997638899999999862-----27871
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEI-SQSNLFSFLQVDICDRECIRSALKE-----FQPDA   76 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~-~~~~~v~~i~~Di~d~~~l~~~~~~-----~~~d~   76 (358)
                      +|||||++=||+.+++.|+++ |.+|+..|+..... ..-.+.+ .....+.++++|++|.+.++++++.     .++|+
T Consensus        10 alVTGas~GIG~aiA~~la~~-Ga~V~i~~~~~~~~-~~~~~~~~~~g~~~~~~~~Dvs~~~~v~~~~~~~~~~~G~iDi   87 (253)
T PRK06172         10 ALVTGGAAGIGRATAIAFARE-GAKVVVADRDAAGG-EETVALIREAGGEALFIACDVTRDAEVKALVEKTIAAYGRLDY   87 (253)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHHH-HHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCE
T ss_conf             999375768999999999987-99899997988999-9999999964993799981899999999999999998299999


Q ss_pred             EEEECCCCCCC-----CCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             78512343322-----2222222222222222202478886512322112478427863055431122222222222222
Q gi|254780920|r   77 IVNFAAESHVD-----RSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPY  151 (358)
Q Consensus        77 ViHlAa~~~~~-----~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~  151 (358)
                      ++|.|+.....     .+.++....+++|+.|+..+..++...     ..+.+.-++|.+||..-...           .
T Consensus        88 LVNNAGi~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~~~-----m~~~~~G~IVnisS~~g~~~-----------~  151 (253)
T PRK06172         88 AFNNAGIEIEQGRLAEGSEAEFDAIMGVNVKGVWLCMKYQIPL-----MLAQGGGAIVNTASVAGLGA-----------A  151 (253)
T ss_pred             EEECCCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCEEEEEECCHHHCCC-----------C
T ss_conf             9989888999999013999999999999739999999999999-----99859958999766664768-----------9


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222233322100000012333---222222222222233322222-22222222222222222222223322113322
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPE-KLIPLAITRMIEGSHVFLYGDGQNVRDWLYVE  227 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~-~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~  227 (358)
                      .....|+.||.+...+.+..+.+   +|+++-.+-|+.+--|..... ..-+.....+....|+         +-+...+
T Consensus       152 ~~~~~Y~asKaal~~ltr~lA~e~a~~gIrVNaV~PG~i~T~~~~~~~~~~~~~~~~~~~~~Pl---------~R~g~pe  222 (253)
T PRK06172        152 PKMSIYAASKHAVIGLTKSAAIEYAKKGIRVNAVCPAVIDTDMFRRAYEADPRKAEFAAAMHPV---------GRIGKVE  222 (253)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEECCCCCHHHHHHCCCCHHHHHHHHHCCCC---------CCCCCHH
T ss_conf             9977899999999999999999863318789999779798757764421899999999737998---------9985999


Q ss_pred             CCCCCEEECCCC---CCCCCCCCCCCC
Q ss_conf             220000000122---222221113578
Q gi|254780920|r  228 DHVRALYLVLKK---GRIGERYNIGGN  251 (358)
Q Consensus       228 D~a~~i~~~~~~---~~~~~~fNigs~  251 (358)
                      |++.++..++..   ...|.++.+.+|
T Consensus       223 diA~~v~FLaSd~a~~iTG~~i~VDGG  249 (253)
T PRK06172        223 EIANAVLYLCSDGASFTTGHSLMVDGG  249 (253)
T ss_pred             HHHHHHHHHHCCHHCCCCCCEEEECCC
T ss_conf             999999999385326825982873924


No 121
>PRK12938 acetyacetyl-CoA reductase; Provisional
Probab=99.47  E-value=7.1e-14  Score=104.12  Aligned_cols=222  Identities=17%  Similarity=0.128  Sum_probs=141.7

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHH-----CCCCE
Q ss_conf             89976788277999999998689879999478876585677762-0379749997638899999999862-----27871
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEI-SQSNLFSFLQVDICDRECIRSALKE-----FQPDA   76 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~-~~~~~v~~i~~Di~d~~~l~~~~~~-----~~~d~   76 (358)
                      +|||||++=||..+++.|+++ |++|+................. .....+..+++|++|.+.++.+++.     .++|+
T Consensus         6 alVTGgs~GIG~aia~~la~~-Ga~Vv~~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~~~~~~~~i~~~~g~idi   84 (246)
T PRK12938          6 AYVTGGMGGIGTSICQRLHKD-GFKVVAGCGPNSPRRVKWLEDQKALGFDFIASEGNVGDWDSTKAAFDKVKAEVGEIDV   84 (246)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEECCCCCHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCE
T ss_conf             999185869999999999987-9989994799817899999999845997899967879999999999999997599989


Q ss_pred             EEEECCCCCCCCC----CCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             7851234332222----222222222222222024788865123221124784278630554311222222222222222
Q gi|254780920|r   77 IVNFAAESHVDRS----ILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYN  152 (358)
Q Consensus        77 ViHlAa~~~~~~~----~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~  152 (358)
                      ++|.|+.......    .++....+++|+.++.++..++...     ..+.+.-++|.+||...+..           ..
T Consensus        85 LVNNAG~~~~~~~~~~~~~~w~~~~~vNl~~~f~~~~~~~~~-----m~~~~~G~IVnisS~~~~~~-----------~~  148 (246)
T PRK12938         85 LVNNAGITRDVVFRKMTREDWTAVIDTNLTSLFNVTKQVIDG-----MVERGWGRIINISSVNGQKG-----------QF  148 (246)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCEEEEEEEEHHHCCC-----------CC
T ss_conf             998988899988034999999999999856399999999986-----10328818999833664668-----------88


Q ss_pred             CCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222333221000000123332---222222222222333222222222222222222222222222332211332222
Q gi|254780920|r  153 PSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDH  229 (358)
Q Consensus       153 p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~  229 (358)
                      ....|+.||.+.+.+.+.++.++   |+++-.+-|+.+--+..  ..+.+..+..+...-|+.         -+-..+|+
T Consensus       149 ~~~~Y~asKaal~~ltk~lA~Ela~~gIrVN~VaPG~i~T~~~--~~~~~~~~~~~~~~~Pl~---------R~g~p~di  217 (246)
T PRK12938        149 GQTNYSTAKAGIHGFTMSLAQEVATKGVTVNTVSPGYIGTDMV--KAIRPDVLEKIVATIPVR---------RLGSPEEI  217 (246)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCH--HHCCHHHHHHHHHCCCCC---------CCCCHHHH
T ss_conf             8637799999999999999999604398999996687987030--112999999998469988---------98499999


Q ss_pred             CCCEEECCCC---CCCCCCCCCCCCC
Q ss_conf             0000000122---2222211135786
Q gi|254780920|r  230 VRALYLVLKK---GRIGERYNIGGNN  252 (358)
Q Consensus       230 a~~i~~~~~~---~~~~~~fNigs~~  252 (358)
                      +.++..++..   .-.|+++.+.+|-
T Consensus       218 A~~v~fL~S~~a~yiTG~~i~VdGG~  243 (246)
T PRK12938        218 GSIVAWLASEESGFSTGADFSLNGGL  243 (246)
T ss_pred             HHHHHHHHCCHHCCCCCCEEEECCCC
T ss_conf             99999994814359648728878781


No 122
>PRK08324 short chain dehydrogenase; Validated
Probab=99.46  E-value=7.2e-14  Score=104.07  Aligned_cols=231  Identities=20%  Similarity=0.150  Sum_probs=147.0

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH-----CCCCEE
Q ss_conf             899767882779999999986898799994788765856777620379749997638899999999862-----278717
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKE-----FQPDAI   77 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~-----~~~d~V   77 (358)
                      +|||||+|=||..+++.|.++ |.+|+..|+.... -..-...+.....+..+.+|++|.+.++.++..     ..+|++
T Consensus       424 ALVTGga~GIG~A~A~~fa~e-GA~Vvl~D~~~~~-l~~~a~el~~~~~~~~~~~DVtd~~~v~~~v~~~~~~fGgIDiL  501 (676)
T PRK08324        424 ALVTGAAGGIGLATAKRLAAE-GACVVLADIDEEA-AEAAAAELGGRDRALGVACDVTDEAAVQAAFEEAALAFGGVDIV  501 (676)
T ss_pred             EEEECCCCCHHHHHHHHHHHC-CCEEEEEECCHHH-HHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             999479881629999999987-9989999588899-99999997079947999806899999999999999985998889


Q ss_pred             EEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCC-CEEEEECCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             85123433222----222222222222222202478886512322112478-4278630554311222222222222222
Q gi|254780920|r   78 VNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKD-QFRFLQISTDEVYGSLDKGLFSEDMPYN  152 (358)
Q Consensus        78 iHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~-~~~~v~~SS~~vYg~~~~~~~~E~~~~~  152 (358)
                      ++.|+......    +.++....+++|+.|+..+..++....     ...+ .-++|++||....-           +..
T Consensus       502 VnNAGi~~~~~~~e~s~e~w~~~~~vNl~g~f~~~r~a~p~M-----~~qg~GG~IV~isS~~a~~-----------~~~  565 (676)
T PRK08324        502 VSNAGIALSGPIGETSDELWRRSFEVNFTGHFLVAREAVRIM-----KAQGTGGNLVFIASKNAVN-----------PGP  565 (676)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHCCCCCEEEEEECHHHHC-----------CCC
T ss_conf             976777899882659999999999886099999999999999-----9769991999982577526-----------799


Q ss_pred             CCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222333221000000123332---222222222222333-22222222222222222222222222233221133222
Q gi|254780920|r  153 PSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGP-YHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVED  228 (358)
Q Consensus       153 p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp-~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D  228 (358)
                      ....|+.||.+...+.+.++.++   |+++-.+-|..|... ..+....+..  +....|.....+-.+...+-....+|
T Consensus       566 ~~~aY~asKAAl~~Ltr~lA~Ela~~GIRVNaV~Pg~V~t~~~~~~~~~~~~--ra~a~g~~~e~y~~~~~L~R~~~peD  643 (676)
T PRK08324        566 NFGAYSAAKAAELHLVRQYALELGPDGIRVNGVNPDAVRSGSGIWTGEWIEA--RAAAYGLSEEEYMARNLLKREVTPED  643 (676)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCCCCCCCCCCCCCHHHHH--HHHHCCCCHHHHHCCCCCCCCCCHHH
T ss_conf             9689999999999999999999712296999985796477875577334688--88755999899960598899678999


Q ss_pred             CCCCEEECCC---CCCCCCCCCCCCCCC
Q ss_conf             2000000012---222222111357864
Q gi|254780920|r  229 HVRALYLVLK---KGRIGERYNIGGNNE  253 (358)
Q Consensus       229 ~a~~i~~~~~---~~~~~~~fNigs~~~  253 (358)
                      +|+++..+..   ....|.++.+.+|..
T Consensus       644 VA~av~fLASd~ss~iTG~~l~VDGG~~  671 (676)
T PRK08324        644 VAEAFVFLASDLLAKTTGAIITVDGGNA  671 (676)
T ss_pred             HHHHHHHHHCCHHCCCCCCEEEECCCHH
T ss_conf             9999999848074292688778586868


No 123
>PRK12828 short chain dehydrogenase; Provisional
Probab=99.46  E-value=1.1e-13  Score=103.03  Aligned_cols=215  Identities=20%  Similarity=0.211  Sum_probs=142.6

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH----C-CCCE
Q ss_conf             4899767882779999999986898799994788765856777620379749997638899999999862----2-7871
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKE----F-QPDA   76 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~----~-~~d~   76 (358)
                      .+|||||++=||..+++.|+++ |.+|+..|+..... .....++ ...+..++++|++|.+.++++++.    + ++|+
T Consensus         9 valITGas~GIG~aia~~la~~-Ga~V~i~~~~~~~~-~~~~~~~-~~~~~~~~~~Dvt~~~~~~~~v~~~~~~~G~iDi   85 (239)
T PRK12828          9 VVAITGGFGGLGRATAAWLAAR-GARVALIGRGAAPL-SQTLPGV-PADALRIGGIDLVDPQAARRAVDEVNRQFGRLDA   85 (239)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHHH-HHHHHHH-HCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCCE
T ss_conf             8999472548999999999987-99899997987789-9999875-1788569996079999999999999998399979


Q ss_pred             EEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             785123433222----2222222222222222024788865123221124784278630554311222222222222222
Q gi|254780920|r   77 IVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYN  152 (358)
Q Consensus        77 ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~  152 (358)
                      ++|.|+......    ..++....+++|+.|+..+..++..+.     .+.+.-++|.+||.+.+-.           ..
T Consensus        86 lVnNAG~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~p~m-----~~~~~G~IInisS~~~~~~-----------~~  149 (239)
T PRK12828         86 LVNIAGAFVWGTIADGDADTWDRMYGVNVKTTLNASKAALPAL-----TASGGGRIVNIGAGAALKA-----------GP  149 (239)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHCCCCEEEEEECHHHCCC-----------CC
T ss_conf             9989778999990449999999999999699999999999999-----8769986999977786777-----------99


Q ss_pred             CCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222333221000000123332---222222222222333222222222222222222222222222332211332222
Q gi|254780920|r  153 PSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDH  229 (358)
Q Consensus       153 p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~  229 (358)
                      ..+.|+.||.+...+.+..+.++   |+++-.+-|+.+--|...          .......   +     .| +...+|+
T Consensus       150 ~~~~Y~asKaal~~ltk~lA~e~~~~gIrVN~V~PG~v~T~~~~----------~~~~~~~---~-----~r-~~~p~di  210 (239)
T PRK12828        150 GMGAYAAAKAGVARLTEALAAELLDRGITVNAVLPSIIDTPPNR----------ADMPDAD---F-----SR-WVTPEQI  210 (239)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCHH----------CCCCHHH---C-----CC-CCCHHHH
T ss_conf             96899999999999999999986130908999973878882002----------4185646---1-----79-8999999


Q ss_pred             CCCEEECCCC---CCCCCCCCCCCCCCC
Q ss_conf             0000000122---222221113578642
Q gi|254780920|r  230 VRALYLVLKK---GRIGERYNIGGNNER  254 (358)
Q Consensus       230 a~~i~~~~~~---~~~~~~fNigs~~~~  254 (358)
                      |+++..++..   ...|.++.|.+|-.+
T Consensus       211 A~~v~fL~Sd~s~~iTG~~i~VdGG~~l  238 (239)
T PRK12828        211 AAVIAFLLSDEAQAITGASIPVDGGVAL  238 (239)
T ss_pred             HHHHHHHHCCHHCCCCCCEEEECCCCCC
T ss_conf             9999999584422855874897978678


No 124
>PRK06227 consensus
Probab=99.46  E-value=5.3e-14  Score=104.89  Aligned_cols=225  Identities=18%  Similarity=0.148  Sum_probs=143.1

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH-CCCCEEEEECCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             899767882779999999986898799994788765856777620-3797499976388999999998622-----7871
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS-QSNLFSFLQVDICDRECIRSALKEF-----QPDA   76 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~-~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d~   76 (358)
                      +|||||++=||..+++.|+++ |.+|+..|+.... .....+.+. ......++++|++|.+.++++++..     ++|+
T Consensus         8 alVTGas~GIG~aiA~~la~~-Ga~V~i~~~~~~~-~~~~~~~~~~~g~~~~~~~~Dvs~~~~v~~~~~~~~~~~G~iDi   85 (256)
T PRK06227          8 AIVTGGGQGIGAAIAQTFAEN-GAKVVIADIDEEA-GLEREEMLRSNGLDALFVKTDVSDEEDVKNMVRKTVERYGGIDI   85 (256)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHH-HHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCE
T ss_conf             999586688999999999987-9999999698889-99999999955991899981689999999999999998299979


Q ss_pred             EEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             785123433222----2222222222222222024788865123221124784278630554311222222222222222
Q gi|254780920|r   77 IVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYN  152 (358)
Q Consensus        77 ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~  152 (358)
                      ++|.|+......    +.++....+++|+.|+..+..++...     ..+.+.-++|.+||..-+-..           .
T Consensus        86 LVNNAGi~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~p~-----m~~~~~G~IVnisS~~~~~~~-----------~  149 (256)
T PRK06227         86 LINNAGIFSGKSIFERTLEEWERVIRVNLTGPYLCSKYAAEE-----MIKNGGGVIINIASTRAFQSE-----------P  149 (256)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEEECCHHHCCCC-----------C
T ss_conf             998998999989034989999999999829999999999999-----998499779996225545689-----------9


Q ss_pred             CCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCC-C-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222233322100000012333---2222222222222333222-2-222222222222222222222223322113322
Q gi|254780920|r  153 PSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHF-P-EKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVE  227 (358)
Q Consensus       153 p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~-~-~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~  227 (358)
                      ...+|+.||.+...+.+..+.+   +|+++-.+-|+.+--|... . ...-+.+........|         .+-+...+
T Consensus       150 ~~~~Y~asKaav~~lTr~lA~ela~~gIrVNaVaPG~i~T~~~~~~~~~~~~~~~~~~~~~~P---------~gR~g~pe  220 (256)
T PRK06227        150 NTEPYSASKGGIIALTHSLAVSLSKYKIRVVSISPGWIETSEWKKPPLRKKPQLTPLDHLQHP---------AGRVGKPE  220 (256)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHCCC---------CCCCCCHH
T ss_conf             868899999999999999999962029499999618696650005751025777887862688---------77985999


Q ss_pred             CCCCCEEECCCC---CCCCCCCCCCCCCCC
Q ss_conf             220000000122---222221113578642
Q gi|254780920|r  228 DHVRALYLVLKK---GRIGERYNIGGNNER  254 (358)
Q Consensus       228 D~a~~i~~~~~~---~~~~~~fNigs~~~~  254 (358)
                      |++.++..++..   ...|.++.+.+|-+.
T Consensus       221 eiA~~v~FL~Sd~as~iTG~~i~VDGG~t~  250 (256)
T PRK06227        221 DVANLCLFLASDEASFITGVNFIVDGGMTV  250 (256)
T ss_pred             HHHHHHHHHHCCHHCCCCCCEEEECCCEEE
T ss_conf             999999999676324925863896789176


No 125
>PRK07478 short chain dehydrogenase; Provisional
Probab=99.46  E-value=6.7e-14  Score=104.25  Aligned_cols=226  Identities=18%  Similarity=0.086  Sum_probs=144.2

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHH-HHHH-CCCCEEEEECCCCCHHHHHHHHHH-----CCCC
Q ss_conf             89976788277999999998689879999478876585677-7620-379749997638899999999862-----2787
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSL-KEIS-QSNLFSFLQVDICDRECIRSALKE-----FQPD   75 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~-~~~~-~~~~v~~i~~Di~d~~~l~~~~~~-----~~~d   75 (358)
                      +|||||++=||..+++.|+++ |.+|+..|+....  .... +++. ...++.++++|++|.+.++++++.     .++|
T Consensus         9 alVTGas~GIG~aiA~~la~~-Ga~Vvi~~r~~~~--l~~~~~ei~~~g~~~~~~~~Dvt~~~~v~~~v~~~~~~~G~iD   85 (254)
T PRK07478          9 AIITGASSGIGRAAAKLFARE-GAKVVVGARRQAE--LDQLVAEIRAEGGEAVALAGDVRDEAYAKALVALAVERFGGLD   85 (254)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHH--HHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             999588768999999999987-9999999798899--9999999996499089997689999999999999999849998


Q ss_pred             EEEEECCCCCCCC-----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             1785123433222-----22222222222222220247888651232211247842786305543112222222222222
Q gi|254780920|r   76 AIVNFAAESHVDR-----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMP  150 (358)
Q Consensus        76 ~ViHlAa~~~~~~-----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~  150 (358)
                      ++++.|+......     +.++....+++|+.|+..+..++...     ..+.+.-++|++||..-+.    .      .
T Consensus        86 iLVNNAG~~~~~~~~~~~~~~~w~~~~~vNl~g~f~~~~~~~p~-----m~~~~~G~IVnisS~~g~~----~------g  150 (254)
T PRK07478         86 IAFNNAGILGEMGPVPELSLEGWRETLATNLTSAFLGAKHQIPA-----MLARGGGSLIFTSTFVGHT----A------G  150 (254)
T ss_pred             EEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEEEECHHHCC----C------C
T ss_conf             99988743689989144999999999999869999999999999-----9886998799984366433----6------8


Q ss_pred             CCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222233322100000012333---22222222222223332222222222222222222222222223322113322
Q gi|254780920|r  151 YNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVE  227 (358)
Q Consensus       151 ~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~  227 (358)
                      ......|+.||.+...+.+..+.+   +|+++-.+-|+.+.-|......--+........-.|         .+-+...+
T Consensus       151 ~~~~~~Y~asKaav~~lTr~lA~E~a~~gIrVNaV~PG~i~T~~~~~~~~~~~~~~~~~~~~p---------l~R~g~pe  221 (254)
T PRK07478        151 FPGMAAYAASKAGLIGLTQVLAAEYGARGIRVNALLPGGTDTPMGRAAADTPEALAFVAGLHA---------LKRMAQPE  221 (254)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHHCCCCHHHHHHHHCCCC---------CCCCCCHH
T ss_conf             897356798899999999999998570385999997798988757642599999999862899---------88983999


Q ss_pred             CCCCCEEECCCC---CCCCCCCCCCCCCCCC
Q ss_conf             220000000122---2222211135786420
Q gi|254780920|r  228 DHVRALYLVLKK---GRIGERYNIGGNNERK  255 (358)
Q Consensus       228 D~a~~i~~~~~~---~~~~~~fNigs~~~~s  255 (358)
                      |++.++..++..   ...|+++.+.+|-+.|
T Consensus       222 eiA~~v~FLaSd~ss~iTG~~i~VDGG~sls  252 (254)
T PRK07478        222 EIAQAALFLASDAASFVTGTALLADGGVSIT  252 (254)
T ss_pred             HHHHHHHHHHCCHHCCCCCCEEEECCCEECC
T ss_conf             9999999995843238449758878897341


No 126
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain. It uses NADPH to reduce the keto group to a hydroxy group.
Probab=99.46  E-value=2e-13  Score=101.31  Aligned_cols=164  Identities=20%  Similarity=0.248  Sum_probs=113.7

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCC--HHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHHC-----C
Q ss_conf             48997678827799999999868987999947887658--5677762-03797499976388999999998622-----7
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGN--LNSLKEI-SQSNLFSFLQVDICDRECIRSALKEF-----Q   73 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~--~~~~~~~-~~~~~v~~i~~Di~d~~~l~~~~~~~-----~   73 (358)
                      -+|||||+|=||..++++|++++..+|+.+.|......  ......+ ....++.++.+|++|++.+++++...     .
T Consensus         2 tvlVTGas~GIG~~~a~~la~~Ga~~vvl~~R~~~~~~~~~~~~~~~~~~g~~v~~~~~Dv~~~~~~~~~v~~~~~~~g~   81 (180)
T smart00822        2 TYLITGGLGGLGLELARWLAERGARHLVLLSRSGPDAPGAAELLAELEALGAEVTVVACDVADRAALAAALAAIPARLGP   81 (180)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEEECCCCHHHHHHHHHHHHHHCCC
T ss_conf             99997878799999999999879988999868987818899999999956996999980268867766677767997398


Q ss_pred             CCEEEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCC-CCCCCCCCCCCCCC
Q ss_conf             871785123433222----2222222222222222024788865123221124784278630554-31122222222222
Q gi|254780920|r   74 PDAIVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTD-EVYGSLDKGLFSED  148 (358)
Q Consensus        74 ~d~ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~-~vYg~~~~~~~~E~  148 (358)
                      +|++||+|+......    +.++-...+++|+.|+.++.+++.         ......||++||. ..+|.+.       
T Consensus        82 id~lvn~AG~~~~~~~~~~~~~~~~~~~~vnv~g~~~l~~~~~---------~~~~~~iV~~SSiag~~g~~g-------  145 (180)
T smart00822       82 LRGVIHAAGVLDDGLLANLTPERFAAVLAPKVDGAWNLHELTR---------DLPLDFFVLFSSVAGVLGNPG-------  145 (180)
T ss_pred             EEEEEEECCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHC---------CCCCCEEEEECCHHHCCCCCC-------
T ss_conf             3799942466699772559999999999999999999999833---------678856999765876578998-------


Q ss_pred             CCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             222222222333221000000123332222222222222
Q gi|254780920|r  149 MPYNPSSPYSATKASSDYLVLAWGHTYGIPVLLSNCSNN  187 (358)
Q Consensus       149 ~~~~p~s~Yg~sK~~~E~~~~~~~~~~~l~~~ilR~~~v  187 (358)
                           .+.|+.+|.+.+-+.+..+.+ |+++.++.|+.+
T Consensus       146 -----~~~Y~Aak~~l~~la~~~~~~-g~~v~~i~pg~w  178 (180)
T smart00822      146 -----QANYAAANAFLDALAAHRRAR-GLPATSINWGAW  178 (180)
T ss_pred             -----CHHHHHHHHHHHHHHHHHHHC-CCCEEEEECCCC
T ss_conf             -----689999999999999999856-992999847886


No 127
>PRK12937 short chain dehydrogenase; Provisional
Probab=99.46  E-value=7.7e-14  Score=103.89  Aligned_cols=220  Identities=22%  Similarity=0.239  Sum_probs=140.6

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             89976788277999999998689879999478876585677762-03797499976388999999998622-----7871
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEI-SQSNLFSFLQVDICDRECIRSALKEF-----QPDA   76 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~-~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d~   76 (358)
                      +|||||++=||..+++.|+++ |++|+..++........-.+.+ ....++..+++|++|.+.++++++..     .+|+
T Consensus         8 alVTGgs~GIG~aia~~la~~-Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dv~~~~~~~~~v~~~~~~~g~iDi   86 (245)
T PRK12937          8 AIVTGASRGIGAAIARRLAAD-GFAVAVNYAGSAAMADELVEEIEAAGGRAIAVQADVADAAAVDRLFEAAETAFGRIDV   86 (245)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             999485778999999999987-9999997699868999999999965995899983789999999999999998199889


Q ss_pred             EEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             785123433222----2222222222222222024788865123221124784278630554311222222222222222
Q gi|254780920|r   77 IVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYN  152 (358)
Q Consensus        77 ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~  152 (358)
                      ++|.|+......    ..++....+++|+.|+..+..++....      +.+ -++|.+||......           ..
T Consensus        87 lVnNAg~~~~~~~~~~~~e~w~~~~~vNl~~~~~~~~~~~~~m------~~~-G~IInisS~~~~~~-----------~~  148 (245)
T PRK12937         87 LVNSAGIMPLAPIADGDLEGFDRTIAVNLRGAFNVLGEAARHL------RRG-GRIINLSTSVIARA-----------LP  148 (245)
T ss_pred             EEEECCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH------HCC-CEEEEEEECHHCCC-----------CC
T ss_conf             9980548999881349999999999998599999999999999------728-82999973000578-----------99


Q ss_pred             CCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222333221000000123332---222222222222333222222222222222222222222222332211332222
Q gi|254780920|r  153 PSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDH  229 (358)
Q Consensus       153 p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~  229 (358)
                      ....|+.+|.+.+.+.+..+.++   |+++-.+-|+.+--+... +..-+.++....+.-|+         +-+...+|+
T Consensus       149 ~~~~Y~asKaav~~ltk~lA~el~~~gIrVN~I~PG~i~T~~~~-~~~~~e~~~~~~~~~Pl---------~R~g~pedi  218 (245)
T PRK12937        149 GYGPYAASKAAVEGLVHVLANELRGRGITVNAVAPGPTATELFF-NGKSPEQIDQLARLAPL---------ERLGEPDEI  218 (245)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCCC-CCCCHHHHHHHHHCCCC---------CCCCCHHHH
T ss_conf             94889999999999999999996051929999976458875543-67999999999856999---------998399999


Q ss_pred             CCCEEECCC-C--CCCCCCCCCCCC
Q ss_conf             000000012-2--222221113578
Q gi|254780920|r  230 VRALYLVLK-K--GRIGERYNIGGN  251 (358)
Q Consensus       230 a~~i~~~~~-~--~~~~~~fNigs~  251 (358)
                      +.++..++. .  ...|+++.+.+|
T Consensus       219 a~~v~fL~S~~a~~iTG~~i~VDGG  243 (245)
T PRK12937        219 AAAVAFLAGPDGAWVNGQVLRVNGG  243 (245)
T ss_pred             HHHHHHHHCCHHCCCCCCEEEECCC
T ss_conf             9999999687024913873685779


No 128
>PRK06398 aldose dehydrogenase; Validated
Probab=99.46  E-value=3.2e-14  Score=106.19  Aligned_cols=218  Identities=18%  Similarity=0.218  Sum_probs=137.0

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             8997678827799999999868987999947887658567776203797499976388999999998622-----78717
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEF-----QPDAI   77 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d~V   77 (358)
                      +|||||++=||..+++.|+++ |.+|+.+|+....          ......++++|++|.+.++++++..     ++|++
T Consensus         9 alVTGgs~GIG~aia~~la~~-Ga~V~~~~~~~~~----------~~~~~~~i~~Dvt~~~~v~~~v~~~~~~~G~iDiL   77 (256)
T PRK06398          9 VIVTGGSSGIGLAIVSRFVDE-GSKVVSISRSEPE----------DINKSDHIKCDVTNEDEVKNAINEISKKYGRIDVL   77 (256)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCCCC----------CCCCCCEEEECCCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             999687878999999999986-9999999487512----------51722389854799999999999999983999799


Q ss_pred             EEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             85123433222----22222222222222220247888651232211247842786305543112222222222222222
Q gi|254780920|r   78 VNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNP  153 (358)
Q Consensus        78 iHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p  153 (358)
                      +|.|+......    +.++....+++|+.|+.++..++....     .+.+.-++|.+||...+..           ...
T Consensus        78 VNNAG~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~p~m-----~~~~~G~IVnisS~~~~~~-----------~~~  141 (256)
T PRK06398         78 VNNAGIEKYGSLHKTDSGTWRRIIDVNVNGVYYMSKEVIPHM-----LRSGTGSIVNISSVQADIA-----------TKN  141 (256)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHCCCCEEEEEECCCCCCC-----------CCC
T ss_conf             989999999990449999999999997362899999999999-----9839957999804020777-----------999


Q ss_pred             CCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-------CCCCCCCCCCCCCCCCC
Q ss_conf             22223332210000001233322222222222223332222222222222222222-------22222222332211332
Q gi|254780920|r  154 SSPYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGS-------HVFLYGDGQNVRDWLYV  226 (358)
Q Consensus       154 ~s~Yg~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~-------~~~i~g~g~~~Rdfi~v  226 (358)
                      ...|+.||.+...+.+..+.+++- .  +|- |...|+-..+.++... .....+.       .+.-+.+....+-+...
T Consensus       142 ~~~Y~asKaal~~ltrslA~ela~-~--IrV-NaV~PG~i~T~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~Pl~R~g~p  216 (256)
T PRK06398        142 AAAYVTSKHALIGLTKSIAVDYAP-L--IRC-NAVCPGTIDTPLVDKA-AELEVGKDPEAIERKILEWGNLHPMGRIGRP  216 (256)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHCC-C--CEE-EEEEECCCCCHHHHHH-HHHHCCCCHHHHHHHHHHHHCCCCCCCCCCH
T ss_conf             689999999999999999999779-9--889-9997378886166767-6643268989999999976457898897789


Q ss_pred             CCCCCCEEECCCC---CCCCCCCCCCCCC
Q ss_conf             2220000000122---2222211135786
Q gi|254780920|r  227 EDHVRALYLVLKK---GRIGERYNIGGNN  252 (358)
Q Consensus       227 ~D~a~~i~~~~~~---~~~~~~fNigs~~  252 (358)
                      +|+|.++..++..   ...|+++.+.+|-
T Consensus       217 eeiA~~v~FLaSd~as~iTG~~i~VDGG~  245 (256)
T PRK06398        217 EEVASVVAFLASDESSFITGTCLYVDGGL  245 (256)
T ss_pred             HHHHHHHHHHHCCHHCCCCCCEEEECCCH
T ss_conf             99999999994845338338617789393


No 129
>PRK09134 short chain dehydrogenase; Provisional
Probab=99.46  E-value=1.1e-13  Score=102.86  Aligned_cols=224  Identities=18%  Similarity=0.099  Sum_probs=137.3

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH-CCCCEEEEECCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             899767882779999999986898799994788765856777620-3797499976388999999998622-----7871
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS-QSNLFSFLQVDICDRECIRSALKEF-----QPDA   76 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~-~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d~   76 (358)
                      +|||||++-||..+++.|+++ |++|+...+.+...-..-..++. ...+..++++|++|.+.++++++..     ++|+
T Consensus        12 alVTGas~GIG~aiA~~la~~-Ga~V~i~~~~~~~~~~~~~~~i~~~g~~~~~~~~Dl~~~~~~~~~v~~~~~~~G~iDi   90 (256)
T PRK09134         12 ALVTGAARRIGRAIALDLAAH-GFDVAVHYNRSRDEAEALAAEIRALGRRAVALQADLADEAQVRALVARASAALGPITL   90 (256)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             999488678999999999987-9989998499989999999999964991899975589999999999999998299878


Q ss_pred             EEEECCCCCCC----CCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             78512343322----22222222222222222024788865123221124784278630554311222222222222222
Q gi|254780920|r   77 IVNFAAESHVD----RSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYN  152 (358)
Q Consensus        77 ViHlAa~~~~~----~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~  152 (358)
                      .+|.|+.....    ...++-...+++|+.|+..+..++....     .+.+.-++|.+||..++.....          
T Consensus        91 LVnNAg~~~~~~~~~~~~e~w~~~~~vNl~~~~~~~q~~~~~m-----~~~~~G~IVni~s~~~~~~~~~----------  155 (256)
T PRK09134         91 LVNNASLFEYDSAASFTRASWDRHMATNLRAPFVLAQAFARAL-----PADARGLVVNMIDQRVWNLNPD----------  155 (256)
T ss_pred             EEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHCCCEEEEEECCHHHCCCCCC----------
T ss_conf             9988711689970209999999997540105999999999998-----8607806999800765478997----------


Q ss_pred             CCCCCCCCCCCCEEEECCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222223332210000001233322--222222222223332222222222222222222222222223322113322220
Q gi|254780920|r  153 PSSPYSATKASSDYLVLAWGHTYG--IPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV  230 (358)
Q Consensus       153 p~s~Yg~sK~~~E~~~~~~~~~~~--l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~a  230 (358)
                       ...|+.||.+.+.+.+.++++++  +++-.+-|+.+.-...    .-+....+..+.-|+.-         +...+|++
T Consensus       156 -~~~Y~asKaal~~ltr~lA~ela~~IrVN~VaPG~~~~~~~----~~~~~~~~~~~~~pl~R---------~~~pediA  221 (256)
T PRK09134        156 -FLSYTLSKAALWTATRTLAQALAPRIRVNAIGPGPTLPSGR----QSPEDFARQHAATPLGR---------GPNPEEIG  221 (256)
T ss_pred             -CHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCC----CCHHHHHHHHHCCCCCC---------CCCHHHHH
T ss_conf             -15169999999999999999977999899994250056876----79999999983799889---------96999999


Q ss_pred             CCEEECCCC-CCCCCCCCCCCCCCCCH
Q ss_conf             000000122-22222111357864202
Q gi|254780920|r  231 RALYLVLKK-GRIGERYNIGGNNERKN  256 (358)
Q Consensus       231 ~~i~~~~~~-~~~~~~fNigs~~~~s~  256 (358)
                      .++..++.. ...|+++.+.+|...+.
T Consensus       222 ~~v~fLas~~~iTGq~i~VDGG~~l~~  248 (256)
T PRK09134        222 AALRYLLDAPSVTGQMIAVDGGQHLAW  248 (256)
T ss_pred             HHHHHHHCCCCCCCCEEEECCCCCCCC
T ss_conf             999999747887788288696833799


No 130
>PRK07576 short chain dehydrogenase; Provisional
Probab=99.46  E-value=6.8e-14  Score=104.23  Aligned_cols=223  Identities=16%  Similarity=0.136  Sum_probs=142.6

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHH-----CCCC
Q ss_conf             489976788277999999998689879999478876585677762-0379749997638899999999862-----2787
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEI-SQSNLFSFLQVDICDRECIRSALKE-----FQPD   75 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~-~~~~~v~~i~~Di~d~~~l~~~~~~-----~~~d   75 (358)
                      .+|||||++=||+.+++.|.++ |.+|+..|+.... -....+.+ .......++.+|++|.+.++++++.     .++|
T Consensus        10 ~alVTGgs~GIG~aia~~la~~-Ga~V~i~~r~~~~-~~~~~~~l~~~~~~~~~~~~Dv~~~~~~~~~~~~~~~~~G~iD   87 (260)
T PRK07576         10 NVFVVGGTSGINLGIAQAFARA-GANVAVASRSQEK-VDAAVAQLQQAGPEALGVSADVRDYAAVEAAFAAIADEFGPID   87 (260)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHH-HHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             8999589619999999999987-9999999798899-9999999995399489999318999999999999999849998


Q ss_pred             EEEEECCCCCCC----CCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             178512343322----2222222222222222202478886512322112478427863055431122222222222222
Q gi|254780920|r   76 AIVNFAAESHVD----RSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPY  151 (358)
Q Consensus        76 ~ViHlAa~~~~~----~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~  151 (358)
                      ++++.|+.....    ...++....+++|+.|+.++..++....      ++..-++|.+||...+-           +.
T Consensus        88 iLVnnAg~~~~~~~~~~~~~~~~~~~~vnl~~~~~~~~~~~p~m------~~~~G~IInisS~~~~~-----------~~  150 (260)
T PRK07576         88 VLVSGAAGNFPAPAAGMSANGFKTVVDIDLLGTFNVLKAAYPLL------RRPGASIIQISAPQAVV-----------AM  150 (260)
T ss_pred             EEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH------HHCCCEEEEEEECHHCC-----------CC
T ss_conf             99989867899891559999999999986463899999999998------71797799998821136-----------78


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222233322100000012333---222222222222233322222222--2222222222222222222332211332
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLI--PLAITRMIEGSHVFLYGDGQNVRDWLYV  226 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i--~~~i~~~~~g~~~~i~g~g~~~Rdfi~v  226 (358)
                      .....|+.+|.+...+.+..+.+   +|+++-.+-|+.+..+... .+..  +.......+.-|+         +-+.-.
T Consensus       151 ~~~~~y~asKaav~~ltk~lA~e~a~~gIrVN~IaPG~i~~t~~~-~~~~~~~~~~~~~~~~~Pl---------~R~g~p  220 (260)
T PRK07576        151 PMQAHVCAAKAGVDMLTRTLALEWGPEGVRVNSISPGPIAGTEGM-ARLAPTPELQAAVAQSVPL---------KRNGTG  220 (260)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCHHH-HHCCCCHHHHHHHHHCCCC---------CCCCCH
T ss_conf             871899999999999999999997133929999834775783666-6327999999999847999---------998699


Q ss_pred             CCCCCCEEECCCC---CCCCCCCCCCCCCC
Q ss_conf             2220000000122---22222111357864
Q gi|254780920|r  227 EDHVRALYLVLKK---GRIGERYNIGGNNE  253 (358)
Q Consensus       227 ~D~a~~i~~~~~~---~~~~~~fNigs~~~  253 (358)
                      +|++.++..++..   ...|+++.+.+|..
T Consensus       221 edia~~v~FL~Sd~s~~iTG~~i~VDGG~s  250 (260)
T PRK07576        221 QDIANAALFLASDMASYITGVVLPVDGGWS  250 (260)
T ss_pred             HHHHHHHHHHHCCHHCCCCCCEEEECCCCC
T ss_conf             999999999958742482586188793911


No 131
>PRK07775 short chain dehydrogenase; Provisional
Probab=99.46  E-value=9e-14  Score=103.48  Aligned_cols=215  Identities=17%  Similarity=0.173  Sum_probs=137.9

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHH-HH-HCCCCEEEEECCCCCHHHHHHHHHHC-----CC
Q ss_conf             4899767882779999999986898799994788765856777-62-03797499976388999999998622-----78
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLK-EI-SQSNLFSFLQVDICDRECIRSALKEF-----QP   74 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~-~~-~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~   74 (358)
                      .+|||||++=||+.+++.|.++ |++|+..+|...  ....+. .+ .....+..+.+|++|.+.++++++..     .+
T Consensus        12 tAlVTGAssGIG~aiA~~la~~-G~~V~l~~R~~e--~l~~~~~~l~~~g~~~~~~~~Dvtd~~~v~~~v~~~~~~~G~i   88 (275)
T PRK07775         12 PAIVAGASSGIGAATAIELAAH-GFPVALGARRVE--KCEEIVDKIRADGGEAVAFPLDVTDPDSVKSFVAQATEALGDI   88 (275)
T ss_pred             EEEEECCCHHHHHHHHHHHHHC-CCEEEEEECCHH--HHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCC
T ss_conf             7999462359999999999987-998999989899--9999999999649948999912899999999999999985996


Q ss_pred             CEEEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             71785123433222----22222222222222220247888651232211247842786305543112222222222222
Q gi|254780920|r   75 DAIVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMP  150 (358)
Q Consensus        75 d~ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~  150 (358)
                      |+++|.|+......    +.++....+++|+.|+.++..++.-.     ..+.+.-++|++||.+.+.            
T Consensus        89 DiLVnNAG~~~~~~~~e~~~e~~~~~~~vNl~g~~~~~~a~lP~-----M~~~~~G~IV~isS~a~~~------------  151 (275)
T PRK07775         89 EVLVSGAGDTYFGKLHEISTEQFESQVQIHLVGANRLATAVLPG-----MVERRRGDLIFVGSDVALR------------  151 (275)
T ss_pred             CEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEEEECHHHHC------------
T ss_conf             59997675688886010999999999988527999999999999-----9975995799984476506------------


Q ss_pred             CCC-CCCCCCCCCCCEEEECCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCC
Q ss_conf             222-22223332210000001233---322222222222223332222222222222222222222222223322-1133
Q gi|254780920|r  151 YNP-SSPYSATKASSDYLVLAWGH---TYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVR-DWLY  225 (358)
Q Consensus       151 ~~p-~s~Yg~sK~~~E~~~~~~~~---~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~R-dfi~  225 (358)
                      ..| .+.|+.||.+.+.+++..+.   .+|+++..+.|+.|--|-..  ......+....+  ...-+  |...+ .++-
T Consensus       152 ~~p~~~~Y~AsKaav~~lt~~La~El~~~gIrVn~V~PG~v~T~m~~--~~~~~~~~~~~~--~~~~~--~~~~~~~~l~  225 (275)
T PRK07775        152 QRPHMGAYGAAKAGLVAMVTNLQMELEGTGVRASIVHPGPTKTSMGW--SLPAEQIGPALE--DWAKW--GQARHDYFLR  225 (275)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCC--CCCHHHHHHHHH--HHHHH--CCCCCCCCCC
T ss_conf             89998059999999999999999985656908999972688188988--878666405778--88874--1125668989


Q ss_pred             CCCCCCCEEECCCCCCC
Q ss_conf             22220000000122222
Q gi|254780920|r  226 VEDHVRALYLVLKKGRI  242 (358)
Q Consensus       226 v~D~a~~i~~~~~~~~~  242 (358)
                      .+|+|+++..++..+..
T Consensus       226 pedIA~av~flas~P~~  242 (275)
T PRK07775        226 ASDLARAITFVAETPRG  242 (275)
T ss_pred             HHHHHHHHHHHHCCCCC
T ss_conf             99999999999669984


No 132
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=99.45  E-value=1.7e-13  Score=101.86  Aligned_cols=230  Identities=17%  Similarity=0.135  Sum_probs=143.0

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHH----C-CCCE
Q ss_conf             89976788277999999998689879999478876585677762-0379749997638899999999862----2-7871
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEI-SQSNLFSFLQVDICDRECIRSALKE----F-QPDA   76 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~-~~~~~v~~i~~Di~d~~~l~~~~~~----~-~~d~   76 (358)
                      +|||||++=||..+++.|+++ |++|+..++.....-..-...+ ....++.++++|++|.+.++++++.    + ++|+
T Consensus         8 alVTGgs~GIG~aia~~la~~-Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~~~~~~~~~~~~fg~iDi   86 (259)
T PRK12745          8 ALVTGGRRGIGLGIALALAAG-GFDLAINDRPDAEKLAATQQELRALGVEVIFFPADVADLSAHEATLDAAQDAWGRIDC   86 (259)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             999686789999999999987-9989999798667899999999844994899984689999999999999998299889


Q ss_pred             EEEECCCCCCC------CCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCC-CCCCCCEEEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             78512343322------22222222222222222024788865123221-124784278630554311222222222222
Q gi|254780920|r   77 IVNFAAESHVD------RSILGADEFITTNIIGTFILLEETRLWWSCLS-QDKKDQFRFLQISTDEVYGSLDKGLFSEDM  149 (358)
Q Consensus        77 ViHlAa~~~~~------~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~-~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~  149 (358)
                      .+|.|+.....      .+.++....+++|+.|+..+..++-....... ......-++|.+||...+..          
T Consensus        87 LVNNAG~~~~~~~~~~~~~~e~~~~~~~vNl~~~f~~~q~~~~~m~~~~~~~~~~~gsIInisS~~a~~~----------  156 (259)
T PRK12745         87 LVNNAGVGVKKRGDLLDLTPESFDRCLAVNLRGTFFLTQAVAKRMLAQPKPEAELPRSIVTVSSVNAIML----------  156 (259)
T ss_pred             EEECCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCHHHCCC----------
T ss_conf             9984753668899810199999999999973899999999999999652688899708999778765577----------


Q ss_pred             CCCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222233322100000012333---2222222222222333222222222222222222222222222332211332
Q gi|254780920|r  150 PYNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYV  226 (358)
Q Consensus       150 ~~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v  226 (358)
                       .....+|+.||.+.+.+.+..+.+   +|+++-.+-|+.+-.+...  .....+-..+..+. ++       ..-+...
T Consensus       157 -~~~~~~Y~asKaal~~ltr~lA~ela~~gIrVN~IaPG~i~T~~~~--~~~~~~~~~~~~~~-~P-------~~R~g~p  225 (259)
T PRK12745        157 -SPNRGEYCISKAGLSMAAQLFALRLAEEGIGVYEVRPGLIKTDMTA--PVTAKYDELIAKGL-VP-------MGRWGEP  225 (259)
T ss_pred             -CCCCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCC--CCHHHHHHHHHHCC-CC-------CCCCCCH
T ss_conf             -8884788999999999999999998554939999986158887632--00354799998679-99-------8997799


Q ss_pred             CCCCCCEEECCCC---CCCCCCCCCCCCCCC
Q ss_conf             2220000000122---222221113578642
Q gi|254780920|r  227 EDHVRALYLVLKK---GRIGERYNIGGNNER  254 (358)
Q Consensus       227 ~D~a~~i~~~~~~---~~~~~~fNigs~~~~  254 (358)
                      +|++.++..++..   ...|+++.+.+|-.+
T Consensus       226 ~dia~~v~fL~S~~a~yiTGq~i~VDGG~sl  256 (259)
T PRK12745        226 EDVAATVAALAEGKLIYTTGQAIAIDGGLSI  256 (259)
T ss_pred             HHHHHHHHHHHCCCCCCCCCCEEEECCCCCC
T ss_conf             9999999999678004875883888967158


No 133
>PRK06138 short chain dehydrogenase; Provisional
Probab=99.45  E-value=8e-14  Score=103.80  Aligned_cols=224  Identities=17%  Similarity=0.155  Sum_probs=143.3

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH----C-CCCEE
Q ss_conf             899767882779999999986898799994788765856777620379749997638899999999862----2-78717
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKE----F-QPDAI   77 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~----~-~~d~V   77 (358)
                      +|||||++=||..+++.|+++ |.+|+..|+.... -..-...+....++.++++|++|.+.++++++.    + ++|++
T Consensus         8 alVTGas~GIG~aia~~la~~-Ga~V~i~~~~~~~-~~~~~~~~~~~~~~~~~~~Dvs~~~~v~~~~~~~~~~~G~iDiL   85 (252)
T PRK06138          8 AIVTGAGSGIGRATAKLFARE-GARVVVADRDAEA-AERVAAAIAAGGRAFARQGDVGSAEAVEALVDFVAARWGRLDVL   85 (252)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHH-HHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             999474679999999999987-9989999688789-99999998379919999942899999999999999982999899


Q ss_pred             EEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCC-CCCCCCCCCCCCCCCC
Q ss_conf             85123433222----222222222222222202478886512322112478427863055431-1222222222222222
Q gi|254780920|r   78 VNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEV-YGSLDKGLFSEDMPYN  152 (358)
Q Consensus        78 iHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~v-Yg~~~~~~~~E~~~~~  152 (358)
                      +|.|+......    +.++....+++|+.|+..+..++...     ..+.+.-++|.+||... .|.            .
T Consensus        86 VNNAG~~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~p~-----m~~~~~G~IInisS~~~~~~~------------~  148 (252)
T PRK06138         86 VNNAGFGCGGTVVTTDEADWDAVMRVNVGGVFLWAKYAIPI-----MQRQGGGSIVNTASQLALAGG------------R  148 (252)
T ss_pred             EECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEEECCHHHCCCC------------C
T ss_conf             98988999998010999999999999969999999999999-----998199679997656657789------------9


Q ss_pred             CCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCC
Q ss_conf             22222333221000000123332---222222222222333222222222222222222222-22222233221133222
Q gi|254780920|r  153 PSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHV-FLYGDGQNVRDWLYVED  228 (358)
Q Consensus       153 p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~-~i~g~g~~~Rdfi~v~D  228 (358)
                      ....|+.||.+...+.+..+.++   |+++-.+-|+.|--|...      .++.+....+.+ ..+......+-+...+|
T Consensus       149 ~~~~Y~asKaav~~lTk~lA~e~a~~gIrVNaI~PG~i~T~~~~------~~~~~~~~~~~~~~~~~~~~Pl~R~g~ped  222 (252)
T PRK06138        149 GRAAYVASKGAIASLTRAMALDHATDGIRVNAVAPGTIDTPYFR------RIFARHADPEALREALRARHPMNRFGTAEE  222 (252)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCHHHH------HHHHHCCCHHHHHHHHHHCCCCCCCCCHHH
T ss_conf             97789999999999999999986222919999975889973566------776613897999999971799899788999


Q ss_pred             CCCCEEECCCC---CCCCCCCCCCCC
Q ss_conf             20000000122---222221113578
Q gi|254780920|r  229 HVRALYLVLKK---GRIGERYNIGGN  251 (358)
Q Consensus       229 ~a~~i~~~~~~---~~~~~~fNigs~  251 (358)
                      ++.++..+...   ...|+++.+.+|
T Consensus       223 IA~~v~FL~Sd~as~iTG~~i~VDGG  248 (252)
T PRK06138        223 VAQAALFLASDESSFATGTTLVVDGG  248 (252)
T ss_pred             HHHHHHHHHCCHHCCCCCCEEECCCC
T ss_conf             99999999676325936874881853


No 134
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional
Probab=99.45  E-value=8e-14  Score=103.79  Aligned_cols=219  Identities=18%  Similarity=0.219  Sum_probs=140.3

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHH--HCCCCEEEEECCCCCHHHHHHHHHHC-----CCC
Q ss_conf             89976788277999999998689879999478876585677762--03797499976388999999998622-----787
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEI--SQSNLFSFLQVDICDRECIRSALKEF-----QPD   75 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~--~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d   75 (358)
                      +|||||++=||..+++.|+++ |.+|+..++..   ........  ....++.++++|++|.+.++++++..     ++|
T Consensus        18 alVTGas~GIG~aiA~~la~~-Ga~Vvi~~~~~---~~~~~~~~~~~~g~~~~~~~~Dvs~~~~v~~~v~~~~~~~G~iD   93 (258)
T PRK06935         18 AIVTGGNTGLGQGYAVALAKA-GADIIITTHGT---NWDETRRLIEKEGRKVTFVQLDLTKKESAEAVVAEALEKFGKID   93 (258)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEECCCC---CHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCC
T ss_conf             999485758999999999987-99999972997---89999999996699379999048999999999999999749999


Q ss_pred             EEEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCC-CCCCCCCCCCCCC
Q ss_conf             1785123433222----2222222222222222024788865123221124784278630554311-2222222222222
Q gi|254780920|r   76 AIVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVY-GSLDKGLFSEDMP  150 (358)
Q Consensus        76 ~ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vY-g~~~~~~~~E~~~  150 (358)
                      +++|.|+......    +.++....+++|+.|+..+..++...     ..+.+.-++|.+||..-+ |.           
T Consensus        94 iLVNNAG~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~~~-----m~~~~~G~IInisS~~~~~g~-----------  157 (258)
T PRK06935         94 ILVNNAGTIRRAPLLEYKDEDWQAVIDINLNSVYHLSQAVAKV-----MAKQGSGKIINIASMLSFQGG-----------  157 (258)
T ss_pred             EEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCCEEEEEEHHHCCCC-----------
T ss_conf             9998999999998023999999999998647899999999999-----998389818999532016788-----------


Q ss_pred             CCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222233322100000012333---22222222222223332222222222222222222222222223322113322
Q gi|254780920|r  151 YNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVE  227 (358)
Q Consensus       151 ~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~  227 (358)
                       ....+|+.||.+...+.+..+.+   +|+++-.+-|+.+.-|....-..-+.........-|+         +-+...+
T Consensus       158 -~~~~~Y~asKaav~~lTr~lA~e~a~~gIrVNaVaPG~i~T~~~~~~~~~~~~~~~~~~~iPl---------gR~g~pe  227 (258)
T PRK06935        158 -KFVPPYTASKHGVAGLTKAFANELAAYNIQVNAIAPGYIKTANTAPIRADKARNAEILKRIPA---------GRWGEPD  227 (258)
T ss_pred             -CCCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCCCHHHHHHHHHCCCC---------CCCCCHH
T ss_conf             -887669999999999999999997226989999854889786501124799999999955999---------9977899


Q ss_pred             CCCCCEEECCCC---CCCCCCCCCCCC
Q ss_conf             220000000122---222221113578
Q gi|254780920|r  228 DHVRALYLVLKK---GRIGERYNIGGN  251 (358)
Q Consensus       228 D~a~~i~~~~~~---~~~~~~fNigs~  251 (358)
                      |++.++..+...   ...|+++.+.+|
T Consensus       228 eiA~~v~FLaSd~s~~iTG~~i~VDGG  254 (258)
T PRK06935        228 DLMGAAVFLASRASDYVNGHILAVDGG  254 (258)
T ss_pred             HHHHHHHHHHCCHHCCCCCCEEEECCC
T ss_conf             999999998384326912872897858


No 135
>PRK06924 short chain dehydrogenase; Provisional
Probab=99.45  E-value=1.4e-13  Score=102.23  Aligned_cols=215  Identities=19%  Similarity=0.186  Sum_probs=126.3

Q ss_pred             CE-EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC-------
Q ss_conf             94-8997678827799999999868987999947887658567776203797499976388999999998622-------
Q gi|254780920|r    1 MR-LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEF-------   72 (358)
Q Consensus         1 Mk-ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~-------   72 (358)
                      || +|||||++=||..++++|+++ |++|+++++.... ....... ...+++.++++|++|.+.+++.++..       
T Consensus         1 MK~alITGas~GIG~aiA~~la~~-G~~V~~~~r~~~~-~~~~~~~-~~~~~~~~~~~Dv~d~~~~~~~~~~~~~~~~~~   77 (251)
T PRK06924          1 MRYVIITGTSKGLGEAIATQLLEK-GTSVISISRRENK-ELTKLAE-QYNSNLTFHSLDLQDLHNLETNFNEILSSIQED   77 (251)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCCHH-HHHHHHH-HHCCCCEEEEEEECCHHHHHHHHHHHHHHHHHC
T ss_conf             999999298749999999999987-9999999798227-8999998-746893699997058999999999999986431


Q ss_pred             --CCCEEEEECCCCCCCC-----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCC
Q ss_conf             --7871785123433222-----222222222222222202478886512322112478427863055431122222222
Q gi|254780920|r   73 --QPDAIVNFAAESHVDR-----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLF  145 (358)
Q Consensus        73 --~~d~ViHlAa~~~~~~-----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~  145 (358)
                        ..+.++|.|+...+..     +.++-...+++|+.|+..+..++.....    ...+..++|.+||.+...       
T Consensus        78 ~~~~i~LVnNAG~~~~~~~~~~~~~~~~~~~~~vNl~g~~~l~~~~~~~~~----~~~~~g~IvnisS~a~~~-------  146 (251)
T PRK06924         78 DVSSIHLINNAGMVAPIKPAEKAESEQLITHVHINLLAPMILTSTFMKHTK----DWKVDKRVINISSGAAKN-------  146 (251)
T ss_pred             CCCCEEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHCCCCCEEEEEEHHHCC-------
T ss_conf             568648995487645568621199999999998760999999999999999----847998549997243258-------


Q ss_pred             CCCCCCCCCCCCCCCCCCCEEEECCCCC-----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCC
Q ss_conf             2222222222223332210000001233-----32222222222222333222222222222222222-22222222233
Q gi|254780920|r  146 SEDMPYNPSSPYSATKASSDYLVLAWGH-----TYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEG-SHVFLYGDGQN  219 (358)
Q Consensus       146 ~E~~~~~p~s~Yg~sK~~~E~~~~~~~~-----~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g-~~~~i~g~g~~  219 (358)
                          +....+.|+.||.+.+.+.+..+.     .+++++..+-|+.|--|...      .+....... +.+.-+..-..
T Consensus       147 ----~~~~~~~Y~aSKaal~~ltk~lA~E~~~~~~~I~v~av~PG~v~T~m~~------~~~~~~~~~~~~~~~~~~~~~  216 (251)
T PRK06924        147 ----PYFGWSAYCSSKAGLNMFTQTVATEQEEEEYPVKIIAFSPGVMDTNMQA------QIRSSSKEDFTNLDRFITLKE  216 (251)
T ss_pred             ----CCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCHHHH------HHHHHCHHHHHHHHHHHCCCC
T ss_conf             ----9999769999999999999999998371599989999840788474567------774302443999998764787


Q ss_pred             CCCCCCCCCCCCCEEECCCC
Q ss_conf             22113322220000000122
Q gi|254780920|r  220 VRDWLYVEDHVRALYLVLKK  239 (358)
Q Consensus       220 ~Rdfi~v~D~a~~i~~~~~~  239 (358)
                      .--+...+|+|+++..++..
T Consensus       217 ~gr~~~PeevA~~v~fL~s~  236 (251)
T PRK06924        217 EGKLLSPEYVAGALRNLLET  236 (251)
T ss_pred             CCCCCCHHHHHHHHHHHHCC
T ss_conf             89997999999999999778


No 136
>PRK06953 short chain dehydrogenase; Provisional
Probab=99.45  E-value=1e-13  Score=103.10  Aligned_cols=165  Identities=18%  Similarity=0.116  Sum_probs=108.4

Q ss_pred             CE-EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC---CCCE
Q ss_conf             94-8997678827799999999868987999947887658567776203797499976388999999998622---7871
Q gi|254780920|r    1 MR-LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEF---QPDA   76 (358)
Q Consensus         1 Mk-ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~---~~d~   76 (358)
                      || ||||||+.=||..++++|+++ |++|++..|..     ..+..+ ...+.+.+++|++|.+.++.+....   .+|+
T Consensus         1 MK~~LVTGas~GIG~a~a~~la~~-G~~V~~~~R~~-----~~l~~l-~~~~~~~~~~Dv~d~~~v~~~~~~~~~~~ldi   73 (222)
T PRK06953          1 MKTVLIVGASRGIGLEFVRQYRAD-GWRVIATARDA-----AGLAAL-RALGAEALALDVADPESIAGLGWKLDGEALDA   73 (222)
T ss_pred             CCEEEECCCCHHHHHHHHHHHHHC-CCEEEEEECCH-----HHHHHH-HHCCCCEEEEECCCHHHHHHHHHHHCCCCCCE
T ss_conf             999999475729999999999988-89999996888-----889998-84215177740589999999998623677678


Q ss_pred             EEEECCCCCCCC-C-----CCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCC-CCCCCCCCCCCCCCC
Q ss_conf             785123433222-2-----222222222222222024788865123221124784278630554-311222222222222
Q gi|254780920|r   77 IVNFAAESHVDR-S-----ILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTD-EVYGSLDKGLFSEDM  149 (358)
Q Consensus        77 ViHlAa~~~~~~-~-----~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~-~vYg~~~~~~~~E~~  149 (358)
                      ++|.|+...+.. .     .++-...+++|+.|+..+..++.-.      .+....+++.+||. ...+...        
T Consensus        74 li~nAGi~~~~~~~~~~~~~~~~~~~~~vN~~g~~~l~~~~lP~------l~~~~g~ii~iSS~~gs~~~~~--------  139 (222)
T PRK06953         74 AVYVAGVYGPRTEGVEPITREDFDAVMHTNVLGPMQLLPILLPL------VEAAGGVLAVLSSRMGSIGEAT--------  139 (222)
T ss_pred             EEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH------HHHCCCCCCEECCCEEEECCCC--------
T ss_conf             99816655678765466899999999987119999999999999------9857998524567764313788--------


Q ss_pred             CCCCCCCCCCCCCCCEEEECCCCCCC-CCCCCCCCCCCC
Q ss_conf             22222222333221000000123332-222222222222
Q gi|254780920|r  150 PYNPSSPYSATKASSDYLVLAWGHTY-GIPVLLSNCSNN  187 (358)
Q Consensus       150 ~~~p~s~Yg~sK~~~E~~~~~~~~~~-~l~~~ilR~~~v  187 (358)
                       ......|+.||.+.+.+++..+.++ ++.+..+-|+.|
T Consensus       140 -~~~~~~Y~aSKaAl~~~~~~la~e~~~i~v~ai~PG~v  177 (222)
T PRK06953        140 -GTTGWLYRASKAALNDALRIASLQARHAACIALHPGWV  177 (222)
T ss_pred             -CCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCC
T ss_conf             -86328789999999999999986547988999946782


No 137
>PRK07814 short chain dehydrogenase; Provisional
Probab=99.45  E-value=9e-14  Score=103.48  Aligned_cols=225  Identities=15%  Similarity=0.089  Sum_probs=139.7

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHH-HHHH-CCCCEEEEECCCCCHHHHHHHHHH----C-CC
Q ss_conf             489976788277999999998689879999478876585677-7620-379749997638899999999862----2-78
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSL-KEIS-QSNLFSFLQVDICDRECIRSALKE----F-QP   74 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~-~~~~-~~~~v~~i~~Di~d~~~l~~~~~~----~-~~   74 (358)
                      .+|||||++=||+.++..|+++ |.+|+..++...  ..... +++. ...++.++.+|++|++.++++++.    + ++
T Consensus        12 valITGgs~GIG~aia~~la~~-Ga~V~i~~~~~~--~l~~~~~~i~~~g~~~~~~~~Dv~~~~~v~~~v~~~~~~~G~i   88 (263)
T PRK07814         12 VAVVTGAGRGLGAAIALAFAEA-GADVLIAARTES--QLDEVAEQIRAAGRRAHVVAADLAHPEATAGLAGQAVEAFGRL   88 (263)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHH--HHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCC
T ss_conf             8999589668999999999987-998999969899--9999999998529928999815899999999999999982998


Q ss_pred             CEEEEECCCCCCC----CCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             7178512343322----222222222222222220247888651232211247842786305543112222222222222
Q gi|254780920|r   75 DAIVNFAAESHVD----RSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMP  150 (358)
Q Consensus        75 d~ViHlAa~~~~~----~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~  150 (358)
                      |+++|.|+.....    .+.++....+++|+.|+..+..++.....    ...+.-++|.+||..-.-           +
T Consensus        89 DiLVnNAg~~~~~~~~~~~~e~w~~~~~vNl~~~~~~~~~~~~~m~----~~~~~G~IInisS~~~~~-----------~  153 (263)
T PRK07814         89 DIVVNNVGGTMPNPLLSTSTKDLADAFTFNVATAHALTRAAVPLML----EHSGGGSIINITSTMGRL-----------A  153 (263)
T ss_pred             CEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHCCCCEEEEEECHHHCC-----------C
T ss_conf             8999898667888445488999999999971999999999999999----847994699981265477-----------8


Q ss_pred             CCCCCCCCCCCCCCEEEECCCCCCCC--CCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222223332210000001233322--2222222222233322222222--2222222222222222222332211332
Q gi|254780920|r  151 YNPSSPYSATKASSDYLVLAWGHTYG--IPVLLSNCSNNYGPYHFPEKLI--PLAITRMIEGSHVFLYGDGQNVRDWLYV  226 (358)
Q Consensus       151 ~~p~s~Yg~sK~~~E~~~~~~~~~~~--l~~~ilR~~~vyGp~~~~~~~i--~~~i~~~~~g~~~~i~g~g~~~Rdfi~v  226 (358)
                      ......|+.+|.+.+.+.+..+.+++  +++-.+-|+.+--+..  ....  +.+...+.+.-|         .+-+...
T Consensus       154 ~~~~~~Y~asKaal~~ltk~lA~e~a~~IrVN~V~PG~i~T~~~--~~~~~~~~~~~~~~~~~P---------l~R~g~p  222 (263)
T PRK07814        154 GRGFAAYGTAKAALAHYTRLAALDLCPRIRVNAIAPGSILTSAL--EVVAANDELRAPMEKATP---------LRRLGDP  222 (263)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCHHH--HHCCCCHHHHHHHHHCCC---------CCCCCCH
T ss_conf             99848899999999999999999977997899997798886045--432599999999985799---------8898099


Q ss_pred             CCCCCCEEECCCC---CCCCCCCCCCCCCCCC
Q ss_conf             2220000000122---2222211135786420
Q gi|254780920|r  227 EDHVRALYLVLKK---GRIGERYNIGGNNERK  255 (358)
Q Consensus       227 ~D~a~~i~~~~~~---~~~~~~fNigs~~~~s  255 (358)
                      +|++.++..++..   ...|+++.+.+|-+++
T Consensus       223 edia~~v~FL~Sd~s~~iTG~~i~VDGG~t~~  254 (263)
T PRK07814        223 EDIAAAAVYLASPAGSYLTGKTLEVDGGLTFP  254 (263)
T ss_pred             HHHHHHHHHHHCCHHCCCCCCEEEECCCEECC
T ss_conf             99999999994843259448828868798289


No 138
>PRK07776 consensus
Probab=99.45  E-value=1.5e-13  Score=102.10  Aligned_cols=221  Identities=16%  Similarity=0.089  Sum_probs=138.7

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH----C-CCCE
Q ss_conf             4899767882779999999986898799994788765856777620379749997638899999999862----2-7871
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKE----F-QPDA   76 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~----~-~~d~   76 (358)
                      .+|||||++-||+.+++.|+++ |.+|+..|+...  .......-.......++.+|++|++.++++++.    + ++|+
T Consensus        10 v~lITG~~~GIG~aiA~~la~~-Ga~V~i~~~~~~--~l~~~~~~l~~~~~~~~~~Dv~~~~~~~~~~~~~~~~~g~iDi   86 (252)
T PRK07776         10 TAIVTGASRGIGLAIAQALAAA-GANVVITARKQE--ALDEAAAQLGAERALGVAGHAVDEEHAREAVDLTLERFGSVDI   86 (252)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHH--HHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             8999477879999999999987-998999979889--9999999847995799997428999999999999998499869


Q ss_pred             EEEECCCCCCC-----CCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             78512343322-----2222222222222222202478886512322112478427863055431122222222222222
Q gi|254780920|r   77 IVNFAAESHVD-----RSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPY  151 (358)
Q Consensus        77 ViHlAa~~~~~-----~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~  151 (358)
                      ++|-|+...+.     .+.++....+++|+.|+..+..++....     .+.+.-++|.+||...+-..           
T Consensus        87 lVnNAg~~~~~~~~~e~~~e~w~~~~~~Nl~~~~~~~~~~~~~m-----~~~~~G~IInisS~~~~~~~-----------  150 (252)
T PRK07776         87 LVNNAGTNPAYGPLIDQDLARFRKIFEVNVWAALGWTQLAWKAW-----MGEHGGAVVNVASIGGLHPS-----------  150 (252)
T ss_pred             EEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHCCCCEEEECCCCCCCCCC-----------
T ss_conf             99878668889981349999999999998078999999999998-----66279649980774411579-----------


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222223332210000001233322--22222222222333222222222222222222222222222332211332222
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGHTYG--IPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDH  229 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~~~~--l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~  229 (358)
                      .-.++|+.||.+...+.+..+.+++  +++-.+-|+.+..|..  ....+..-......-|         .+-+...+|+
T Consensus       151 ~~~~~Y~asKaav~~ltk~lA~e~a~~IrVN~V~PG~i~T~~~--~~~~~~~~~~~~~~iP---------l~R~g~p~di  219 (252)
T PRK07776        151 PGIGAYGASKAALIHLTKQLALELAPRVRVNAVAPGVVRTKFA--EALWEGREDEVAASYP---------LGRLGEPEDI  219 (252)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCH--HHHHHHHHHHHHHCCC---------CCCCCCHHHH
T ss_conf             9847999999999999999999986998899996457988541--1220558999985799---------9998099999


Q ss_pred             CCCEEECCCC---CCCCCCCCCCCCC
Q ss_conf             0000000122---2222211135786
Q gi|254780920|r  230 VRALYLVLKK---GRIGERYNIGGNN  252 (358)
Q Consensus       230 a~~i~~~~~~---~~~~~~fNigs~~  252 (358)
                      +.++..++..   ...|+++.|.+|-
T Consensus       220 a~~v~fL~S~~ss~iTGq~i~VDGG~  245 (252)
T PRK07776        220 ASAVAFLVSDAASWITGETLVVDGGL  245 (252)
T ss_pred             HHHHHHHHCCHHCCCCCCEEEECCCC
T ss_conf             99999995874248058729989571


No 139
>PRK07074 short chain dehydrogenase; Provisional
Probab=99.45  E-value=1.1e-13  Score=102.94  Aligned_cols=221  Identities=17%  Similarity=0.142  Sum_probs=141.2

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH---C-CCCEEE
Q ss_conf             899767882779999999986898799994788765856777620379749997638899999999862---2-787178
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKE---F-QPDAIV   78 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~---~-~~d~Vi   78 (358)
                      +|||||++-||+.+++.|+++ |.+|+..|+...  ............++..+.+|++|.+.++.+++.   + ++|+++
T Consensus         5 alITGgs~GIG~aia~~la~~-Ga~V~~~~r~~~--~~~~~~~~l~~~~~~~~~~Dv~~~~~~~~~~~~i~~~g~iDiLV   81 (256)
T PRK07074          5 ALVTGAAGGIGQALARRFLAA-GDRVLALDIDRA--ALAAFVDALGDAAVAPVICDLTDAASVERLAAALANEGPVDVLV   81 (256)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHH--HHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCEEE
T ss_conf             999884689999999999986-999999979889--99999998269977999972799999999999999859987999


Q ss_pred             EECCCCCCC----CCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             512343322----2222222222222222202478886512322112478427863055431122222222222222222
Q gi|254780920|r   79 NFAAESHVD----RSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPS  154 (358)
Q Consensus        79 HlAa~~~~~----~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~  154 (358)
                      |-|+.....    .+.++....+++|+.|+..+..++...     ..+.+.-++|++||..-++.     .       +.
T Consensus        82 NNAG~~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~p~-----m~~~~~G~IInisS~~~~~~-----~-------~~  144 (256)
T PRK07074         82 ANAGAARAATLHDTTSASWRADNALNLEATYLCVEAVEAG-----MKARSRGAIVNIGSVNGMAA-----L-------GH  144 (256)
T ss_pred             ECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEEEECHHHCCC-----C-------CC
T ss_conf             8887789989155999999999999859999999999999-----98759976999966565676-----8-------85


Q ss_pred             CCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222333221000000123332---2222222222223332222-222222222222222222222223322113322220
Q gi|254780920|r  155 SPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFP-EKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV  230 (358)
Q Consensus       155 s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~-~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~a  230 (358)
                      ..|+.+|.+...+.+..+.++   |+++-.+=|+.+-.|.... ..--|.+..++.+.-|+         +-+.-.+|+|
T Consensus       145 ~~Y~asKaal~~ltk~lA~e~~~~gIrVN~VaPG~i~T~~~~~~~~~~~~~~~~~~~~~Pl---------~R~g~pedIA  215 (256)
T PRK07074        145 PAYSAAKAGLISYTKSLAIEYGRFGIRANAVCPGTVKTQAWEARVAANPQVFEELKKWYPL---------QDFATPDDVA  215 (256)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCHHHHHHHHCCHHHHHHHHHCCCC---------CCCCCHHHHH
T ss_conf             7899999999999999999964249799998427798736664322499999999847998---------8986999999


Q ss_pred             CCEEECCCC---CCCCCCCCCCCCC
Q ss_conf             000000122---2222211135786
Q gi|254780920|r  231 RALYLVLKK---GRIGERYNIGGNN  252 (358)
Q Consensus       231 ~~i~~~~~~---~~~~~~fNigs~~  252 (358)
                      +++..+...   ...|.++.+.+|-
T Consensus       216 ~~v~FLaS~~as~iTG~~i~VDGG~  240 (256)
T PRK07074        216 NAVLFLASPAARAITGVCLPVDGGL  240 (256)
T ss_pred             HHHHHHHCCHHCCCCCCEEEECCCH
T ss_conf             9999995805359358738858870


No 140
>PRK06123 short chain dehydrogenase; Provisional
Probab=99.45  E-value=1.7e-13  Score=101.81  Aligned_cols=226  Identities=19%  Similarity=0.173  Sum_probs=139.4

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH-CCCCEEEEECCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             899767882779999999986898799994788765856777620-3797499976388999999998622-----7871
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS-QSNLFSFLQVDICDRECIRSALKEF-----QPDA   76 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~-~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d~   76 (358)
                      +|||||++=||+.+++.|+++ |++|+..++.....-..-...+. ...++.++++|+++.+.++++++..     ++|+
T Consensus         6 alITGas~GIG~aia~~la~~-Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~~G~iDi   84 (249)
T PRK06123          6 MIITGASRGIGAATALLAAER-GYAVCLNYLRNRDAAEAVVQAIRRQGGEALAVAADVADEADVLRLFEAVDRELGRLDA   84 (249)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             999686879999999999987-9989998089878999999999964990999984799999999999999998299878


Q ss_pred             EEEECCCCCCCCC-----CCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCC-CCCCCCCCCCCCC
Q ss_conf             7851234332222-----222222222222222024788865123221124784278630554311-2222222222222
Q gi|254780920|r   77 IVNFAAESHVDRS-----ILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVY-GSLDKGLFSEDMP  150 (358)
Q Consensus        77 ViHlAa~~~~~~~-----~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vY-g~~~~~~~~E~~~  150 (358)
                      ++|.|+.......     .++....+++|+.|+..+..++.......  .....-.+|.+||..-. |.           
T Consensus        85 LVnNAG~~~~~~~~~~~~~~~w~~~~~vNl~~~~~~~~~~~~~m~~~--~~g~~g~IInisS~~~~~~~-----------  151 (249)
T PRK06123         85 LVNNAGILEAQMRLEQMDAARLTRIFATNVVGSFLCAREAVKRMSTR--HGGRGGAIVNVSSMAARLGS-----------  151 (249)
T ss_pred             EEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HCCCCCEEEEECCHHHCCCC-----------
T ss_conf             99888557899972129999999998540699999999999999997--08998379997447656589-----------


Q ss_pred             CCCCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222333221000000123332---2222222222223332222222222222222222222222223322113322
Q gi|254780920|r  151 YNPSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVE  227 (358)
Q Consensus       151 ~~p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~  227 (358)
                      +.....|+.||.+.+.+.+..+.++   |+++-.+-|+.+.-+.... ..-+....++...-|+.         -+...+
T Consensus       152 ~~~~~~Y~asKaav~~ltr~lA~ela~~gIrvN~IaPG~i~T~~~~~-~~~~~~~~~~~~~ipl~---------R~g~pe  221 (249)
T PRK06123        152 PGEYIDYAASKGAIDTMTIGLAKEVAAEGIRVNAVRPGVIYTEIHAS-GGEPGRVDRVKAGIPMG---------RGGTAE  221 (249)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCC-CCCHHHHHHHHHCCCCC---------CCCCHH
T ss_conf             83068789999999999999999986559699999867897743212-59979999998579989---------983999


Q ss_pred             CCCCCEEECCCC---CCCCCCCCCCCCC
Q ss_conf             220000000122---2222211135786
Q gi|254780920|r  228 DHVRALYLVLKK---GRIGERYNIGGNN  252 (358)
Q Consensus       228 D~a~~i~~~~~~---~~~~~~fNigs~~  252 (358)
                      |+++++..++..   ...|+++.+.+|+
T Consensus       222 dvA~~v~fL~S~~s~~iTGq~i~VdGGq  249 (249)
T PRK06123        222 EVARAILWLLSDEASYTTGTFIDVSGGR  249 (249)
T ss_pred             HHHHHHHHHHCCHHCCCCCCEEEECCCC
T ss_conf             9999999996862258658557848999


No 141
>PRK07523 gluconate 5-dehydrogenase; Provisional
Probab=99.45  E-value=7.6e-14  Score=103.92  Aligned_cols=223  Identities=20%  Similarity=0.207  Sum_probs=142.8

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             48997678827799999999868987999947887658567776203797499976388999999998622-----7871
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEF-----QPDA   76 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d~   76 (358)
                      .+|||||++=||..+++.|.++ |.+|+..++...  ....... ........+.+|++|.+.++++++..     ++|+
T Consensus        11 ~alVTG~s~GIG~aiA~~la~~-Ga~Vvi~~r~~~--~l~~~~~-~l~~~~~~~~~Dvtd~~~v~~~v~~~~~~~G~iDi   86 (251)
T PRK07523         11 RALITGSSQGIGYALAKGLAQA-GAEVILNGRDAA--KLAAAAE-SLKGSAHTLAFDVTDHDAVRAAIDAFEAEIGPIDI   86 (251)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHH--HHHHHHH-HCCCCCEEEEEECCCHHHHHHHHHHHHHHCCCCCE
T ss_conf             8999583669999999999987-999999969989--9999999-81887279999579999999999999997599869


Q ss_pred             EEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCC-CCCCCCCCCCCCCCC
Q ss_conf             785123433222----222222222222222202478886512322112478427863055431-122222222222222
Q gi|254780920|r   77 IVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEV-YGSLDKGLFSEDMPY  151 (358)
Q Consensus        77 ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~v-Yg~~~~~~~~E~~~~  151 (358)
                      ++|.|+......    +.++....+++|+.|+..+..++...     ..+.+.-++|.+||... .+.            
T Consensus        87 LVNNAG~~~~~~~~~~~~e~~~~~~~vNl~~~f~~~~~~~~~-----m~~~~~G~IInisS~~~~~~~------------  149 (251)
T PRK07523         87 LVNNAGMQHRTPLEDFPADAFERLLQTNISSVFYVGQAVARH-----MIARGAGKIINIASVQSALAR------------  149 (251)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEEEEEHHHCCCC------------
T ss_conf             998988799999055999999999999739999999999899-----886399679999415760768------------


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222233322100000012333---222222222222233322222222222222222222222222233221133222
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVED  228 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D  228 (358)
                      ....+|+.||.+.+.+.+..+.+   +|+++-.+-|+.+-.|....-.--+.+...+.+.-|+         .-+...+|
T Consensus       150 ~~~~~Y~asKaav~~lTr~lA~e~a~~gIrVNaVaPG~i~T~~~~~~~~~~~~~~~~~~~~Pl---------gR~g~pee  220 (251)
T PRK07523        150 PGIAPYTATKGAVGNLTKGMATDWAKHGLQCNAIAPGYFDTPLNAALVADPEFSAWLEKRTPA---------GRWGKVEE  220 (251)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHHHCCCHHHHHHHHHCCCC---------CCCCCHHH
T ss_conf             994789999999999999999997020949999973789873243213899999999857999---------99789999


Q ss_pred             CCCCEEECCCC---CCCCCCCCCCCCCCC
Q ss_conf             20000000122---222221113578642
Q gi|254780920|r  229 HVRALYLVLKK---GRIGERYNIGGNNER  254 (358)
Q Consensus       229 ~a~~i~~~~~~---~~~~~~fNigs~~~~  254 (358)
                      ++.++..+...   ...|+++.+.+|-.-
T Consensus       221 ia~~v~fLaSd~s~~iTG~~i~VDGG~tA  249 (251)
T PRK07523        221 LVGACIFLASDASSFVNGHVLYVDGGITA  249 (251)
T ss_pred             HHHHHHHHHCCHHCCCCCCEEEECCCCCC
T ss_conf             99999999487424826874880938113


No 142
>PRK05717 oxidoreductase; Validated
Probab=99.44  E-value=1.2e-13  Score=102.70  Aligned_cols=222  Identities=18%  Similarity=0.175  Sum_probs=137.6

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH-----CCCCEE
Q ss_conf             899767882779999999986898799994788765856777620379749997638899999999862-----278717
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKE-----FQPDAI   77 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~-----~~~d~V   77 (358)
                      +|||||+|=||..++++|+++ |.+|+..|+...  ....+... ...+..++.+|++|.+.++++++.     .++|++
T Consensus        13 alITG~s~GIG~aia~~la~~-Ga~V~i~~~~~~--~~~~~~~~-~~~~~~~~~~Dvt~~~~v~~~i~~~~~~~G~id~l   88 (255)
T PRK05717         13 ALVTGAARGIGLGIAAWLIAE-GWQVVLADLDRE--RGAKVAKA-LGENAWFIAMDVADEAQVAAGVAEVLGQFGRLDAL   88 (255)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHH--HHHHHHHH-HCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             999587888999999999987-998999969889--99999998-48975899930799999999999999982999899


Q ss_pred             EEECCCCCCC------CCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             8512343322------2222222222222222202478886512322112478427863055431122222222222222
Q gi|254780920|r   78 VNFAAESHVD------RSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPY  151 (358)
Q Consensus        78 iHlAa~~~~~------~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~  151 (358)
                      ++.|+...+.      .+.++....+++|+.|+..+..++....      +...-++|.+||......           .
T Consensus        89 vnNAg~~~~~~~~l~~~~~~~w~~~~~vNl~g~f~~~k~~~~~m------~~~~G~IInisS~~~~~~-----------~  151 (255)
T PRK05717         89 VCNAAIANPHNTTLESLSLAQWNRVLAVNLGGPMLLAKHCAPYL------RAHNGAIVNLASTRARQS-----------E  151 (255)
T ss_pred             EECCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHCHHHH------HHCCCCEEEEEECCCCCC-----------C
T ss_conf             98773057899983559999999999986042657766431988------747998699976014547-----------8


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222223332210000001233322--22222222222333222222222222222222222222222332211332222
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGHTYG--IPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDH  229 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~~~~--l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~  229 (358)
                      .....|+.+|.+.+.+.+..+.+++  +++-.+-|+.+-.+... ... ..-+.......      .|  .+-+...+|+
T Consensus       152 ~~~~~Y~asKaal~~ltkslA~e~a~~IRvN~I~PG~i~t~~~~-~~~-~~~~~~~~~~~------~P--l~R~g~~edi  221 (255)
T PRK05717        152 PDTEAYAASKGGLLALTHALAISLGPEIRVNAVSPGWIDARDPS-QRR-AEPLSEADHAQ------HP--AGRVGTVEDV  221 (255)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHH-HHC-CHHHHHHHHHC------CC--CCCCCCHHHH
T ss_conf             98376799999999999999999779998999962718888745-524-64689999847------99--7898199999


Q ss_pred             CCCEEECCCC---CCCCCCCCCCCCCCCC
Q ss_conf             0000000122---2222211135786420
Q gi|254780920|r  230 VRALYLVLKK---GRIGERYNIGGNNERK  255 (358)
Q Consensus       230 a~~i~~~~~~---~~~~~~fNigs~~~~s  255 (358)
                      +.++..++..   ...|+++.+-+|-+..
T Consensus       222 a~~v~fL~S~~ss~iTGq~i~VDGG~t~~  250 (255)
T PRK05717        222 AAMVAWLLSRNAGFVTGQEFVVDGGMTRK  250 (255)
T ss_pred             HHHHHHHHCCHHCCCCCCEEEECCCHHHC
T ss_conf             99999996772148159838979894000


No 143
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=99.44  E-value=6.4e-14  Score=104.41  Aligned_cols=222  Identities=17%  Similarity=0.185  Sum_probs=137.1

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC-----C-CC
Q ss_conf             48997678827799999999868987999947887658567776203797499976388999999998622-----7-87
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEF-----Q-PD   75 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~-----~-~d   75 (358)
                      .+|||||++=||+.+++.|+++ |++|+..++.... ....+... ...+...+++|++|++.++++++..     + +|
T Consensus         8 ~alVTGas~GIG~aia~~la~~-Ga~V~i~~~~~~~-~~~~~~~~-~g~~~~~~~~Dv~~~~~~~~~v~~~~~~~G~~id   84 (254)
T PRK08642          8 IVLVTGGSRGLGAAIARAFARE-GARVVVNYHRSED-AAEALADE-LGDRAIAIQADVTDRNQVDAMFATATEHFGKPIT   84 (254)
T ss_pred             EEEEECHHHHHHHHHHHHHHHC-CCEEEEECCCCHH-HHHHHHHH-HCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             9999781119999999999987-9999996189889-99999998-1994699980699999999999999999499776


Q ss_pred             EEEEECCCCC-----C-----CCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCC
Q ss_conf             1785123433-----2-----22222222222222222202478886512322112478427863055431122222222
Q gi|254780920|r   76 AIVNFAAESH-----V-----DRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLF  145 (358)
Q Consensus        76 ~ViHlAa~~~-----~-----~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~  145 (358)
                      +++|.|+...     .     ...+++-...+++|+.|+.++..++...     ..+.+.-++|++||.....       
T Consensus        85 ilVnnA~~~~~~~~~~~~~~~~~~~e~~~~~~~~nl~~~~~~~~~~~~~-----m~~~~~G~IinisS~~~~~-------  152 (254)
T PRK08642         85 TVVNNALADFSFDGDARPKAEDITWEDFQQQLEGAVKGALNTIQAALPG-----MRERGFGRIINIGTNLFQN-------  152 (254)
T ss_pred             EEEECCEECCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCCEEEECCHHHCC-------
T ss_conf             9986764224568766689345999999999999999999999999997-----7874899668860033158-------


Q ss_pred             CCCCCCCCCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222222222333221000000123332---2222222222223332222222222-222222222222222223322
Q gi|254780920|r  146 SEDMPYNPSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIPL-AITRMIEGSHVFLYGDGQNVR  221 (358)
Q Consensus       146 ~E~~~~~p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~~-~i~~~~~g~~~~i~g~g~~~R  221 (358)
                          +..|...|+.||.+.+.+.+..+.++   |+++-.+-|+.+--+..  ....+. ....+.+..|+         +
T Consensus       153 ----~~~~~~~Y~asKaal~~ltr~lA~ela~~gIrVN~I~PG~i~t~~~--~~~~~~~~~~~~~~~~Pl---------~  217 (254)
T PRK08642        153 ----PVVPYHDYTAAKAALLSLTRTLAADLGPYGITVNMVSGGLLRTTDA--SAATPEEVFDLIAATTPL---------R  217 (254)
T ss_pred             ----CCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCC--CCCCCHHHHHHHHHCCCC---------C
T ss_conf             ----8876037789999999999999999713396998874555467665--556989999999847998---------9


Q ss_pred             CCCCCCCCCCCEEECCC---CCCCCCCCCCCCCCC
Q ss_conf             11332222000000012---222222111357864
Q gi|254780920|r  222 DWLYVEDHVRALYLVLK---KGRIGERYNIGGNNE  253 (358)
Q Consensus       222 dfi~v~D~a~~i~~~~~---~~~~~~~fNigs~~~  253 (358)
                      -+...+|++.++..++.   ....|+++.+.+|-.
T Consensus       218 R~g~pedia~~v~fL~S~~as~iTGq~i~VDGG~~  252 (254)
T PRK08642        218 RVTTPQEFADAVLFFASPWSRAVTGQNLVVDGGLV  252 (254)
T ss_pred             CCCCHHHHHHHHHHHHCCHHCCEECCEEEECCCCC
T ss_conf             99599999999999948153682087489670811


No 144
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=99.44  E-value=1.3e-13  Score=102.53  Aligned_cols=203  Identities=19%  Similarity=0.176  Sum_probs=134.2

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHH-HHH-CCCCEEEEECCCCCHHHHHHHHHH-----CCC
Q ss_conf             4899767882779999999986898799994788765856777-620-379749997638899999999862-----278
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLK-EIS-QSNLFSFLQVDICDRECIRSALKE-----FQP   74 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~-~~~-~~~~v~~i~~Di~d~~~l~~~~~~-----~~~   74 (358)
                      .+|||||++=||..++..|.++ |++|+.+++...  ...... .+. ...+..++.+|++|.+.++++++.     ..+
T Consensus         8 valITGas~GIG~aiA~~la~~-Ga~V~l~~r~~~--~l~~~~~~i~~~g~~~~~~~~Dvtd~~~v~~~v~~~~~~~G~i   84 (238)
T PRK07666          8 NALITGAGRGIGRAVAIALAKE-GVNVGLLARSEE--NLKAVAKEVEAEGVKAVIATADVSDYEEVTTAIETLKNGLGSI   84 (238)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHH--HHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCC
T ss_conf             8999163778999999999987-998999989999--9999999999559927999930799999999999999981998


Q ss_pred             CEEEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCC-CCCCCCCCCCCCC
Q ss_conf             71785123433222----222222222222222202478886512322112478427863055431-1222222222222
Q gi|254780920|r   75 DAIVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEV-YGSLDKGLFSEDM  149 (358)
Q Consensus        75 d~ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~v-Yg~~~~~~~~E~~  149 (358)
                      |+++|.|+......    +.++....+++|+.|+.++..++...     ..+.+.-++|.+||.+- .|.          
T Consensus        85 DiLVNNAGi~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~lp~-----M~~~~~G~IInisS~ag~~~~----------  149 (238)
T PRK07666         85 DILINNAGISKFGKFLELDVAEWEKIIQVNLMGVYYVTRAVLPS-----MIEQQSGDIINISSTAGQKGA----------  149 (238)
T ss_pred             CEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEEECCHHHHCCC----------
T ss_conf             78998474579998233999999999989629999999999999-----997499589998777770679----------


Q ss_pred             CCCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222233322100000012333---2222222222222333222222222222222222222222222332211332
Q gi|254780920|r  150 PYNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYV  226 (358)
Q Consensus       150 ~~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v  226 (358)
                        ...++|+.||.+..-+.+..+.+   +|+++..+-|+.|-=|-          .....    +. .++++   .++-.
T Consensus       150 --~~~~~Y~aSK~av~glt~~la~El~~~gIrVn~v~PG~v~T~m----------~~~~~----~~-~~~~~---~~~~P  209 (238)
T PRK07666        150 --PVTSAYSASKFAVLGLTESLMMEVRKHNIRVTALTPSTVATDM----------AVDLG----LT-DGNPD---KVMQP  209 (238)
T ss_pred             --CCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCC----------CCCCC----CC-CCCCC---CCCCH
T ss_conf             --9980699999999999999999854139699999858898624----------67877----78-78830---25799


Q ss_pred             CCCCCCEEECCCCCCC
Q ss_conf             2220000000122222
Q gi|254780920|r  227 EDHVRALYLVLKKGRI  242 (358)
Q Consensus       227 ~D~a~~i~~~~~~~~~  242 (358)
                      +|+|++++.++..+..
T Consensus       210 edVA~~vv~~l~~~~~  225 (238)
T PRK07666        210 EDLAEFIVAQLKLNPR  225 (238)
T ss_pred             HHHHHHHHHHHCCCCC
T ss_conf             9999999999839986


No 145
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional
Probab=99.44  E-value=1.4e-13  Score=102.29  Aligned_cols=223  Identities=14%  Similarity=0.120  Sum_probs=140.6

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH-----CCCCE
Q ss_conf             4899767882779999999986898799994788765856777620379749997638899999999862-----27871
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKE-----FQPDA   76 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~-----~~~d~   76 (358)
                      .+|||||++=||..++..|++. |.+|+.+++..........+  ....++.++++|++|.+.++++++.     .++|+
T Consensus        10 valVTGas~GIG~aia~~la~~-Ga~Vv~~~~~~~~~~~~~~~--~~g~~~~~~~~Dv~~~~~~~~~~~~~~~~~g~iDi   86 (251)
T PRK12481         10 VAIITGCNTGLGQGMAIGLAKA-GADIVGVGVAEAPETQAQVE--ALGRKFHFITADLIQQKDIDSIVSQAVEVMGHIDI   86 (251)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEECCCCHHHHHHHHH--HCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCCE
T ss_conf             8999486768999999999986-99999978987199999999--75994799991279999999999999998199989


Q ss_pred             EEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             785123433222----2222222222222222024788865123221124784278630554311222222222222222
Q gi|254780920|r   77 IVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYN  152 (358)
Q Consensus        77 ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~  152 (358)
                      ++|.|+......    +.++....+++|+.|+..+.+++....    ......-++|.+||...+...           .
T Consensus        87 lVNNAG~~~~~~~~~~~~~~w~~~~~vNl~~~~~~~q~~~~~m----~~~~~~G~IVnisS~~~~~~~-----------~  151 (251)
T PRK12481         87 LINNAGIIRRQDLLEFGNKDWDDVININQKTVFFLSQAVAKQF----VKQGNGGKIINIASMLSFQGG-----------I  151 (251)
T ss_pred             EEECCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHCCCCEEEEECCHHHCCCC-----------C
T ss_conf             9989989999990349999999999998377999999999999----985699348740213333688-----------9


Q ss_pred             CCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222233322100000012333---2222222222222333222222222222222222222222222332211332222
Q gi|254780920|r  153 PSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDH  229 (358)
Q Consensus       153 p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~  229 (358)
                      ....|+.||.+.+.+.+..+.+   +++++-.+-|+.+-.|.......-+..-....+.-|+         +-+.-.+|+
T Consensus       152 ~~~~Y~asKaav~~ltr~lA~e~a~~gIrVN~IaPG~i~T~~~~~~~~~~~~~~~~~~~~Pl---------~R~g~pedi  222 (251)
T PRK12481        152 RVPSYTASKSAVMGLTRALATELSQYNINVNAIAPGYMATDNTAALRADTARNEAILERIPA---------SRWGTPDDL  222 (251)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCHHHCCCCHHHHHHHHHCCCC---------CCCCCHHHH
T ss_conf             87147999999999999999997030969999952888777521103799999999955999---------998689999


Q ss_pred             CCCEEECCCC---CCCCCCCCCCCC
Q ss_conf             0000000122---222221113578
Q gi|254780920|r  230 VRALYLVLKK---GRIGERYNIGGN  251 (358)
Q Consensus       230 a~~i~~~~~~---~~~~~~fNigs~  251 (358)
                      +.++..++..   ...|+++.+.+|
T Consensus       223 a~~v~fL~S~~a~~iTG~~i~VDGG  247 (251)
T PRK12481        223 AGPAIFLSSSASDYVTGYTLAVDGG  247 (251)
T ss_pred             HHHHHHHHCCHHCCCCCCEEEECCC
T ss_conf             9999999382535904855897846


No 146
>PRK06057 short chain dehydrogenase; Provisional
Probab=99.44  E-value=1.5e-13  Score=102.15  Aligned_cols=219  Identities=17%  Similarity=0.122  Sum_probs=141.1

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH-----CCCCEE
Q ss_conf             899767882779999999986898799994788765856777620379749997638899999999862-----278717
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKE-----FQPDAI   77 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~-----~~~d~V   77 (358)
                      +|||||++=||..+++.|+++ |.+|+..|+.     ....+.....-+..++++|++|.++++++++.     .++|++
T Consensus        10 alVTGas~GIG~aia~~la~~-Ga~Vvi~d~~-----~~~~~~~~~~~~~~~~~~Dv~~~~~v~~~v~~~~~~~G~iDiL   83 (255)
T PRK06057         10 AVITGGASGIGLATARRMRAE-GATVVVGDID-----PEAGKAAADELGGLFVQVDVTDEDAVNALFDTAAETYGSVDIA   83 (255)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECC-----HHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             999684888999999999986-9989999698-----8999999986499799981699999999999999981998789


Q ss_pred             EEECCCCCCCC------CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCC-CCCCCCCCCCCCCCCC
Q ss_conf             85123433222------2222222222222222024788865123221124784278630554-3112222222222222
Q gi|254780920|r   78 VNFAAESHVDR------SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTD-EVYGSLDKGLFSEDMP  150 (358)
Q Consensus        78 iHlAa~~~~~~------~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~-~vYg~~~~~~~~E~~~  150 (358)
                      +|.|+...+..      +.++....+++|+.|+..+..++...     ..+.+.-++|.+||. ...|..          
T Consensus        84 VNnAGi~~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~p~-----m~~~~~G~IVnisS~~~~~g~~----------  148 (255)
T PRK06057         84 FNNAGISPPEDDSILNTGLDAWQRVQDVNLKSVYLCCKAALPH-----MVEAGKGSIINTASFVAVMGSA----------  148 (255)
T ss_pred             EECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEEECCHHHCCCCC----------
T ss_conf             9888557889986200999999999999829999999999999-----9983995899973765635888----------


Q ss_pred             CCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222233322100000012333---222222222222233322222-2222222222222222222222332211332
Q gi|254780920|r  151 YNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPE-KLIPLAITRMIEGSHVFLYGDGQNVRDWLYV  226 (358)
Q Consensus       151 ~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~-~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v  226 (358)
                       .....|+.||.+...+.+..+.+   +|+++-.+-|+.+--|..... .--|....+.+..-|         .+-+...
T Consensus       149 -~~~~~Y~asKaav~~lTr~lA~e~a~~gIrVN~IaPG~i~T~~~~~~~~~~~e~~~~~~~~~P---------lgR~g~p  218 (255)
T PRK06057        149 -TSQISYTASKGGVLAMSRELGVQFARQGIRVNALCPGPVNTPLLQELFAKDPERAARRLVHVP---------LGRFAEP  218 (255)
T ss_pred             -CCCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCHHHHHHHCCCHHHHHHHHHCCC---------CCCCCCH
T ss_conf             -652559999999999999999986031939999973879965777663059999999983699---------8897889


Q ss_pred             CCCCCCEEECCCC---CCCCCCCCCCCCC
Q ss_conf             2220000000122---2222211135786
Q gi|254780920|r  227 EDHVRALYLVLKK---GRIGERYNIGGNN  252 (358)
Q Consensus       227 ~D~a~~i~~~~~~---~~~~~~fNigs~~  252 (358)
                      +|++.++..++..   ...|+++.+.+|-
T Consensus       219 eeiA~~v~fLaSd~ss~iTG~~i~VDGG~  247 (255)
T PRK06057        219 EEIAAAVAFLASDDASFITASTFLVDGGI  247 (255)
T ss_pred             HHHHHHHHHHHCCHHCCCCCCEEEECCCH
T ss_conf             99999999996764248268738869383


No 147
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional
Probab=99.44  E-value=1.7e-13  Score=101.78  Aligned_cols=221  Identities=19%  Similarity=0.181  Sum_probs=141.3

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH----C-CCCEE
Q ss_conf             899767882779999999986898799994788765856777620379749997638899999999862----2-78717
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKE----F-QPDAI   77 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~----~-~~d~V   77 (358)
                      +|||||++=||..+++.|+++ |.+|+++|+...         .....++.++++|++|.+.++++++.    + ++|++
T Consensus        12 alVTGgs~GIG~aia~~la~~-Ga~V~~~d~~~~---------~~~~~~~~~~~~Dvt~~~~v~~~v~~~~~~~G~iDiL   81 (266)
T PRK06171         12 IIVTGGSSGIGLAIVEELLAQ-GANVQMVDIHGG---------DEKHKGYQFWPTDISSAKEVNHTVAEIIERFGRIDGL   81 (266)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHH---------HCCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             999477878999999999987-999999978853---------5058976999816999999999999999983998899


Q ss_pred             EEECCCCCCC-------------CCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCC
Q ss_conf             8512343322-------------222222222222222220247888651232211247842786305543112222222
Q gi|254780920|r   78 VNFAAESHVD-------------RSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGL  144 (358)
Q Consensus        78 iHlAa~~~~~-------------~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~  144 (358)
                      +|.|+...+.             .+.++....+++|+.|+..+..++...     ..+.+.-++|.+||.+-+-      
T Consensus        82 VNNAGi~~~~~~~d~~~~~~~~e~~~~~w~~~~~vNl~g~~~~~~~~~p~-----m~~~~~G~IVnisS~~g~~------  150 (266)
T PRK06171         82 VNNAGINFPRLLVDEKAPAGQYELNEAAFEKMVNINQKGVFLMSQAVARQ-----MVKQHDGVIVNMSSEAGLE------  150 (266)
T ss_pred             EECCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEEECCHHHCC------
T ss_conf             98886676532124457665455999999999999949999999999999-----9983995799805777567------


Q ss_pred             CCCCCCCCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCC------
Q ss_conf             222222222222233322100000012333---2222222222222333222222222222222--22222222------
Q gi|254780920|r  145 FSEDMPYNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRM--IEGSHVFL------  213 (358)
Q Consensus       145 ~~E~~~~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~--~~g~~~~i------  213 (358)
                           +....+.|+.||.+...+.+..+.+   +|+++-.+-|+.+-.+....    +.+-...  ..+.+..-      
T Consensus       151 -----g~~~~~~Y~asKaav~~ltr~lA~ela~~gIrVNaV~PG~i~t~~~~~----~~~~~~~~~~~~~~~~~~~~~~~  221 (266)
T PRK06171        151 -----GSEGQSCYAATKAAVNSFTRSWAKELGKHGIRVVGVAPGILEATGLRT----PEYEEALAYTRNITVEQLRAGYT  221 (266)
T ss_pred             -----CCCCCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCC----HHHHHHHHHHCCCCHHHHHHHHH
T ss_conf             -----898758999999999999999999984549599998317716654567----01577765403665889998887


Q ss_pred             CCCCCCCCCCCCCCCCCCCEEECCCC---CCCCCCCCCCCCCC
Q ss_conf             22223322113322220000000122---22222111357864
Q gi|254780920|r  214 YGDGQNVRDWLYVEDHVRALYLVLKK---GRIGERYNIGGNNE  253 (358)
Q Consensus       214 ~g~g~~~Rdfi~v~D~a~~i~~~~~~---~~~~~~fNigs~~~  253 (358)
                      .......+-+...+|+|.++..++..   ...|.++++.+|.+
T Consensus       222 ~~~~~PlgR~g~peeiA~~v~fLaSd~as~iTG~~i~VDGG~T  264 (266)
T PRK06171        222 KTSTIPLGRSGKLSEVADLVCYLLSERASYITGVTTNIAGGKT  264 (266)
T ss_pred             HHCCCCCCCCCCHHHHHHHHHHHHCCHHCCCCCCEEEECCCCC
T ss_conf             7657998897499999999999958552580586289878826


No 148
>PRK09291 short chain dehydrogenase; Provisional
Probab=99.44  E-value=2.3e-13  Score=101.03  Aligned_cols=168  Identities=16%  Similarity=0.148  Sum_probs=116.4

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHH--HCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEE
Q ss_conf             489976788277999999998689879999478876585677762--037974999763889999999986227871785
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEI--SQSNLFSFLQVDICDRECIRSALKEFQPDAIVN   79 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~--~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~ViH   79 (358)
                      +||||||+.=||+.++..|+++ |++|++.++...  ....+...  .....+..+++|+++.....++. ...+|++++
T Consensus         4 ~vLITGAssGIGraiA~~la~~-G~~Vi~~~r~~~--~l~~l~~~~~~~g~~~~~~~lDv~~~~~~~~~~-~~~iDvLVN   79 (257)
T PRK09291          4 TILITGAGSGFGREVALRLARK-GHRVIAGVQIAP--QVTELRAEAARRGLALRVEKLDLTDAIDRARAA-EWDVDVLLN   79 (257)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHH--HHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHC-CCCCCEEEE
T ss_conf             8999689858999999999987-998999968789--999999999852995599989889999999980-899999998


Q ss_pred             ECCCCCCCCC----CCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             1234332222----222222222222222024788865123221124784278630554311222222222222222222
Q gi|254780920|r   80 FAAESHVDRS----ILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSS  155 (358)
Q Consensus        80 lAa~~~~~~~----~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~s  155 (358)
                      .|+......-    .++-...+++|+.|+..+..+....     ..+.+.-++|++||.+-+-           +.-...
T Consensus        80 NAGi~~~g~i~e~~~~~~~~~~~vNv~g~~~ltq~~lp~-----M~~~~~G~IV~isS~ag~~-----------~~p~~~  143 (257)
T PRK09291         80 NAGIGEAGALVDIPVELVRELFETNVFGPLELTQGVVRK-----MVARGKGKIVFVSSIAGLI-----------TGPFTG  143 (257)
T ss_pred             CCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEEECCHHHCC-----------CCCCCC
T ss_conf             985689977344999999999999979999999997899-----9876996899987877668-----------999984


Q ss_pred             CCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCC
Q ss_conf             2233322100000012333---222222222222233
Q gi|254780920|r  156 PYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYG  189 (358)
Q Consensus       156 ~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyG  189 (358)
                      .|+.||.+.+-+.+..+.+   +|+++..+-|+.+-=
T Consensus       144 ~Y~aSK~Al~~~t~sLa~El~~~GIrVn~I~PG~v~T  180 (257)
T PRK09291        144 AYCASKHALEAIAEAMHAELAPFGIQVATVNPGPYRT  180 (257)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCC
T ss_conf             1999999999999999998430095899998479998


No 149
>PRK08264 short chain dehydrogenase; Validated
Probab=99.43  E-value=2.6e-13  Score=100.62  Aligned_cols=160  Identities=18%  Similarity=0.133  Sum_probs=112.9

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCE-EEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC-CCCEEEEE
Q ss_conf             8997678827799999999868987-999947887658567776203797499976388999999998622-78717851
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQ-VLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEF-QPDAIVNF   80 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~-V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~-~~d~ViHl   80 (358)
                      +|||||+.=||..++++|+++ |.. |++..+ .    ..    ....+++..+++|++|++.++++++.. .+|+++|.
T Consensus         8 alITGassGIG~aiA~~la~~-Ga~~V~~~~r-~----~~----~~~~~~~~~~~~Dv~d~~~v~~~~~~~~~idvlVnN   77 (235)
T PRK08264          8 VLVTGANRGIGRAFVEELLAR-GAAKVYAAAR-D----PE----SVDLPRVVPLQLDVTDPASVAAAAEQASDVTILINN   77 (235)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCCEEEEECC-C----HH----HCCCCCEEEEEECCCCHHHHHHHHHHCCCCCEEEEC
T ss_conf             999267549999999999986-9977999727-8----40----355598799980689999999999973998699988


Q ss_pred             CCCCCCCCC-----CCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             234332222-----222222222222222024788865123221124784278630554311222222222222222222
Q gi|254780920|r   81 AAESHVDRS-----ILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSS  155 (358)
Q Consensus        81 Aa~~~~~~~-----~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~s  155 (358)
                      |+.......     .++-...+++|+.|+.++..++...     ..+.+.-++|++||..-+-           +.....
T Consensus        78 AGi~~~~~~~~~~~~~~~~~~~~vNl~g~~~l~~~~~p~-----m~~~~~G~IvnisS~~g~~-----------~~p~~~  141 (235)
T PRK08264         78 AGISRPGSLLAEGDLDALRAEMETNVFGPLRMARAFAPV-----LAANGGGAIVNVLSVLSWV-----------NFPNLG  141 (235)
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEEEECHHHCC-----------CCCCCH
T ss_conf             855778986455999999999999729999999872699-----9857998599992754448-----------999976


Q ss_pred             CCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCC
Q ss_conf             2233322100000012333---22222222222223
Q gi|254780920|r  156 PYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNY  188 (358)
Q Consensus       156 ~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vy  188 (358)
                      .|+.||.+.+.+.+..+.+   +|+.+..+.|+.|-
T Consensus       142 ~Y~aSKaal~~~~~~La~El~~~gI~V~~i~PG~v~  177 (235)
T PRK08264        142 AYSASKAAAWSLTQALREELAPQGTRVLGVHPGYID  177 (235)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEECCCC
T ss_conf             799999999999999999850329389999728999


No 150
>PRK07023 short chain dehydrogenase; Provisional
Probab=99.43  E-value=2.9e-13  Score=100.37  Aligned_cols=166  Identities=20%  Similarity=0.170  Sum_probs=112.8

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHH---------H
Q ss_conf             9489976788277999999998689879999478876585677762037974999763889999999986---------2
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALK---------E   71 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~---------~   71 (358)
                      ||.|||||+.=||..++++|+++ |++|+++++...   . .+. .....++..+++|++|...++..+.         +
T Consensus         2 ~rAlITGas~GIG~aiA~~la~~-G~~Vi~~~r~~~---~-~l~-~~~~~~~~~~~~Dl~d~~~~~~~~~~~~~~~~~~~   75 (243)
T PRK07023          2 VRAIVTGHSRGLGAALAEQLLQP-GIAVLGVSRSRH---P-SLA-ARAGERLAEVELDLSDPAAAAAWLAGDTLRAFVDG   75 (243)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCCC---H-HHH-HHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHC
T ss_conf             99999287629999999999987-999999979978---9-999-86799757999505778999999999999975413


Q ss_pred             CCCCEEEEECCCCCCC--CCCCC---CCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCC
Q ss_conf             2787178512343322--22222---222222222222024788865123221124784278630554311222222222
Q gi|254780920|r   72 FQPDAIVNFAAESHVD--RSILG---ADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFS  146 (358)
Q Consensus        72 ~~~d~ViHlAa~~~~~--~~~~~---p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~  146 (358)
                      ...+++||.|+...+.  ....+   ....+++|+.|+..+..++...     ..+.+..++|++||.+.+-        
T Consensus        76 ~~~~ilinNAG~~~~~~~~~~~~~~~~~~~~~vNl~~~~~l~~~~~~~-----~~~~~~g~IInisS~a~~~--------  142 (243)
T PRK07023         76 ASRVLLINNAGTVEPIGPLDTQDAAAIARAVGLNVAAPLMLTAALAQA-----ASDAAERRILHISSGAARN--------  142 (243)
T ss_pred             CCEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHHCCCCEEEEECHHHCC--------
T ss_conf             775899977987888875100999999999999759999999999999-----9972798605783311167--------


Q ss_pred             CCCCCCCCCCCCCCCCCCEEEECCCCCC--CCCCCCCCCCCCCC
Q ss_conf             2222222222233322100000012333--22222222222223
Q gi|254780920|r  147 EDMPYNPSSPYSATKASSDYLVLAWGHT--YGIPVLLSNCSNNY  188 (358)
Q Consensus       147 E~~~~~p~s~Yg~sK~~~E~~~~~~~~~--~~l~~~ilR~~~vy  188 (358)
                         +....+.|+.||.+.+.+.+.++.+  +++++..+-|+.|-
T Consensus       143 ---~~~~~~~Y~aSKaal~~~t~sla~E~~~~IrVn~V~PG~v~  183 (243)
T PRK07023        143 ---AYAGWSVYCATKAALDHHARAVALEANRALRIVSLAPGVVD  183 (243)
T ss_pred             ---CCCCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCC
T ss_conf             ---89996689999999999999999867999889999637797


No 151
>PRK12743 acetoin dehydrogenase; Provisional
Probab=99.43  E-value=2.2e-13  Score=101.06  Aligned_cols=224  Identities=15%  Similarity=0.062  Sum_probs=140.4

Q ss_pred             CE--EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH-CCCCEEEEECCCCCHHHHHHHHHH-----C
Q ss_conf             94--899767882779999999986898799994788765856777620-379749997638899999999862-----2
Q gi|254780920|r    1 MR--LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS-QSNLFSFLQVDICDRECIRSALKE-----F   72 (358)
Q Consensus         1 Mk--ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~-~~~~v~~i~~Di~d~~~l~~~~~~-----~   72 (358)
                      |+  +|||||++=||+.++..|+++ |++|...++........-.+.+. ...+..++++|++|.+.++++++.     .
T Consensus         1 M~KValITGgs~GIG~a~a~~la~~-Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~~~~~~~~~~~~~G   79 (253)
T PRK12743          1 MAQVAIVTASDSGIGKACALLLAQQ-GFDIGITWHSDEEGAKETAEEVVSHGVRAEIVHLDLSNLPEGAQAIEKLIQRLG   79 (253)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHC-CCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCC
T ss_conf             9998999075889999999999987-998999748997999999999994599189999048999999999999999819


Q ss_pred             CCCEEEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCC-CCEEEEECCCCCCCCCCCCCCCCC
Q ss_conf             7871785123433222----22222222222222220247888651232211247-842786305543112222222222
Q gi|254780920|r   73 QPDAIVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKK-DQFRFLQISTDEVYGSLDKGLFSE  147 (358)
Q Consensus        73 ~~d~ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~-~~~~~v~~SS~~vYg~~~~~~~~E  147 (358)
                      ++|+++|.|+......    +.++....+++|+.|+..+...+-...     .+. ..-++|++||...+..        
T Consensus        80 ~iDilVNnAG~~~~~~~~~~~~~~w~~~~~vNl~~~f~~~~~~~~~m-----~k~~~~G~IVnisS~~~~~~--------  146 (253)
T PRK12743         80 RLDVLVNNAGAMTKAPFLDMAFDEWRKIFTVDVDGAFLCSQIAARHM-----VKQGQGGRIINITSVHEHTP--------  146 (253)
T ss_pred             CCCEEEECCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHCCCCCEEEEEEEHHHCCC--------
T ss_conf             99899989989999980029999999999998599999999999999-----97589963899963665578--------


Q ss_pred             CCCCCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222222233322100000012333---22222222222223332222222222222222222222222223322113
Q gi|254780920|r  148 DMPYNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWL  224 (358)
Q Consensus       148 ~~~~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi  224 (358)
                         ......|+.+|.+.+.+.+..+.+   +|+++-.+-|+.+--|...  .............-|+         +-+.
T Consensus       147 ---~~~~~~Y~asKaal~~ltk~lA~ela~~gIrVN~VaPG~i~T~~~~--~~~~~~~~~~~~~iPl---------~R~g  212 (253)
T PRK12743        147 ---LPDASAYTAAKHALGGLTKAMALELVEHKILVNAVAPGAIATPMNG--MDDSDVKPDAEPSIPL---------RRPG  212 (253)
T ss_pred             ---CCCCHHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCCC--CCCHHHHHHHHHCCCC---------CCCC
T ss_conf             ---8985899999999999999999997021929999964889877666--7877799999857998---------9984


Q ss_pred             CCCCCCCCEEECCCC---CCCCCCCCCCCCC
Q ss_conf             322220000000122---2222211135786
Q gi|254780920|r  225 YVEDHVRALYLVLKK---GRIGERYNIGGNN  252 (358)
Q Consensus       225 ~v~D~a~~i~~~~~~---~~~~~~fNigs~~  252 (358)
                      ..+|++.++..++..   ...|+.+++.+|-
T Consensus       213 ~pedia~~v~fL~Sd~s~yiTG~~i~VDGG~  243 (253)
T PRK12743        213 HTHEIASLVAWLCSEGASYTTGQSLIVDGGF  243 (253)
T ss_pred             CHHHHHHHHHHHHCCHHCCCCCCEEEECCCE
T ss_conf             9999999999993852258258648978686


No 152
>PRK09072 short chain dehydrogenase; Provisional
Probab=99.43  E-value=2.7e-13  Score=100.59  Aligned_cols=207  Identities=16%  Similarity=0.161  Sum_probs=132.5

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHH---H-CCCCEE
Q ss_conf             489976788277999999998689879999478876585677762037974999763889999999986---2-278717
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALK---E-FQPDAI   77 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~---~-~~~d~V   77 (358)
                      .||||||++=||..++++|.++ |++|+..++...  ....+..-....++.++.+|++|.+.++.+.+   . ..+|++
T Consensus         7 ~vlITGassGIG~a~A~~la~~-G~~vil~~R~~~--~L~~~~~~l~~~~~~~~~~Dls~~~~~~~~~~~~~~~g~iDiL   83 (262)
T PRK09072          7 RVLLTGASGGIGEALAEALCAA-GARLLLVGRNAE--KLEALAARPYPGRVRWVVADLTSEAGREAVLARAREMGGINVL   83 (262)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHH--HHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCEE
T ss_conf             8999486239999999999987-998999989899--9999999845897699997179999999999999984999899


Q ss_pred             EEECCCCCCCCC----CCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             851234332222----2222222222222220247888651232211247842786305543112222222222222222
Q gi|254780920|r   78 VNFAAESHVDRS----ILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNP  153 (358)
Q Consensus        78 iHlAa~~~~~~~----~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p  153 (358)
                      ||.|+.......    .+.....+++|+.|+.++..++.-.     ..+.+.-++|++||.+-+     .+      .-.
T Consensus        84 InNAG~~~~~~~~~~~~~~~~~~~~vN~~g~~~lt~~~lp~-----m~~~~~G~IvnisS~ag~-----~~------~p~  147 (262)
T PRK09072         84 INNAGVNHFALLDQQDPEAIDRLLALNLTAPMQLTRALLPL-----LRAQPSAAVVNVGSTFGS-----IG------YPG  147 (262)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEEECCHHHH-----CC------CCC
T ss_conf             98997788986354999999999999568999999999999-----987699489996686662-----57------899


Q ss_pred             CCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222233322100000012333---22222222222223332222222222222222222222222223322113322220
Q gi|254780920|r  154 SSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV  230 (358)
Q Consensus       154 ~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~a  230 (358)
                      .+.|+.||.+.+-+.+..+.+   +|+.++.+-|+.+--|-          .........-. .+.     .....+++|
T Consensus       148 ~~~Y~ASKaal~~~s~sL~~El~~~gI~V~~v~Pg~v~T~~----------~~~~~~~~~~~-~~~-----~~~~pe~vA  211 (262)
T PRK09072        148 YASYCASKFALRGFSEALRRELADTGVRVLYLAPRATRTAM----------NSAAVTALNAA-LGN-----AMDSPEDVA  211 (262)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCC----------CCHHHHHHHHH-HCC-----CCCCHHHHH
T ss_conf             81799999999999999999846229089999728999888----------85023454554-166-----789999999


Q ss_pred             CCEEECCCCCCCC
Q ss_conf             0000001222222
Q gi|254780920|r  231 RALYLVLKKGRIG  243 (358)
Q Consensus       231 ~~i~~~~~~~~~~  243 (358)
                      ++++.++++++..
T Consensus       212 ~~i~~~i~~~k~~  224 (262)
T PRK09072        212 AAVLQAIEQERAE  224 (262)
T ss_pred             HHHHHHHHCCCCE
T ss_conf             9999999469988


No 153
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional
Probab=99.43  E-value=3.1e-13  Score=100.24  Aligned_cols=219  Identities=18%  Similarity=0.137  Sum_probs=133.2

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH-----CCCCEE
Q ss_conf             899767882779999999986898799994788765856777620379749997638899999999862-----278717
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKE-----FQPDAI   77 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~-----~~~d~V   77 (358)
                      +|||||++-||..+++.|+++ |++|+.+|+...  ....+.. ....++..+.+|++|.+.++++++.     ..+|++
T Consensus         9 alVTGas~GIG~aia~~l~~~-Ga~V~~~~r~~~--~l~~~~~-~~~~~~~~~~~Dv~~~~~~~~~~~~~~~~~G~iDiL   84 (263)
T PRK06200          9 ALITGGGSGIGRALVERFLAE-GARVAVLERSAE--KCASLRQ-RFGDDVLVVEGDVTSYADNQRAVAQTVDRFGKLDCF   84 (263)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHH--HHHHHHH-HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             999586679999999999987-999999979999--9999999-818864687179999999999999999984998889


Q ss_pred             EEECCCCCCCCCCC--C-------CCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCC-CCCCCCCCCCC
Q ss_conf             85123433222222--2-------22222222222202478886512322112478427863055431-12222222222
Q gi|254780920|r   78 VNFAAESHVDRSIL--G-------ADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEV-YGSLDKGLFSE  147 (358)
Q Consensus        78 iHlAa~~~~~~~~~--~-------p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~v-Yg~~~~~~~~E  147 (358)
                      +|.|+.........  +       .+..+++|+.|+.++..++....      ++..-++|+.||..- ++.        
T Consensus        85 VnnAG~~~~~~~~~~~~~~~~~~~~~~~~~vN~~~~~~~~~~~~p~m------~~~~g~iI~~~S~~~~~~~--------  150 (263)
T PRK06200         85 VGNAGIWDYYTSLVDIPAETLDTAFDEIFRVNVKGYLLGAKAALPAL------KASGGSIIFTLSNSSFYPG--------  150 (263)
T ss_pred             EECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------HHCCCEEEEECCHHHCCCC--------
T ss_conf             97575467777603399789999999999998799999999998988------6079779998220212588--------


Q ss_pred             CCCCCCCCCCCCCCCCCEEEECCCCCCCC--CCCCCCCCCCCCCCCCCCCC---------CCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222222223332210000001233322--22222222222333222222---------22222222222222222222
Q gi|254780920|r  148 DMPYNPSSPYSATKASSDYLVLAWGHTYG--IPVLLSNCSNNYGPYHFPEK---------LIPLAITRMIEGSHVFLYGD  216 (358)
Q Consensus       148 ~~~~~p~s~Yg~sK~~~E~~~~~~~~~~~--l~~~ilR~~~vyGp~~~~~~---------~i~~~i~~~~~g~~~~i~g~  216 (358)
                          .....|+.||.+.+.+.+..+.+++  +++-.+.|+.+.-|......         -.+.+.......-|      
T Consensus       151 ----~~~~~Y~asKaal~~ltr~lA~ela~~IrVN~I~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P------  220 (263)
T PRK06200        151 ----GGGPLYTASKHAVVGLVRQLAYELAPKIRVNGVAPGGTVTDLRGPASLGQGETSISDVPGLADMIAAITP------  220 (263)
T ss_pred             ----CCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCHHHHHHCCCHHHHHHHHHCCC------
T ss_conf             ----9856789999999999999999977998899996288988864421121466542046889999971799------


Q ss_pred             CCCCCCCCCCCCCCCCEEECCC-C---CCCCCCCCCCCCC
Q ss_conf             2332211332222000000012-2---2222211135786
Q gi|254780920|r  217 GQNVRDWLYVEDHVRALYLVLK-K---GRIGERYNIGGNN  252 (358)
Q Consensus       217 g~~~Rdfi~v~D~a~~i~~~~~-~---~~~~~~fNigs~~  252 (358)
                         .+-+...+|++.++..++. .   ...|+++.+.+|-
T Consensus       221 ---l~R~g~p~dia~~v~fL~Sd~~s~~iTG~~i~vDGG~  257 (263)
T PRK06200        221 ---LQFAPQPEDHTGPYVLLASRRNSRALTGVVINADGGL  257 (263)
T ss_pred             ---CCCCCCHHHHHHHHHHHCCCCCCCCEECCEEEECCCH
T ss_conf             ---8998399999999999808532368458678889362


No 154
>PRK08265 short chain dehydrogenase; Provisional
Probab=99.43  E-value=4.4e-13  Score=99.29  Aligned_cols=223  Identities=21%  Similarity=0.169  Sum_probs=142.4

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH----C-CCCEE
Q ss_conf             899767882779999999986898799994788765856777620379749997638899999999862----2-78717
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKE----F-QPDAI   77 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~----~-~~d~V   77 (358)
                      +|||||++=||+.+++.|+++ |++|++.|+...  ....+.. .......++++|++|.++++++++.    + ++|++
T Consensus         9 alVTGgs~GIG~aia~~la~~-Ga~V~i~~~~~~--~~~~~~~-~~~~~~~~~~~Dv~~~~~i~~~~~~~~~~fG~iDiL   84 (261)
T PRK08265          9 AIVTGGATLIGAAVARALVAA-GACVAILDIDAD--NGAAVAA-SLGERARFIATDITDDAAIERAVATAVARFGGLDIL   84 (261)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHH--HHHHHHH-HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             999487768999999999987-998999979889--9999999-819972899813899999999999999981998789


Q ss_pred             EEECCCCCCCC---CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             85123433222---222222222222222202478886512322112478427863055431122222222222222222
Q gi|254780920|r   78 VNFAAESHVDR---SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPS  154 (358)
Q Consensus        78 iHlAa~~~~~~---~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~  154 (358)
                      +|.|+......   +.++....+++|+.|+..+..++....      +++.-++|.+||....-           +..+.
T Consensus        85 VNNAg~~~~~~~~~~~e~w~~~~~vNl~~~~~~~q~~~~~m------~~~~G~IInisS~~~~~-----------~~~~~  147 (261)
T PRK08265         85 VNLACTYVDDGLASSRADWLAALDVNLVSAAMLAQAAHPHL------KRGGGAIVNFTSISAKV-----------AQTGR  147 (261)
T ss_pred             EECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH------HHCCCEEEEEEECCCCC-----------CCCCC
T ss_conf             98575578873439999999999998399999999999999------87697799996533045-----------78885


Q ss_pred             CCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222333221000000123332---22222222222233322222222222222222222222222233221133222200
Q gi|254780920|r  155 SPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVR  231 (358)
Q Consensus       155 s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~a~  231 (358)
                      ..|+.||.+.+.+.+..+.++   |+++-.+-|+.+..|....  +...-..+.   ..+  ..+-...+-+...+|+++
T Consensus       148 ~~Y~asKaal~~ltk~lA~e~a~~gIrVN~IaPG~i~T~~~~~--~~~~~~~~~---~~~--~~~~~Pl~R~g~p~dIa~  220 (261)
T PRK08265        148 WLYPASKAAIRQLTRSMAMDLAPDGIRVNSVSPGWTWSRVMDE--LSGGDRAKA---DRV--AAPFHLLGRVGDPEEVAQ  220 (261)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCHHHHH--HCCCCHHHH---HHH--HHCCCCCCCCCCHHHHHH
T ss_conf             0679999999999999999974109299888558778677876--435889999---998--613788899758999999


Q ss_pred             CEEECCCC---CCCCCCCCCCCCCC
Q ss_conf             00000122---22222111357864
Q gi|254780920|r  232 ALYLVLKK---GRIGERYNIGGNNE  253 (358)
Q Consensus       232 ~i~~~~~~---~~~~~~fNigs~~~  253 (358)
                      ++..++..   ...|+++.|.+|-+
T Consensus       221 ~v~fL~Sd~a~~iTGq~i~VDGG~s  245 (261)
T PRK08265        221 VVAFLCSDAASFVTGADYAVDGGYS  245 (261)
T ss_pred             HHHHHHCCHHCCCCCCEEEECCCCC
T ss_conf             9999967742383597087281901


No 155
>PRK06114 short chain dehydrogenase; Provisional
Probab=99.43  E-value=1.8e-13  Score=101.69  Aligned_cols=223  Identities=15%  Similarity=0.094  Sum_probs=141.5

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH-CCCCEEEEECCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             899767882779999999986898799994788765856777620-3797499976388999999998622-----7871
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS-QSNLFSFLQVDICDRECIRSALKEF-----QPDA   76 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~-~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d~   76 (358)
                      +|||||++-||..+++.|+++ |.+|+..|+..........+.+. ......++++|++|.+.++++++..     ++|+
T Consensus        19 alVTGa~~GIG~aiA~~la~~-Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvt~~~~v~~~v~~~~~~~G~iDi   97 (262)
T PRK06114         19 AFVTGAGSGIGQRIAIGLAQA-GADVALFDLRTDDGLAETAEHIEAAGRRAIQIAADVTSKSDLAAAVARTEAELGALTL   97 (262)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCE
T ss_conf             999684789999999999987-9989999589746999999999965995899981689999999999999998199989


Q ss_pred             EEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCC-CCCCCCCCCCCCCCC
Q ss_conf             785123433222----222222222222222202478886512322112478427863055431-122222222222222
Q gi|254780920|r   77 IVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEV-YGSLDKGLFSEDMPY  151 (358)
Q Consensus        77 ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~v-Yg~~~~~~~~E~~~~  151 (358)
                      +++.|+......    +.++....+++|+.|+..+..++...     ..+.+.-++|.+||..- .+.          +.
T Consensus        98 LVNnAGi~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~~~-----m~~~~~G~IVnisS~~g~~~~----------~g  162 (262)
T PRK06114         98 AVNAAGIANANPAEEMEEEQWQTVMDINLTGVFLSCQAEARA-----MLENGGGSIVNIASMSGVIVN----------RG  162 (262)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEEECCCHHCCCC----------CC
T ss_conf             998998999988155999999999999736699999999999-----997289789997862230478----------88


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222233322100000012333---222222222222233322222222222222222222222222233221133222
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVED  228 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D  228 (358)
                      -+...|+.||.+...+.+..+.+   +|+++-.+-|+.+--|..... ......+.....-|+         +-+...+|
T Consensus       163 ~~~~~Y~asKaav~~lTr~lA~e~a~~gIrVNaIaPG~i~T~~~~~~-~~~~~~~~~~~~~Pl---------gR~g~pee  232 (262)
T PRK06114        163 LLQAHYNASKAGVIHMSKSLAMEWVGRGIRVNTISPGYTATPMNTRP-EMVHQTKLFEEQTPM---------QRMADVDE  232 (262)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCC-CCHHHHHHHHHCCCC---------CCCCCHHH
T ss_conf             53188999999999999999999670593999997588988766674-648999999857998---------99868999


Q ss_pred             CCCCEEECCCC---CCCCCCCCCCCC
Q ss_conf             20000000122---222221113578
Q gi|254780920|r  229 HVRALYLVLKK---GRIGERYNIGGN  251 (358)
Q Consensus       229 ~a~~i~~~~~~---~~~~~~fNigs~  251 (358)
                      ++.++..++..   ...|+.+.+.+|
T Consensus       233 iA~~v~FLaSd~as~iTG~~i~VDGG  258 (262)
T PRK06114        233 MVGPAVFLLSDAASFVTGVDLLVDGG  258 (262)
T ss_pred             HHHHHHHHHCCHHCCCCCCEEEECCC
T ss_conf             99999999576324755862897953


No 156
>PRK06701 short chain dehydrogenase; Provisional
Probab=99.43  E-value=3.6e-13  Score=99.77  Aligned_cols=221  Identities=17%  Similarity=0.174  Sum_probs=142.8

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHH-H-HCCCCEEEEECCCCCHHHHHHHHHH----C-CCC
Q ss_conf             8997678827799999999868987999947887658567776-2-0379749997638899999999862----2-787
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKE-I-SQSNLFSFLQVDICDRECIRSALKE----F-QPD   75 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~-~-~~~~~v~~i~~Di~d~~~l~~~~~~----~-~~d   75 (358)
                      +|||||++=||..+++.|+++ |.+|...++..... .+.... + ....++.++++|++|.++++++++.    + ++|
T Consensus        48 alVTGgs~GIG~aiA~~la~~-GA~V~i~~~~~~~~-a~~~~~~~~~~G~~~~~~~~Dv~d~~~v~~~v~~~~~~fG~iD  125 (289)
T PRK06701         48 ALITGGDSGIGRAVAVAFAKE-GADIAIVYLDEHED-ANETKQRVEKEGVKCLLIPGDVSDEQFCKDAVEETVRELGRLD  125 (289)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCCHHH-HHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             999682579999999999987-99899982894678-9999999996399089998478999999999999999859998


Q ss_pred             EEEEECCCCCCCC-----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             1785123433222-----22222222222222220247888651232211247842786305543112222222222222
Q gi|254780920|r   76 AIVNFAAESHVDR-----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMP  150 (358)
Q Consensus        76 ~ViHlAa~~~~~~-----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~  150 (358)
                      +++|.|+......     +.++....+++|+.|+..+..++....      +.+ .++|++||.+.+...          
T Consensus       126 iLVNNAG~~~~~~~~~~~~~~~~~~~~~vNl~g~f~~~~~~~p~m------~~g-g~IInisS~~~~~g~----------  188 (289)
T PRK06701        126 ILVNNAAQQYPQQSLEDITAEQLDKTFRTNIYSYFHMTKAALPHL------KPG-SAIINTGSITGYEGN----------  188 (289)
T ss_pred             EEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH------HCC-CEEEEECCCEECCCC----------
T ss_conf             999888346788872449999999997452178999999999997------349-779995012152578----------


Q ss_pred             CCCCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222333221000000123332---2222222222223332222222222222222222222222223322113322
Q gi|254780920|r  151 YNPSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVE  227 (358)
Q Consensus       151 ~~p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~  227 (358)
                       .....|+.||.+.+.+.+..+.++   |+++-.+-|+.|.-+....+ ..+..+.++...-|+         +-+...+
T Consensus       189 -~~~~~Y~asKaav~~ltk~LA~Ela~~gIrVNaIaPG~v~T~~~~~~-~~~~~~~~~~~~~Pl---------gR~g~pe  257 (289)
T PRK06701        189 -ETLIDYSATKGAIHAFTRSLSQSLVQKGIRVNAVAPGPIWTPLIPSD-FDEEKVSQFGSDTPM---------KRPGQPE  257 (289)
T ss_pred             -CCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCC-CCHHHHHHHHHCCCC---------CCCCCHH
T ss_conf             -84077899999999999999999703391898996578878876565-999999999856998---------9980999


Q ss_pred             CCCCCEEECCCC---CCCCCCCCCCCCCC
Q ss_conf             220000000122---22222111357864
Q gi|254780920|r  228 DHVRALYLVLKK---GRIGERYNIGGNNE  253 (358)
Q Consensus       228 D~a~~i~~~~~~---~~~~~~fNigs~~~  253 (358)
                      |++.++..++..   ...|+++.|.+|-.
T Consensus       258 DIA~~v~fLaSd~ss~iTGq~i~VDGG~~  286 (289)
T PRK06701        258 ELAPAYVYLASPDSSYITGQMLHVNGGVI  286 (289)
T ss_pred             HHHHHHHHHHCCHHCCCCCCEEEECCCEE
T ss_conf             99999999957411485486899688888


No 157
>PRK08936 glucose-1-dehydrogenase; Provisional
Probab=99.42  E-value=3e-13  Score=100.28  Aligned_cols=224  Identities=15%  Similarity=0.095  Sum_probs=140.4

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH-CCCCEEEEECCCCCHHHHHHHHHH-----CCCCE
Q ss_conf             899767882779999999986898799994788765856777620-379749997638899999999862-----27871
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS-QSNLFSFLQVDICDRECIRSALKE-----FQPDA   76 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~-~~~~v~~i~~Di~d~~~l~~~~~~-----~~~d~   76 (358)
                      +|||||++=||+.+++.|+++ |.+|+..++.....-..-.+.+. ...+..++++|++|.+.++++++.     .++|+
T Consensus        10 alVTGa~~GIG~aia~~la~~-Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~v~~~~~~~G~iDi   88 (261)
T PRK08936         10 VVITGGSTGLGRAMAVRFGKE-KAKVVINYRSDESEANDVAEEIKKVGGEAIAVKGDVTVESDVVNLIQSAVKEFGTLDV   88 (261)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             999684778999999999987-9999997289878999999999965993899982799999999999999998299889


Q ss_pred             EEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCC-CCCEEEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             785123433222----2222222222222222024788865123221124-78427863055431122222222222222
Q gi|254780920|r   77 IVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDK-KDQFRFLQISTDEVYGSLDKGLFSEDMPY  151 (358)
Q Consensus        77 ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~-~~~~~~v~~SS~~vYg~~~~~~~~E~~~~  151 (358)
                      .+|-|+......    +.++-...+++|+.|+..+...+-..     ..+ ...-++|.+||..-..           +.
T Consensus        89 LVNNAg~~~~~~~~~~~~e~w~~~~~iNl~~~f~~~k~~~~~-----m~~~~~~G~IInisS~~~~~-----------~~  152 (261)
T PRK08936         89 MINNAGIENAVPSHEMPLEDWNKVINTNLTGAFLGSREAIKY-----FVEHDIKGSIINMSSVHEQI-----------PW  152 (261)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHHCCCEEEEEEEEHHCCC-----------CC
T ss_conf             998997899988133999999999999716499999999999-----99818861478873310057-----------89


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222333221000000123332---22222222222233322222222222222222222222222233221133222
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVED  228 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D  228 (358)
                      .+...|+.||.+.+.+.+..+.++   |+++-.+-|+.+-.|.......-+.........-|+         +-+...+|
T Consensus       153 ~~~~~Y~asKaav~~ltk~lA~ela~~gIrVN~I~PG~i~T~~~~~~~~~~~~~~~~~~~~Pl---------~R~g~p~d  223 (261)
T PRK08936        153 PLFVHYAASKGGVKLMTETLAMEYAPKGIRVNNIGPGAINTPINAEKFADPKQRADVESMIPM---------GYIGKPEE  223 (261)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCHHHHCCCHHHHHHHHHCCCC---------CCCCCHHH
T ss_conf             986007999999999999999997353959999978989870121114899999999857998---------99839999


Q ss_pred             CCCCEEECCCC---CCCCCCCCCCCCC
Q ss_conf             20000000122---2222211135786
Q gi|254780920|r  229 HVRALYLVLKK---GRIGERYNIGGNN  252 (358)
Q Consensus       229 ~a~~i~~~~~~---~~~~~~fNigs~~  252 (358)
                      ++.++..++..   ...|.++.+-+|-
T Consensus       224 Ia~~v~FL~S~~asyiTG~~i~VDGG~  250 (261)
T PRK08936        224 IAAVAAWLASSEASYVTGITLFADGGM  250 (261)
T ss_pred             HHHHHHHHHCCHHCCCCCCEEEECCCC
T ss_conf             999999982743268338738879581


No 158
>PRK12935 acetoacetyl-CoA reductase; Provisional
Probab=99.42  E-value=2.3e-13  Score=101.03  Aligned_cols=221  Identities=18%  Similarity=0.150  Sum_probs=138.1

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH-CCCCEEEEECCCCCHHHHHHHHHH----C-CCCE
Q ss_conf             899767882779999999986898799994788765856777620-379749997638899999999862----2-7871
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS-QSNLFSFLQVDICDRECIRSALKE----F-QPDA   76 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~-~~~~v~~i~~Di~d~~~l~~~~~~----~-~~d~   76 (358)
                      +|||||++=||..+++.|+++ |.+|+.-.+........-.+.+. ...++.++++|++|.+.++++++.    + ++|+
T Consensus         9 alVTG~s~GIG~aiA~~la~~-Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvs~~~~~~~~v~~~~~~~G~iDi   87 (247)
T PRK12935          9 AIVTGGAKGIGKAITVALAQE-GAKVVINYNSSKEAAENLVNELGKEGHDVYAVQADVSKVEDANRLVEEAVNHFGKVDI   87 (247)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCE
T ss_conf             999172768999999999987-9989997699989999999999843995899985799999999999999998399989


Q ss_pred             EEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             785123433222----2222222222222222024788865123221124784278630554311222222222222222
Q gi|254780920|r   77 IVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYN  152 (358)
Q Consensus        77 ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~  152 (358)
                      ++|.|+......    +.++....+++|+.|+..+..++...     ..+.+.-++|.+||..-..           +..
T Consensus        88 LVNNAGi~~~~~~~~~~~e~w~~~~~vNl~~~~~~~~~~~p~-----m~~~~~G~IVnisS~~g~~-----------g~~  151 (247)
T PRK12935         88 LVNNAGITRDRTFKKLNREDWERVIDVNLSSVFNTTSAVLPY-----ITEAEEGRIISISSIIGQA-----------GGF  151 (247)
T ss_pred             EEECCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEEECCHHHCC-----------CCC
T ss_conf             998998899999044999999999999769999999997687-----4227995289955546456-----------899


Q ss_pred             CCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222233322100000012333---2222222222222333222222222222222222222222222332211332222
Q gi|254780920|r  153 PSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDH  229 (358)
Q Consensus       153 p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~  229 (358)
                      ....|+.||.+...+.+..+.+   +|+++-.+-|+.+--|...  ........+....-|+         +-|...+|+
T Consensus       152 ~~~~Y~asKaal~~ltk~lA~Ela~~gIrVNaVaPG~i~T~~~~--~~~~~~~~~~~~~iPl---------~R~g~pedi  220 (247)
T PRK12935        152 GQTNYSAAKAGMLGFTKSLALELAKTNVTVNAICPGFIDTEMVA--EVPEEVRQKIVAKIPK---------KRFGQADEI  220 (247)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCHHHH--HCCHHHHHHHHHCCCC---------CCCCCHHHH
T ss_conf             85899999999999999999997140969999962778873223--0689999999856999---------898599999


Q ss_pred             CCCEEECCCCC--CCCCCCCCCCC
Q ss_conf             00000001222--22221113578
Q gi|254780920|r  230 VRALYLVLKKG--RIGERYNIGGN  251 (358)
Q Consensus       230 a~~i~~~~~~~--~~~~~fNigs~  251 (358)
                      +.++..+....  ..|+++.+.+|
T Consensus       221 A~~v~fLasd~ayiTG~~i~VDGG  244 (247)
T PRK12935        221 AKGVVYLCRDGAYITGQQLNINGG  244 (247)
T ss_pred             HHHHHHHHCCCCCCCCCEEEECCC
T ss_conf             999999957976554785885889


No 159
>PRK06346 consensus
Probab=99.42  E-value=3.8e-13  Score=99.66  Aligned_cols=223  Identities=15%  Similarity=0.099  Sum_probs=140.1

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHC-CCCEEEEECCCCCHHHHHHHHHH----C-CCCE
Q ss_conf             8997678827799999999868987999947887658567776203-79749997638899999999862----2-7871
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQ-SNLFSFLQVDICDRECIRSALKE----F-QPDA   76 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~-~~~v~~i~~Di~d~~~l~~~~~~----~-~~d~   76 (358)
                      +|||||++=||..+++.|+++ |.+|+..|+.... -.+-...+.. ..++.++++|+++.+.++++++.    + ++|+
T Consensus         8 ~lITGgs~GIG~a~a~~la~~-Ga~V~i~~r~~e~-~~~~~~~l~~~~~~~~~~~~Dv~~~~~v~~~i~~~~~~fg~iDi   85 (251)
T PRK06346          8 AIVTGAASGMGKSIAELFAKE-GAKVVVADLNLER-AQKVVEEITSNGGTAIAVVANVTKQEDIENMVDTAVDTYGTLDI   85 (251)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHH-HHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCCE
T ss_conf             999475788999999999987-9989999798999-99999999963990899977889899999999999998299979


Q ss_pred             EEEECCCCCCCC-----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             785123433222-----222222222222222202478886512322112478427863055431122222222222222
Q gi|254780920|r   77 IVNFAAESHVDR-----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPY  151 (358)
Q Consensus        77 ViHlAa~~~~~~-----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~  151 (358)
                      ++|.|+......     +.++....+++|+.|+.++..++....     .+.+.-++|.+||..-+..           .
T Consensus        86 LVnNAgi~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~p~m-----~~~~~G~IInisS~~~~~~-----------~  149 (251)
T PRK06346         86 LVNNAGIMDNFVPVGELTDELWDKVFAVNTTGVMRATRKALPIF-----EEKGSGVIVNIASVGGLNG-----------S  149 (251)
T ss_pred             EEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHCCCCEEEEEECHHHCCC-----------C
T ss_conf             99899889999871128999999999997099999999999999-----9859954999945654788-----------9


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222233322100000012333---2222222222222333222222-2222222222222222222223322113322
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEK-LIPLAITRMIEGSHVFLYGDGQNVRDWLYVE  227 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~-~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~  227 (358)
                      ....+|+.||.+...+.+..+.+   +++++-.+-|+.+--+...... .-+....+.....++        ..-+...+
T Consensus       150 ~~~~~Y~asK~al~~ltr~lA~e~a~~gIrvN~I~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~--------~~R~g~pe  221 (251)
T PRK06346        150 RAGAAYTASKHAVIGLTKNTGFMYANKGIRCNAIAPGAVNTNIGTTITAPDEFGQERAMAGMGT--------NPRAGQAE  221 (251)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCHHHHCCCCCHHHHHHHHHCCCC--------CCCCCCHH
T ss_conf             8875899999999999999999862419599998768897723331247897799988624888--------89876899


Q ss_pred             CCCCCEEECCCCC---CCCCCCCCCCC
Q ss_conf             2200000001222---22221113578
Q gi|254780920|r  228 DHVRALYLVLKKG---RIGERYNIGGN  251 (358)
Q Consensus       228 D~a~~i~~~~~~~---~~~~~fNigs~  251 (358)
                      |++.++..++...   ..|+++.+.+|
T Consensus       222 diA~~v~fL~Sd~s~~iTG~~i~VDGG  248 (251)
T PRK06346        222 EIAQVALFLASDDASFVNGTVITADGG  248 (251)
T ss_pred             HHHHHHHHHHCCHHCCCCCCEEECCCC
T ss_conf             999999999571535936862880858


No 160
>PRK12829 short chain dehydrogenase; Provisional
Probab=99.42  E-value=2.9e-13  Score=100.38  Aligned_cols=229  Identities=19%  Similarity=0.161  Sum_probs=143.5

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             48997678827799999999868987999947887658567776203797499976388999999998622-----7871
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEF-----QPDA   76 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d~   76 (358)
                      .+|||||++=||..+++.|+++ |.+|+..|+....  ...........++..+++|++|.+.++++++..     ++|+
T Consensus        13 valVTGgs~GIG~aiA~~la~~-Ga~V~i~~r~~~~--~~~~~~~~~~~~~~~~~~Dvt~~~~v~~~v~~~~~~~G~iDi   89 (264)
T PRK12829         13 RVLVTGGASGIGRAIAEAFAEA-GARVHVCDVSEAA--LAATAARLPGAKVTATVADVADPAQVERVFDTAVERFGGLDV   89 (264)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHH--HHHHHHHCCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCCE
T ss_conf             7999473768999999999987-9989999799899--999999747997599996289999999999999997399989


Q ss_pred             EEEECCCCCCCC-----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCC-CEEEEECCCCCCC-CCCCCCCCCCCC
Q ss_conf             785123433222-----222222222222222202478886512322112478-4278630554311-222222222222
Q gi|254780920|r   77 IVNFAAESHVDR-----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKD-QFRFLQISTDEVY-GSLDKGLFSEDM  149 (358)
Q Consensus        77 ViHlAa~~~~~~-----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~-~~~~v~~SS~~vY-g~~~~~~~~E~~  149 (358)
                      +++.|+......     +.++....+++|+.|+..+..++....     .+.+ ...+|.+||..-. |.          
T Consensus        90 LVNNAGi~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~p~m-----~~~~~G~~IinisS~~~~~~~----------  154 (264)
T PRK12829         90 LVNNAGIAGPTGGIDEITPEQWEQTLAVNLNGQFYFARAAVPLL-----RASGHGGVIIALSSVAGRLGY----------  154 (264)
T ss_pred             EEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHCCCCCEEEEEECHHHCCCC----------
T ss_conf             99899899999980239999999999998487899999999999-----873998089998026547799----------


Q ss_pred             CCCCCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CC-CCCCCCCCCCCCC
Q ss_conf             22222222333221000000123332---2222222222223332222222222222222222-22-2222223322113
Q gi|254780920|r  150 PYNPSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGS-HV-FLYGDGQNVRDWL  224 (358)
Q Consensus       150 ~~~p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~-~~-~i~g~g~~~Rdfi  224 (358)
                        ....+|+.||.+...+.+..+.++   |+++-.+-|+.+..|...  ..++.......... .. .-+-.....+-+.
T Consensus       155 --~~~~~Y~asKaal~~ltr~lA~E~a~~gIrVNaV~PG~i~T~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~Pl~R~g  230 (264)
T PRK12829        155 --PGRTPYAASKWAVVGLVKSLAIELGPLGIRVNAILPGIVRGPRMR--RVIEARAQQLGIGLDEMEQEYLEKISLGRMV  230 (264)
T ss_pred             --CCCHHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCHHH--HHHHHHHHHCCCCHHHHHHHHHHCCCCCCCC
T ss_conf             --886789999999999999999998540949998862888880254--4546567653788799999998079999978


Q ss_pred             CCCCCCCCEEECCCC---CCCCCCCCCCCCC
Q ss_conf             322220000000122---2222211135786
Q gi|254780920|r  225 YVEDHVRALYLVLKK---GRIGERYNIGGNN  252 (358)
Q Consensus       225 ~v~D~a~~i~~~~~~---~~~~~~fNigs~~  252 (358)
                      ..+|+|.++..+...   ...|+++.+.+|-
T Consensus       231 ~peeiA~~v~FLaSd~ss~iTG~~i~VDGGl  261 (264)
T PRK12829        231 EPEDIAATALFLASPAARYITGQAISVDGNV  261 (264)
T ss_pred             CHHHHHHHHHHHHCCHHCCCCCCEEEECCCC
T ss_conf             8999999999995816458058777978780


No 161
>PRK07201 short chain dehydrogenase; Provisional
Probab=99.41  E-value=4.6e-13  Score=99.13  Aligned_cols=198  Identities=20%  Similarity=0.173  Sum_probs=128.9

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHH-HHH-CCCCEEEEECCCCCHHHHHHHHHH----C-CCC
Q ss_conf             899767882779999999986898799994788765856777-620-379749997638899999999862----2-787
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLK-EIS-QSNLFSFLQVDICDRECIRSALKE----F-QPD   75 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~-~~~-~~~~v~~i~~Di~d~~~l~~~~~~----~-~~d   75 (358)
                      +|||||+-=||..++.+|.+. |.+|+.++|....  .+... ++. ....+..+++|++|.++++.+++.    + .+|
T Consensus       379 alITGASSGIG~A~A~~LA~~-GA~Vvl~AR~~e~--Le~v~~ei~~~Gg~a~~~~~DVtd~~~v~~lv~~i~~~~G~ID  455 (663)
T PRK07201        379 VIITGASSGIGRATAIKVAEA-GATVFALARDGEK--LDELVAEIRARGGQAHAYTCDLTDSASVEHTVKDILGRHGHVD  455 (663)
T ss_pred             EEECCCCCHHHHHHHHHHHHC-CCEEEEEECCHHH--HHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCC
T ss_conf             999388759999999999987-9989999899999--9999999995599189999627999999999999999679988


Q ss_pred             EEEEECCCCCCCC---C---CCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             1785123433222---2---222222222222222024788865123221124784278630554311222222222222
Q gi|254780920|r   76 AIVNFAAESHVDR---S---ILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDM  149 (358)
Q Consensus        76 ~ViHlAa~~~~~~---~---~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~  149 (358)
                      +++|.|+.+....   +   .++-...+++|+.|+.++..+..-.     ..+.+.-++|.+||.+.+-..+        
T Consensus       456 VLVNNAG~si~~~~~~~~d~~~d~er~m~vN~~G~v~l~~a~lP~-----M~~r~~G~IVNISSiag~~~~P--------  522 (663)
T PRK07201        456 YLVNNAGRSIRRSVVNSTDRFHDYERTMQLNYFGAVRLVLGLLPH-----MRERRFGHVVNISSIGVQTNAP--------  522 (663)
T ss_pred             EEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCEEEEEECCHHHCCCCC--------
T ss_conf             899896446757501134549999999999749999999999998-----8853993999975565477899--------


Q ss_pred             CCCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222233322100000012333---2222222222222333222222222222222222222222222332211332
Q gi|254780920|r  150 PYNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYV  226 (358)
Q Consensus       150 ~~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v  226 (358)
                         -.+.|+.||.+.+.+.+..+.+   .|+.++.+.|+.|-=|-     +-|.           ..++.    -+-+..
T Consensus       523 ---~~saYsASKaAl~aftr~La~Ela~~GVrVttI~PG~V~TpM-----iapt-----------~~y~~----~p~l~p  579 (663)
T PRK07201        523 ---RFSAYVASKAALDAFARVAASETLSDGITFTNIHMPLVRTPM-----IAPT-----------KRYNP----VPTLSP  579 (663)
T ss_pred             ---CCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCC-----CCCC-----------CCCCC----CCCCCH
T ss_conf             ---864999999999999999999837578289997159717887-----7875-----------22278----998999


Q ss_pred             CCCCCCEEECCCC
Q ss_conf             2220000000122
Q gi|254780920|r  227 EDHVRALYLVLKK  239 (358)
Q Consensus       227 ~D~a~~i~~~~~~  239 (358)
                      +|+|+.+..++.+
T Consensus       580 e~aA~~i~~a~~~  592 (663)
T PRK07201        580 EEAADMVARALVE  592 (663)
T ss_pred             HHHHHHHHHHHHC
T ss_conf             9999999999851


No 162
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=99.41  E-value=4.2e-13  Score=99.39  Aligned_cols=214  Identities=15%  Similarity=0.166  Sum_probs=137.6

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHH-HHHHCCCCEEEEECCCCCHHHHHHHHHH-----CCCC
Q ss_conf             489976788277999999998689879999478876585677-7620379749997638899999999862-----2787
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSL-KEISQSNLFSFLQVDICDRECIRSALKE-----FQPD   75 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~-~~~~~~~~v~~i~~Di~d~~~l~~~~~~-----~~~d   75 (358)
                      ++|||||++=||..+++.|+++ |.+|+..++...  ..... +.+....++.++.+|+++.+.++++++.     ..+|
T Consensus         7 ~~lVTGas~GIG~aiA~~la~~-Ga~V~i~~r~~~--~l~~~~~~l~~~g~~~~~~~Dvs~~~~v~~~~~~~~~~~g~iD   83 (238)
T PRK05786          7 NVLIVGVSPGLGYAVAYFALRE-GASVYAFARSEE--KLKEIKKTLAKYGNVIYVVGDVSKLEGAREAAEKAAKVFGALH   83 (238)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHH--HHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             8999289878999999999987-999999969889--9999999874359779997578999999999999999839988


Q ss_pred             EEEEECCCCCCC--CCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCC-CCCCCCCCCCCCCCCCCC
Q ss_conf             178512343322--22222222222222222024788865123221124784278630554-311222222222222222
Q gi|254780920|r   76 AIVNFAAESHVD--RSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTD-EVYGSLDKGLFSEDMPYN  152 (358)
Q Consensus        76 ~ViHlAa~~~~~--~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~-~vYg~~~~~~~~E~~~~~  152 (358)
                      .+++.|+.....  ....+.+..+++|+.++..+..++...      .+.+ ..+|.+||. ..+.            ..
T Consensus        84 ~lv~naG~~~~~~~~~~~~~~~~~~~nl~~~~~~~~~~~~~------m~~g-~~ii~iss~~~~~~------------~~  144 (238)
T PRK05786         84 GLVVTAGGYIEDTVEELAGLEDMLNNHLKAPLYAVNASLPL------LREG-SSIVLVSSIRGIYK------------AW  144 (238)
T ss_pred             EEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH------HHHC-CEEEEEECHHHCCC------------CC
T ss_conf             79980575678852318999999999858999999999997------4216-77999964454167------------89


Q ss_pred             C-CCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2-222233322100000012333---222222222222233322222222222222222222222222233221133222
Q gi|254780920|r  153 P-SSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVED  228 (358)
Q Consensus       153 p-~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D  228 (358)
                      | ...|+.||.+.+.+.+..+.+   +|+++-.+-|+.+-++... +.-       ...-.++   +     +.....+|
T Consensus       145 ~~~~~Y~asKaal~~ltk~lA~ela~~gIrVN~IaPG~i~t~~~~-~~~-------~~~~~~~---~-----~~~~~pee  208 (238)
T PRK05786        145 PRQLSYAAAKAGLAKAVEILAAELLDRGIRVNGVAPSGIDGDFVP-GRD-------WKKLRKL---G-----DPQAPPED  208 (238)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCC-CCC-------HHHHHHH---C-----CCCCCHHH
T ss_conf             861789999999999999999996417959999962889988877-768-------6987763---0-----17999999


Q ss_pred             CCCCEEECCCC---CCCCCCCCCCCCCC
Q ss_conf             20000000122---22222111357864
Q gi|254780920|r  229 HVRALYLVLKK---GRIGERYNIGGNNE  253 (358)
Q Consensus       229 ~a~~i~~~~~~---~~~~~~fNigs~~~  253 (358)
                      +|+++..++..   ...|.++.+.+|..
T Consensus       209 iA~~v~fL~S~~a~~iTG~~i~VDGG~~  236 (238)
T PRK05786        209 FAKVIIWLLTDEAEWVNGVVIPVDGGRR  236 (238)
T ss_pred             HHHHHHHHHCCHHCCCCCCEEEECCCHH
T ss_conf             9999999969721396688088893500


No 163
>PRK06949 short chain dehydrogenase; Provisional
Probab=99.41  E-value=2.7e-13  Score=100.55  Aligned_cols=225  Identities=17%  Similarity=0.137  Sum_probs=138.9

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHH-HHHH-CCCCEEEEECCCCCHHHHHHHHHHC-----CC
Q ss_conf             489976788277999999998689879999478876585677-7620-3797499976388999999998622-----78
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSL-KEIS-QSNLFSFLQVDICDRECIRSALKEF-----QP   74 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~-~~~~-~~~~v~~i~~Di~d~~~l~~~~~~~-----~~   74 (358)
                      .+|||||++=||..+++.|+++ |.+|+..|+....  .... ..+. ......++++|++|++.++++++..     ++
T Consensus        11 valVTGas~GIG~aiA~~la~~-Ga~V~i~~~~~~~--~~~~~~~i~~~g~~~~~~~~Dv~~~~~v~~~v~~~~~~~G~i   87 (258)
T PRK06949         11 VALVTGASSGLGQRFAQVLSQA-GAKVVLASRRVER--LKELRAEIEAEGGAAHVVSLDVTDYQSIKAAVAHAETEAGTI   87 (258)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHH--HHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC
T ss_conf             8999585779999999999987-9999999698899--999999999659928999826899999999999999984999


Q ss_pred             CEEEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCC---CCCCCEEEEECCCCCCCCCCCCCCCCC
Q ss_conf             71785123433222----22222222222222220247888651232211---247842786305543112222222222
Q gi|254780920|r   75 DAIVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQ---DKKDQFRFLQISTDEVYGSLDKGLFSE  147 (358)
Q Consensus        75 d~ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~---~~~~~~~~v~~SS~~vYg~~~~~~~~E  147 (358)
                      |+++|.|+......    +.++....+++|+.|+..+..++.........   .....-++|++||.+....        
T Consensus        88 DiLVnnAG~~~~~~~~~~~~~~~~~~~~vNl~g~~~~~~~~~~~mi~~~~~~~~~~~~G~IVni~S~~~~~~--------  159 (258)
T PRK06949         88 DILVNNSGVSTTQKLVDVTPADFEFVFDTNTRGAFFVAQEVAKRMIARAKGAGNAKPQCRIINIASVAGLRV--------  159 (258)
T ss_pred             CEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCHHHCCC--------
T ss_conf             899989988999892659999999999987099999999999999984579988889839999835554768--------


Q ss_pred             CCCCCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222222233322100000012333---2222222222222333222222222-222222222222222222332211
Q gi|254780920|r  148 DMPYNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIP-LAITRMIEGSHVFLYGDGQNVRDW  223 (358)
Q Consensus       148 ~~~~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~-~~i~~~~~g~~~~i~g~g~~~Rdf  223 (358)
                         .....+|+.||.+...+.+..+.+   +++++-.+-|+.+--|...  .... ...++....-|+         +-+
T Consensus       160 ---~~~~~~Y~asKaav~~ltr~lA~ela~~gIrVN~IaPG~i~T~~~~--~~~~~e~~~~~~~~~P~---------~R~  225 (258)
T PRK06949        160 ---LPQIGLYCMSKAAVVHMTRAMALEWGRHGINVNAICPGYIDTEINH--HHWETEQGQKLVSMLPR---------KRV  225 (258)
T ss_pred             ---CCCCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCH--HCCCHHHHHHHHHCCCC---------CCC
T ss_conf             ---9983899999999999999999996221979999965788870001--00575999999964999---------998


Q ss_pred             CCCCCCCCCEEECCCC---CCCCCCCCCCCC
Q ss_conf             3322220000000122---222221113578
Q gi|254780920|r  224 LYVEDHVRALYLVLKK---GRIGERYNIGGN  251 (358)
Q Consensus       224 i~v~D~a~~i~~~~~~---~~~~~~fNigs~  251 (358)
                      ...+|++.++..+...   .-.|+++.+.+|
T Consensus       226 g~pedia~~v~fL~S~~s~~iTGq~i~VDGG  256 (258)
T PRK06949        226 GKPEDLDGLLLLLAADESQFINGAIISADDG  256 (258)
T ss_pred             CCHHHHHHHHHHHHCCHHCCCCCCEEEECCC
T ss_conf             2999999999998387316736874784799


No 164
>PRK07062 short chain dehydrogenase; Provisional
Probab=99.41  E-value=2.8e-13  Score=100.44  Aligned_cols=226  Identities=13%  Similarity=0.048  Sum_probs=143.5

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH---CCCCEEEEECCCCCHHHHHHHHHH-----CC
Q ss_conf             4899767882779999999986898799994788765856777620---379749997638899999999862-----27
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS---QSNLFSFLQVDICDRECIRSALKE-----FQ   73 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~---~~~~v~~i~~Di~d~~~l~~~~~~-----~~   73 (358)
                      .+|||||++=||..++++|+++ |.+|+..++..... ..-...+.   ...++.++++|++|.+.++++++.     .+
T Consensus        10 ~alITG~s~GIG~a~a~~la~~-Ga~Vvi~~r~~~~l-~~~~~~l~~~~~~~~~~~~~~Dvt~~~~v~~~v~~~~~~~G~   87 (265)
T PRK07062         10 VAVVTGGSSGIGLATVELLLEA-GASVAICGRDEERL-ASAEARLREKFPGARLLAARCDVLDEADVAAFAAAVEARFGG   87 (265)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHHH-HHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHHCC
T ss_conf             8999575779999999999987-99999997988999-999999987369965999975799999999999999998399


Q ss_pred             CCEEEEECCCCCCC----CCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             87178512343322----22222222222222222024788865123221124784278630554311222222222222
Q gi|254780920|r   74 PDAIVNFAAESHVD----RSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDM  149 (358)
Q Consensus        74 ~d~ViHlAa~~~~~----~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~  149 (358)
                      +|+++|.|+.....    .+.++....+++|+.|+.++..++....     .+.+.-++|.+||...+-           
T Consensus        88 iDiLVnNAg~~~~~~~~~~~~e~w~~~~~~nl~~~~~~~~~~~p~m-----~~~~~G~IInisS~~~~~-----------  151 (265)
T PRK07062         88 VDMLVNNAGQGRVSTFADTTDDAWRDELELKYFSVIRPTRAFLPLL-----RASAAPSITCVNSLLALQ-----------  151 (265)
T ss_pred             CCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHCCCCEEEEEECHHHCC-----------
T ss_conf             8889977888898884879999999999872145899999999999-----962996299993442357-----------


Q ss_pred             CCCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCC----------CCCCCCCCCCCCCCCCC
Q ss_conf             2222222233322100000012333---2222222222222333222222222----------22222222222222222
Q gi|254780920|r  150 PYNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIP----------LAITRMIEGSHVFLYGD  216 (358)
Q Consensus       150 ~~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~----------~~i~~~~~g~~~~i~g~  216 (358)
                      +......|+.+|.+...+.+..+.+   +|+++-.+-|+.+..|.-.  +.+.          .+.......+.++    
T Consensus       152 ~~~~~~~Y~asKaal~~ltk~lA~ela~~gIrVN~V~PG~i~T~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~iP----  225 (265)
T PRK07062        152 PEPHMVATSAARAGLLNLVKSLATELAPEGVRVNSILLGLVESGQWR--RRYEARADPGLSWEAWTAALARKKGIP----  225 (265)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCHHH--HHHHHHCCCCCCHHHHHHHHHHHCCCC----
T ss_conf             89996899999999999999999997664939998960858772454--331320254557899999988746999----


Q ss_pred             CCCCCCCCCCCCCCCCEEECCCC---CCCCCCCCCCCCCCC
Q ss_conf             23322113322220000000122---222221113578642
Q gi|254780920|r  217 GQNVRDWLYVEDHVRALYLVLKK---GRIGERYNIGGNNER  254 (358)
Q Consensus       217 g~~~Rdfi~v~D~a~~i~~~~~~---~~~~~~fNigs~~~~  254 (358)
                         .+=+.-.+|++.++..++..   ...|..+.|.+|-..
T Consensus       226 ---l~R~g~peevA~~v~fLaS~~s~~iTG~~i~VDGG~s~  263 (265)
T PRK07062        226 ---LGRFGRPDEAARALFFLASPLSSYTTGSHIDVSGGFAR  263 (265)
T ss_pred             ---CCCCCCHHHHHHHHHHHHCCHHCCCCCCEEEECCCCCC
T ss_conf             ---88976899999999999687325735842798978036


No 165
>PRK06125 short chain dehydrogenase; Provisional
Probab=99.41  E-value=2.5e-13  Score=100.75  Aligned_cols=231  Identities=13%  Similarity=0.017  Sum_probs=142.9

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH--CCCCEEEEECCCCCHHHHHHHHHHC-CCCEEE
Q ss_conf             4899767882779999999986898799994788765856777620--3797499976388999999998622-787178
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS--QSNLFSFLQVDICDRECIRSALKEF-QPDAIV   78 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~--~~~~v~~i~~Di~d~~~l~~~~~~~-~~d~Vi   78 (358)
                      ++|||||++=||..+++.|+++ |.+|+..|+.... -..-...+.  ....+..+.+|+++.+.++++++.+ ++|+++
T Consensus         9 ~alITG~s~GIG~aiA~~la~~-Ga~V~i~~r~~~~-l~~~~~~l~~~~~~~~~~~~~D~~~~~~~~~~~~~~g~iDiLV   86 (259)
T PRK06125          9 RVLITGASKGIGAAAAEAFAAE-GCHLVLAARDADA-LAALAADLRAAHGVDVAVHALDLSSPEAREQLAAEAGDIDILV   86 (259)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHH-HHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHCCCCEEE
T ss_conf             8999687768999999999987-9989999798899-9999999987009866999888999999999999858998999


Q ss_pred             EECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             5123433222----222222222222222202478886512322112478427863055431122222222222222222
Q gi|254780920|r   79 NFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPS  154 (358)
Q Consensus        79 HlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~  154 (358)
                      |.|+......    +.++....+++|+.|+..+..++....     ...+.-++|.+||....     .      +..+.
T Consensus        87 nnAG~~~~~~~~~~~~~~w~~~~~vnl~~~~~l~~~~~p~m-----~~~~~G~Iini~s~~~~-----~------~~~~~  150 (259)
T PRK06125         87 NNAGAIPGGSLDDVDDAAWRAGWELKVFGYINLTRLFYPRM-----KARGSGVIVNVIGAAGE-----N------PDAGY  150 (259)
T ss_pred             ECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHCCCCEEEEEEECCCC-----C------CCCCC
T ss_conf             76877899864549999999999986343788999999976-----53498199999421337-----8------88764


Q ss_pred             CCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22233322100000012333---22222222222223332222222222222222-222222222223322113322220
Q gi|254780920|r  155 SPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMI-EGSHVFLYGDGQNVRDWLYVEDHV  230 (358)
Q Consensus       155 s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~-~g~~~~i~g~g~~~Rdfi~v~D~a  230 (358)
                      ..|+.+|.+.+.+.+..+.+   +|+++-.+-|+.+..|....  .+........ ..+...-........-+...+|++
T Consensus       151 ~~y~asKaal~~ltr~lA~e~~~~gIrVNaV~PG~v~T~~~~~--~~~~~~~~~~~~~~~~~~~~~~~PlgR~g~peeiA  228 (259)
T PRK06125        151 ICGSAGNAALMAFTRALGGKSLDDGIRVVGVNPGPVGTDRMLT--LLKGRARAELGDESRWQELLAGLPLGRPATPREVA  228 (259)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCHHHH--HHHHHHHHHCCCHHHHHHHHHCCCCCCCCCHHHHH
T ss_conf             8999999999999999999856678499998668888705777--87777766238899999998479989978899999


Q ss_pred             CCEEECCCC---CCCCCCCCCCCCC
Q ss_conf             000000122---2222211135786
Q gi|254780920|r  231 RALYLVLKK---GRIGERYNIGGNN  252 (358)
Q Consensus       231 ~~i~~~~~~---~~~~~~fNigs~~  252 (358)
                      .++..+...   ...|+++.+.+|-
T Consensus       229 ~~v~fLaSd~ss~itG~~i~vDGG~  253 (259)
T PRK06125        229 DLVAFLASPRSGYTSGTVVTVDGGI  253 (259)
T ss_pred             HHHHHHHCHHHCCCCCCEEEECCCC
T ss_conf             9999995805368538527868081


No 166
>PRK06198 short chain dehydrogenase; Provisional
Probab=99.41  E-value=1.9e-13  Score=101.49  Aligned_cols=223  Identities=17%  Similarity=0.138  Sum_probs=140.0

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCE-EEEEECCCCCCCHHHHHHHH-CCCCEEEEECCCCCHHHHHHHHHHC-----CC
Q ss_conf             48997678827799999999868987-99994788765856777620-3797499976388999999998622-----78
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQ-VLVIDKLTYAGNLNSLKEIS-QSNLFSFLQVDICDRECIRSALKEF-----QP   74 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~-V~~~d~~~~~~~~~~~~~~~-~~~~v~~i~~Di~d~~~l~~~~~~~-----~~   74 (358)
                      .+|||||++=||+.+++.|+++ |.+ |+..++ +...-....+.+. ...++.++++|+++.++++++++..     ++
T Consensus         8 ~alVTGas~GIG~aiA~~la~~-Ga~vv~~~~~-~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~fG~i   85 (268)
T PRK06198          8 IALVTGGTQGLGAAIARLFAER-GAAGLVICGR-SAEKGEAKAAELEALGAKAVFVQADLAKVEDCRAVVAAADEAFGRL   85 (268)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCCEEEEECC-CHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC
T ss_conf             8999585778999999999987-9938999629-8889999999999549967999826899999999999999983999


Q ss_pred             CEEEEECCCCCCC----CCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCC-CEEEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             7178512343322----2222222222222222202478886512322112478-4278630554311222222222222
Q gi|254780920|r   75 DAIVNFAAESHVD----RSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKD-QFRFLQISTDEVYGSLDKGLFSEDM  149 (358)
Q Consensus        75 d~ViHlAa~~~~~----~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~-~~~~v~~SS~~vYg~~~~~~~~E~~  149 (358)
                      |+++|.|+.....    .+.++....+++|+.|+..+..++-...     .+.+ .-++|.+||...+...         
T Consensus        86 DiLVNnAG~~~~~~~~~~~~e~w~~~~~vNl~~~~~~~~~~~~~m-----~~~~~~G~IVnisS~~~~~~~---------  151 (268)
T PRK06198         86 DALVNAAGLTDRGTILDTSPELFDRMFAVNVRAPFFLMQEAIKLM-----RRRRAEGTIVNIGSMSAHGGQ---------  151 (268)
T ss_pred             CEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHCCCCCEEEEEECHHHCCCC---------
T ss_conf             899989978999982659999999999987269999999999999-----975999279999154545689---------


Q ss_pred             CCCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCC--C---CCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222233322100000012333---22222222222223332222--2---22222222222222222222223322
Q gi|254780920|r  150 PYNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFP--E---KLIPLAITRMIEGSHVFLYGDGQNVR  221 (358)
Q Consensus       150 ~~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~--~---~~i~~~i~~~~~g~~~~i~g~g~~~R  221 (358)
                        .....|+.||.+...+.+..+.+   +++++-.+-|+.+--|....  .   .....+...+...-|+         .
T Consensus       152 --~~~~~Y~asKaal~~ltkslA~e~a~~gIrVNaI~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~Pl---------g  220 (268)
T PRK06198        152 --PFIAAYCASKGALATLTRNVAYALLRNRIRVNGLNIGWMASEGEDRIQREFHGAPDDWLEKAAATQPF---------G  220 (268)
T ss_pred             --CCCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCHHHHHHHHHCCCCHHHHHHHHHCCCC---------C
T ss_conf             --98568999999999999999999705694999887577888426789887324879999999836998---------8


Q ss_pred             CCCCCCCCCCCEEECCCC---CCCCCCCCCCCC
Q ss_conf             113322220000000122---222221113578
Q gi|254780920|r  222 DWLYVEDHVRALYLVLKK---GRIGERYNIGGN  251 (358)
Q Consensus       222 dfi~v~D~a~~i~~~~~~---~~~~~~fNigs~  251 (358)
                      -+...+|+++++..++..   ...|.++.+-+|
T Consensus       221 R~g~peeiA~~v~FL~S~~s~~iTG~~i~VDGG  253 (268)
T PRK06198        221 RLVDPDEVARAVAFLLSDESGLMTGSVIDFDQS  253 (268)
T ss_pred             CCCCHHHHHHHHHHHHCCHHCCCCCCEEEECCC
T ss_conf             976999999999999674322865837894877


No 167
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=99.40  E-value=2.4e-13  Score=100.93  Aligned_cols=220  Identities=18%  Similarity=0.165  Sum_probs=139.2

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             48997678827799999999868987999947887658567776203797499976388999999998622-----7871
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEF-----QPDA   76 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d~   76 (358)
                      .+|||||++=||..+++.|+++ |.+|+..++...    ...+.+ ...+...+++|++|.+.++++++..     ++|+
T Consensus         9 valVTGas~GIG~aia~~la~~-Ga~V~i~~~~~~----~~~~~~-~~~~~~~~~~Dvt~~~~v~~~v~~~~~~~G~iDi   82 (254)
T PRK06463          9 VALITGGSRGIGRAIAEKFLKE-GAKVAILYNSSE----DKAKEL-KEKGVETFKCDVSNRDQVRKAKEEIHKKLGRIDV   82 (254)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEECCCCH----HHHHHH-HHCCCEEEEEECCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             8999484778999999999988-999999649978----999999-8669889997389999999999999998299989


Q ss_pred             EEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             785123433222----2222222222222222024788865123221124784278630554311222222222222222
Q gi|254780920|r   77 IVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYN  152 (358)
Q Consensus        77 ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~  152 (358)
                      ++|.|+......    +.++....+++|+.|+..+..++....      +...-++|.+||..-.+.          +..
T Consensus        83 LVNNAG~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~p~m------~~~~G~IVnisS~~g~~~----------~~~  146 (254)
T PRK06463         83 LVNNAGIWYLMPFEEFDEEKYNRMLDVNLNGTIYTTYEFLPDL------KEENGVIINIASNAGIGT----------AAE  146 (254)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH------HHCCCEEEEEEEHHHCCC----------CCC
T ss_conf             9989977899991559999999999998389999999999988------763986999975754287----------887


Q ss_pred             CCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCC---CC-CCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222233322100000012333---2222222222222333222222222222---22-222222222222233221133
Q gi|254780920|r  153 PSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAI---TR-MIEGSHVFLYGDGQNVRDWLY  225 (358)
Q Consensus       153 p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i---~~-~~~g~~~~i~g~g~~~Rdfi~  225 (358)
                      ....|+.||.+...+.+..+.+   +|+++-.+-|+.+--|..... ..+.-.   ++ ....-|+.         -+..
T Consensus       147 ~~~~Y~asKaav~~ltr~lA~ela~~gIrVNaVaPG~i~T~~~~~~-~~~~~~~~~~~~~~~~~pl~---------R~g~  216 (254)
T PRK06463        147 GTTFYAITKAGIIMLTKRLAFELGKYGIRVNAVAPGWIETDMTIGG-KSPEEIEKLEEDFRSRTVLH---------TTGK  216 (254)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCC-CCHHHHHHHHHHHHHCCCCC---------CCCC
T ss_conf             6178899999999999999999702395999998688987653356-88578999999998279978---------9819


Q ss_pred             CCCCCCCEEECCCC---CCCCCCCCCCCCCC
Q ss_conf             22220000000122---22222111357864
Q gi|254780920|r  226 VEDHVRALYLVLKK---GRIGERYNIGGNNE  253 (358)
Q Consensus       226 v~D~a~~i~~~~~~---~~~~~~fNigs~~~  253 (358)
                      .+|++.++..+...   ...|+++.+.+|.-
T Consensus       217 pediA~~v~fLaSd~a~~iTG~~i~VDGG~v  247 (254)
T PRK06463        217 PEDIANIVLFLASDDARYITGQVIVADGGRI  247 (254)
T ss_pred             HHHHHHHHHHHHCCHHCCCCCCEEEECCCEE
T ss_conf             9999999999958442491586599639995


No 168
>PRK06128 oxidoreductase; Provisional
Probab=99.40  E-value=5.8e-13  Score=98.53  Aligned_cols=224  Identities=15%  Similarity=0.104  Sum_probs=141.2

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHH-HHHH-CCCCEEEEECCCCCHHHHHHHHHH-----CCC
Q ss_conf             489976788277999999998689879999478876585677-7620-379749997638899999999862-----278
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSL-KEIS-QSNLFSFLQVDICDRECIRSALKE-----FQP   74 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~-~~~~-~~~~v~~i~~Di~d~~~l~~~~~~-----~~~   74 (358)
                      .+|||||+.=||..++..|.++ |.+|+..++.......... +.+. .......+.+|++|.+.++++++.     .++
T Consensus        57 vAlVTGgssGIG~AiA~~lA~e-GA~Vvi~~~~~~~~~a~~~~~~i~~~G~~a~~v~~Dvsd~~~~~~~v~~~~~~~G~i  135 (300)
T PRK06128         57 KALITGADSGIGRATAIAFARE-GADIVLNYLPEEEQDAAEVVQLIQAEGRKAVAVPGDLKDEAFCRQLVERAVKELGGL  135 (300)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCC
T ss_conf             5899173669999999999986-999999429955678999999999659818999747899999999999999980999


Q ss_pred             CEEEEECCCCCCCC-----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             71785123433222-----2222222222222222024788865123221124784278630554311222222222222
Q gi|254780920|r   75 DAIVNFAAESHVDR-----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDM  149 (358)
Q Consensus        75 d~ViHlAa~~~~~~-----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~  149 (358)
                      |++++.|+......     +.++....+++|+.|+..+..++..+.      +.+ -++|.+||...+...         
T Consensus       136 DiLVNNAG~~~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~aa~p~m------~~g-GsIInisSi~~~~~~---------  199 (300)
T PRK06128        136 DILVNIAGKQTARKDIADITTEQFDATFKTNVYAMFWLCKAAIPHL------PPG-ASIINTGSIQSYQPS---------  199 (300)
T ss_pred             CEEEECCCCCCCCCCHHHCCHHHHHHHHHHCCHHHHHHHHHHHHHH------HCC-CCEEEEEEEEEECCC---------
T ss_conf             9899899997789991779999999998661158999999999987------538-714787421240578---------


Q ss_pred             CCCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222233322100000012333---2222222222222333222222222222222222222222222332211332
Q gi|254780920|r  150 PYNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYV  226 (358)
Q Consensus       150 ~~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v  226 (358)
                        .....|+.||.+...+.+..+.+   +|+++-.+-|+.|.-|........+..+......-|+.         -+...
T Consensus       200 --~~~~~Y~asKaav~~lTrslA~ela~~gIRVNaVaPG~i~T~l~~~~~~~~e~~~~~~~~~Plg---------R~g~P  268 (300)
T PRK06128        200 --PTLLDYASTKAAIVNFTKGLAQQVAEKGIRVNAVAPGPVWTPLQPSGGQPPEKIPDFGSETPMK---------RAGQP  268 (300)
T ss_pred             --CCCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCCCHHHHHHHHHCCCCC---------CCCCH
T ss_conf             --8617789999999999999999974169799999618898712001699999999998369989---------98399


Q ss_pred             CCCCCCEEECCCC---CCCCCCCCCCCCCC
Q ss_conf             2220000000122---22222111357864
Q gi|254780920|r  227 EDHVRALYLVLKK---GRIGERYNIGGNNE  253 (358)
Q Consensus       227 ~D~a~~i~~~~~~---~~~~~~fNigs~~~  253 (358)
                      +|+|.++..+...   ...|+++.+.+|-.
T Consensus       269 eEIA~~v~FLaSd~asyiTGq~i~VDGG~~  298 (300)
T PRK06128        269 VEMAPLYVLLASQESSYVTGEVFGATGGLL  298 (300)
T ss_pred             HHHHHHHHHHHCCHHCCCCCCEEEECCCHH
T ss_conf             999999999958242585585489686830


No 169
>PRK05866 short chain dehydrogenase; Provisional
Probab=99.40  E-value=6e-13  Score=98.47  Aligned_cols=199  Identities=15%  Similarity=0.151  Sum_probs=125.9

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHH-HHH-CCCCEEEEECCCCCHHHHHHHHHHC-----CC
Q ss_conf             4899767882779999999986898799994788765856777-620-3797499976388999999998622-----78
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLK-EIS-QSNLFSFLQVDICDRECIRSALKEF-----QP   74 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~-~~~-~~~~v~~i~~Di~d~~~l~~~~~~~-----~~   74 (358)
                      .||||||+.=||..+++.|.++ |.+|+..++....  ..... ++. ....+..+.+|++|.+.++++++..     .+
T Consensus        42 vaLITGassGIG~aiA~~la~~-Ga~Vvl~~R~~~~--l~~~~~~i~~~g~~~~~~~~Dvtd~~~v~~~v~~~~~~~G~i  118 (290)
T PRK05866         42 RILLTGASSGIGEAAAEKFARR-GATVVAVARRKDL--LDAVADRITAAGGDAMAIPCDLSDLDAVDALVADVEERIGGV  118 (290)
T ss_pred             EEEECCCCCHHHHHHHHHHHHC-CCEEEEEECCHHH--HHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCC
T ss_conf             8999081309999999999986-9989999899999--999999999649908999778898999999999999985998


Q ss_pred             CEEEEECCCCCCCCCC------CCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCC
Q ss_conf             7178512343322222------2222222222222202478886512322112478427863055431122222222222
Q gi|254780920|r   75 DAIVNFAAESHVDRSI------LGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSED  148 (358)
Q Consensus        75 d~ViHlAa~~~~~~~~------~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~  148 (358)
                      |+++|.|+........      .+-...+++|+.|+..+..++.-.     ..+.+.-++|.+||...+..         
T Consensus       119 DiLVNNAG~~~~~~~~~~~~~~~d~~~~~~vN~~g~~~l~~~~lp~-----M~~~~~G~IVnisS~~~~~~---------  184 (290)
T PRK05866        119 DILINNAGRSIRRPLAESLDRWHDVERTMVLNYYAPLRLIRGLAPG-----MIERGDGHIINVATWGVLSE---------  184 (290)
T ss_pred             CEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEEEECHHHCCC---------
T ss_conf             8899757666787422215779999999999839999999875099-----99669964999927243278---------


Q ss_pred             CCCCCC-CCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222-22233322100000012333---22222222222223332222222222222222222222222223322113
Q gi|254780920|r  149 MPYNPS-SPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWL  224 (358)
Q Consensus       149 ~~~~p~-s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi  224 (358)
                        ..|. +.|+.||.+...+.+..+.+   +|+++..+-|+.|-=|--          ....      .+ +   ....+
T Consensus       185 --~~p~~~~Y~ASKaAl~~lt~sLa~El~~~gIrVn~V~PG~V~Tpm~----------a~~~------~~-~---~~~~~  242 (290)
T PRK05866        185 --ASPLFSVYNASKAALSAVSRVIETEWGDRGVHSTTLYYPLVATPMI----------APTK------AY-D---GLPAL  242 (290)
T ss_pred             --CCCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCC----------CCCC------CC-C---CCCCC
T ss_conf             --8988641899999999999999998526196999997688987567----------9887------76-7---88889


Q ss_pred             CCCCCCCCEEECCCC
Q ss_conf             322220000000122
Q gi|254780920|r  225 YVEDHVRALYLVLKK  239 (358)
Q Consensus       225 ~v~D~a~~i~~~~~~  239 (358)
                      ..+++|+.+..++++
T Consensus       243 ~pe~~A~~iv~a~~~  257 (290)
T PRK05866        243 TADEAAEWMVTAART  257 (290)
T ss_pred             CHHHHHHHHHHHHHC
T ss_conf             999999999999844


No 170
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase; InterPro: IPR011284   This entry represents 3-oxoacyl-[ACP] reductase, also called 3-ketoacyl-acyl carrier protein reductase, an enzyme of fatty acid biosynthesis found in many plant and bacterial species. This enzyme is involved in type II fatty acid biosynthesis, where the individual metabolic transformations are carried out by different enzymes rather than by a single enzyme as occurs in type I fatty acid biosynthesis .   Structural studies show that the enzyme is a tetramer which forms a typical Rossman fold , . Unlike other members of the short-chain dehydrogenase/reductase superfamily, the enzyme undergoes a marked conformational change upon binding of the NADP(H)cofactor. This conformational change aligns the side chains of the catalytic triad at the active site in an active conformation and increases the affinity of the enzyme for its substrate.; GO: 0004316 3-oxoacyl-[acyl-carrier-protein] reductase activity, 0051287 NAD binding, 0006633 fatty acid biosynthetic process.
Probab=99.40  E-value=3.6e-13  Score=99.79  Aligned_cols=218  Identities=19%  Similarity=0.200  Sum_probs=150.7

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCC-CCEEEEECCCCCHHHHHHHHHH-----CCCCE
Q ss_conf             89976788277999999998689879999478876585677762037-9749997638899999999862-----27871
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQS-NLFSFLQVDICDRECIRSALKE-----FQPDA   76 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~-~~v~~i~~Di~d~~~l~~~~~~-----~~~d~   76 (358)
                      +|||||+.=||+.+++.|.++ |.+|++-++.....-..-.+.+... -.+..+.+|++|.+++++++++     . +|+
T Consensus         1 AlVTGasRGIG~AIA~~LA~~-Ga~V~i~y~~~e~~~~~~~~e~~~~G~~a~~~~~dvs~~~~~~~~~~~~~~~~G-iDi   78 (238)
T TIGR01830         1 ALVTGASRGIGRAIALKLAKE-GAKVIITYRTSEEGAEEVVEEIKELGVKAAGVVLDVSDREDVKALVEEAEEELG-IDI   78 (238)
T ss_pred             CEECCCCCHHHHHHHHHHHHC-CCEEEEECCCCHHHHHHHHHHHHHCCCEEEEEEECCCCHHHHHHHHHHHHHHHC-CEE
T ss_conf             967167861679999999867-995999659825788899999985697599996038888999999999999829-908


Q ss_pred             EEEECCCC----CCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCC-CCCCCCCCCCCCCCCCC
Q ss_conf             78512343----32222222222222222222024788865123221124784278630554-31122222222222222
Q gi|254780920|r   77 IVNFAAES----HVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTD-EVYGSLDKGLFSEDMPY  151 (358)
Q Consensus        77 ViHlAa~~----~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~-~vYg~~~~~~~~E~~~~  151 (358)
                      +++=|+.+    ..+...+|.+..+++|+.|++|+-.++-+     ...+...=|+|.+||. -++|.+..         
T Consensus        79 LVNNAGITrD~Ll~RMk~edWd~Vi~~NL~g~F~~t~~v~~-----~M~K~R~GrIINisSVVG~~GN~GQ---------  144 (238)
T TIGR01830        79 LVNNAGITRDNLLMRMKEEDWDAVINVNLKGVFNLTQAVLR-----PMIKQRSGRIINISSVVGLMGNAGQ---------  144 (238)
T ss_pred             EEECCCCCCCCHHCCCCHHHHHHHHHHHHHHHHHHHHHHHH-----HHHHHCCCCEEEEEEHHHHHCCCCH---------
T ss_conf             99787413430100488556899998612668788899889-----8875067434861002000068742---------


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222333221000000123332---222222222222333222222222222222-2222222222223322113322
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIPLAITRM-IEGSHVFLYGDGQNVRDWLYVE  227 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~-~~g~~~~i~g~g~~~Rdfi~v~  227 (358)
                         .=|++||.--.=+.++++++.   |+.+=++=|+.+--+   .+..+|.=+++. +..=|+.-+|         -.+
T Consensus       145 ---aNYaASKAG~IGftKSlAkElasRnItVNaVAPGFI~Td---MT~~L~e~~~~~~l~~IPLgR~G---------~pE  209 (238)
T TIGR01830       145 ---ANYAASKAGVIGFTKSLAKELASRNITVNAVAPGFIETD---MTDKLSEKVKKAMLSQIPLGRFG---------TPE  209 (238)
T ss_pred             ---HHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCC---CCHHCCHHHHHHHHHCCCCCCCC---------CHH
T ss_conf             ---678888755899999999860368705888748998970---00216988999998527723267---------765


Q ss_pred             CCCCCEEECCC-C--CCCCCCCCCCCC
Q ss_conf             22000000012-2--222221113578
Q gi|254780920|r  228 DHVRALYLVLK-K--GRIGERYNIGGN  251 (358)
Q Consensus       228 D~a~~i~~~~~-~--~~~~~~fNigs~  251 (358)
                      |+|.++.++.. .  .-.|++++|.+|
T Consensus       210 eVA~~v~FLASd~AsYITGqv~~VdGG  236 (238)
T TIGR01830       210 EVANAVAFLASDEASYITGQVIHVDGG  236 (238)
T ss_pred             HHHHHHHHHCCCCCCCCCCCEEECCCC
T ss_conf             699999973251247425516630687


No 171
>PRK08643 acetoin reductase; Validated
Probab=99.40  E-value=6.9e-13  Score=98.09  Aligned_cols=228  Identities=17%  Similarity=0.157  Sum_probs=140.6

Q ss_pred             CE--EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHH----C-
Q ss_conf             94--89976788277999999998689879999478876585677762-0379749997638899999999862----2-
Q gi|254780920|r    1 MR--LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEI-SQSNLFSFLQVDICDRECIRSALKE----F-   72 (358)
Q Consensus         1 Mk--ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~-~~~~~v~~i~~Di~d~~~l~~~~~~----~-   72 (358)
                      |+  +|||||++=||+.+++.|+++ |++|+..|+.... -..-..++ ....+...+++|++|+++++++++.    + 
T Consensus         1 mnKvalVTGg~~GIG~aia~~la~~-Ga~V~i~d~~~~~-~~~~~~~~~~~~~~~~~~~~Dvt~~~~v~~~~~~~~~~~G   78 (256)
T PRK08643          1 MSKVALVTGAGQGIGFAIAKRLVED-GFKVAIVDYNEET-AKAAADKLSSDGGKAIAVKADVSNRDQVFDAVQQVVDTFG   78 (256)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHH-HHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHC
T ss_conf             9849999575788999999999987-9999999698899-9999999985399099998058999999999999999829


Q ss_pred             CCCEEEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCC-CCEEEEECCCCCCCCCCCCCCCCC
Q ss_conf             7871785123433222----22222222222222220247888651232211247-842786305543112222222222
Q gi|254780920|r   73 QPDAIVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKK-DQFRFLQISTDEVYGSLDKGLFSE  147 (358)
Q Consensus        73 ~~d~ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~-~~~~~v~~SS~~vYg~~~~~~~~E  147 (358)
                      ++|++++.|+......    +.++....+++|+.|+..+..++....     .+. ..-++|.+||.+.+-..       
T Consensus        79 ~iDiLVNnAG~~~~~~~~~~~~~~w~~~~~vNl~g~~~~~~~~~~~m-----~~~~~~G~IVnisS~~~~~~~-------  146 (256)
T PRK08643         79 DLNVVVNNAGLAPTTPIDTITEEQFKKVYGINVGGVIWGIQAAQEQF-----KKLGHGGKIINATSQAGVEGN-------  146 (256)
T ss_pred             CCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHCHHHHHHHHHHHHHH-----HHHCCCCEEEEEECCHHCCCC-------
T ss_conf             98799989988999882559999999999997636899999999999-----982899279998321013589-------


Q ss_pred             CCCCCCCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCC----CCCCCCC
Q ss_conf             2222222222333221000000123332---22222222222233322222222222222222--2222----2222223
Q gi|254780920|r  148 DMPYNPSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIPLAITRMIE--GSHV----FLYGDGQ  218 (358)
Q Consensus       148 ~~~~~p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~--g~~~----~i~g~g~  218 (358)
                          ....+|+.||.+...+.+..+.++   |+++-.+-|+.+-.|...      .+.++..+  +.+.    ..+..-.
T Consensus       147 ----~~~~~Y~asKaav~~ltkslA~ela~~gIrVN~V~PG~i~T~~~~------~~~~~~~~~~~~~~~~~~~~~~~~i  216 (256)
T PRK08643        147 ----PGLSVYGSTKFAVRGLTQTAARDLASEGITVNAYAPGIVKTPMMF------DIAHEVGENAGKPDEWGMEQFAKDI  216 (256)
T ss_pred             ----CCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEECCCCCCHHH------HHHHHHHHHCCCCHHHHHHHHHHCC
T ss_conf             ----984899999999999999999998775918999960668870456------6778878762897589999998359


Q ss_pred             CCCCCCCCCCCCCCEEECCCC---CCCCCCCCCCCCC
Q ss_conf             322113322220000000122---2222211135786
Q gi|254780920|r  219 NVRDWLYVEDHVRALYLVLKK---GRIGERYNIGGNN  252 (358)
Q Consensus       219 ~~Rdfi~v~D~a~~i~~~~~~---~~~~~~fNigs~~  252 (358)
                      ..+-+...+|++.++..++..   ...|+++.+.+|-
T Consensus       217 pl~R~g~pedia~~v~fL~S~~s~~iTG~~i~VDGGl  253 (256)
T PRK08643        217 TLKRLSEPEDVANVVSFLAGPDSDYITGQTIIVDGGM  253 (256)
T ss_pred             CCCCCCCHHHHHHHHHHHHCCHHCCCCCCEEEECCCE
T ss_conf             9999868999999999995935369358759966388


No 172
>PRK06500 short chain dehydrogenase; Provisional
Probab=99.40  E-value=6.1e-13  Score=98.42  Aligned_cols=219  Identities=16%  Similarity=0.113  Sum_probs=141.0

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             48997678827799999999868987999947887658567776203797499976388999999998622-----7871
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEF-----QPDA   76 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d~   76 (358)
                      .+|||||++=||..+++.|+++ |.+|+..|+...  ....... ....+..++++|++|.++++++++..     ++|+
T Consensus         8 ~~lITGas~GIG~aiA~~la~~-Ga~V~i~~r~~~--~l~~~~~-~l~~~~~~~~~Dv~~~~~~~~~~~~~~~~~g~iDi   83 (249)
T PRK06500          8 TALITGGTSGIGLETARQFAAE-GARVAITGRDAA--TLEAARA-ELGEDALVIRNDAGSVAAQRALAQALAEAGGRLDA   83 (249)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHH--HHHHHHH-HHCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCCE
T ss_conf             8999376878999999999987-999999969989--9999999-85897599995179999999999999997699989


Q ss_pred             EEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCC-CCCCCCCCCCCCCCC
Q ss_conf             785123433222----222222222222222202478886512322112478427863055431-122222222222222
Q gi|254780920|r   77 IVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEV-YGSLDKGLFSEDMPY  151 (358)
Q Consensus        77 ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~v-Yg~~~~~~~~E~~~~  151 (358)
                      .+|.|+......    +.++....+++|+.|+..+..++....      ..+ ..+|..||... .|.+           
T Consensus        84 LvnnAG~~~~~~~~~~~~e~w~~~~~vNl~~~f~~~~~~~p~m------~~~-g~iI~~sS~~~~~~~~-----------  145 (249)
T PRK06500         84 VFINAGVAKFAPLEDWDEAMFDRSFNTNVKGPYFLIQALLPLL------NNP-ASIVLNGSINAHIGMP-----------  145 (249)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH------HCC-CCEEEEEECEEEECCC-----------
T ss_conf             9989987899991669999999999986456999999999986------229-8189982230761689-----------


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222233322100000012333---222222222222233322222----22222222222222222222223322113
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPE----KLIPLAITRMIEGSHVFLYGDGQNVRDWL  224 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~----~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi  224 (358)
                       ....|+.+|.+.+.+.+..+.+   +|+++-.+-|+.+.-|....-    .-...+..++...-|+.         -|.
T Consensus       146 -~~~aY~asKaal~~ltk~lA~E~a~~gIrVNaIaPG~i~T~~~~~~~~~~~~~~~~~~~~~~~iPl~---------R~g  215 (249)
T PRK06500        146 -NSSVYAASKAALLSLAKTLSGELLPRGIRVNAVSPGPVQTPLYGKLGLSEADLEATAAQIQGLVPLG---------RFG  215 (249)
T ss_pred             -CCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHHCCCCHHHHHHHHHHHHHCCCCC---------CCC
T ss_conf             -7377899999999999999999650495999997788977335531798010599999998379999---------985


Q ss_pred             CCCCCCCCEEECCCC---CCCCCCCCCCCCC
Q ss_conf             322220000000122---2222211135786
Q gi|254780920|r  225 YVEDHVRALYLVLKK---GRIGERYNIGGNN  252 (358)
Q Consensus       225 ~v~D~a~~i~~~~~~---~~~~~~fNigs~~  252 (358)
                      ..+|++.++..++..   ...|.++.+.+|-
T Consensus       216 ~peeia~~v~fL~S~~as~iTG~~i~vDGG~  246 (249)
T PRK06500        216 TPEEIAKAVVFLASDESAFIVGSEIIVDGGM  246 (249)
T ss_pred             CHHHHHHHHHHHHCCHHCCCCCCEEEECCCC
T ss_conf             9999999999995874228148638889581


No 173
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase. Members of this family occur as the BphD protein of biphenyl catabolism and as the TodD protein of toluene catabolism. Members catalyze the second step in each pathway and proved interchangeable when tested; the first and fourth enzymes in each pathway confer metabolic specificity. In the context of biphenyl degradation, the enzyme acts as cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase (EC 1.3.1.56), while in toluene degradation it acts as cis-toluene dihydrodiol dehydrogenase.
Probab=99.39  E-value=1.1e-12  Score=96.90  Aligned_cols=227  Identities=17%  Similarity=0.157  Sum_probs=132.7

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH----C-CCCEE
Q ss_conf             899767882779999999986898799994788765856777620379749997638899999999862----2-78717
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKE----F-QPDAI   77 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~----~-~~d~V   77 (358)
                      +|||||++=||+.+++.|+++ |.+|+..|+...  ....+.. ....++..+++|+++.+.++++++.    + ++|++
T Consensus         8 alITGgs~GIG~aia~~~a~~-Ga~V~i~~r~~~--~l~~~~~-~~g~~~~~~~~Dv~~~~~~~~~v~~~~~~~G~iDiL   83 (262)
T TIGR03325         8 VLVTGGASGLGRAIVDRFVAE-GARVAVLDKSAA--GLQELEA-AHGDAVVGVEGDVRSLDDHKEAVARCVAAFGKIDCL   83 (262)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHH--HHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             999067878999999999987-999999989989--9999998-679967999845799999999999999984998889


Q ss_pred             EEECCCCCCCCCC---------CCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCC
Q ss_conf             8512343322222---------2222222222222202478886512322112478427863055431122222222222
Q gi|254780920|r   78 VNFAAESHVDRSI---------LGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSED  148 (358)
Q Consensus        78 iHlAa~~~~~~~~---------~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~  148 (358)
                      +|.|+........         +.....+++|+.|+.++..++....     .+.+...++.+||...++.+        
T Consensus        84 VnNAG~~~~~~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~p~m-----~~~~g~iI~~~S~~~~~~~~--------  150 (262)
T TIGR03325        84 IPNAGIWDYSTALVDIPDDRIDEAFDEVFHINVKGYLLAVKAALPAL-----VASRGSVIFTISNAGFYPNG--------  150 (262)
T ss_pred             EECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHCCCCEEEEEECCCCCCCC--------
T ss_conf             97265168776434586241499999999997499999999999999-----97098189998710324889--------


Q ss_pred             CCCCCCCCCCCCCCCCEEEECCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCC
Q ss_conf             2222222223332210000001233322--22222222222333222222222222222222222-22222233221133
Q gi|254780920|r  149 MPYNPSSPYSATKASSDYLVLAWGHTYG--IPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHV-FLYGDGQNVRDWLY  225 (358)
Q Consensus       149 ~~~~p~s~Yg~sK~~~E~~~~~~~~~~~--l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~-~i~g~g~~~Rdfi~  225 (358)
                          ....|+.||.+...+.+..+.+++  +++-.+-|+.+.-|......  ...-.......++ .....-....-+..
T Consensus       151 ----~~~~Y~asKaal~~ltr~lA~e~~~~IRVNaV~PG~i~T~~~~~~~--~~~~~~~~~~~~~~~~~~~~~PlgR~g~  224 (262)
T TIGR03325       151 ----GGPLYTAAKHAVVGLVKELAFELAPYVRVNGVAPGGMSSDLRGPKS--LGMADKSISTVPLGDMLKSVLPIGRMPD  224 (262)
T ss_pred             ----CCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCC--CCHHHHHHCCCHHHHHHHCCCCCCCCCC
T ss_conf             ----9668999999999999999999759978999953788879867544--3135554211058999970799899839


Q ss_pred             CCCCCCCEEECCCC-C---CCCCCCCCCCCC
Q ss_conf             22220000000122-2---222211135786
Q gi|254780920|r  226 VEDHVRALYLVLKK-G---RIGERYNIGGNN  252 (358)
Q Consensus       226 v~D~a~~i~~~~~~-~---~~~~~fNigs~~  252 (358)
                      .+|+|.++..++.. .   ..|.++.+.+|-
T Consensus       225 peeia~av~fL~s~~~s~~iTG~~l~VDGG~  255 (262)
T TIGR03325       225 AEEYTGAYVFFATRGDTVPATGAVLNYDGGM  255 (262)
T ss_pred             HHHHHHHHHHHCCCCHHCCEECCEEEECCCC
T ss_conf             9999999999819802269458688979471


No 174
>PRK07832 short chain dehydrogenase; Provisional
Probab=99.39  E-value=9.4e-13  Score=97.26  Aligned_cols=217  Identities=15%  Similarity=0.084  Sum_probs=130.9

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHH-HHHHC--CCCEEEEECCCCCHHHHHHHHHHC-----C
Q ss_conf             489976788277999999998689879999478876585677-76203--797499976388999999998622-----7
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSL-KEISQ--SNLFSFLQVDICDRECIRSALKEF-----Q   73 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~-~~~~~--~~~v~~i~~Di~d~~~l~~~~~~~-----~   73 (358)
                      ++|||||++=||..++++|.++ |++|+..|+....  .... .++..  .....++.+|++|.+.++++++..     .
T Consensus         2 ~alITGassGIG~a~A~~la~~-Ga~v~l~~r~~~~--l~~~~~~l~~~g~~~~~~~~~Dvsd~~~v~~~~~~~~~~~g~   78 (272)
T PRK07832          2 RCFVTGAASGIGRATALRLAAQ-GAELFLTDRDADG--LAQTVADARALGGTVPEHRALDISDYDAVAAFAADIHAAHPS   78 (272)
T ss_pred             EEEEECCCHHHHHHHHHHHHHC-CCEEEEEECCHHH--HHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHCCC
T ss_conf             7999472019999999999988-9989999898899--999999998458971478856689999999999999997299


Q ss_pred             CCEEEEECCCCCCCCC----CCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCC-CCCEEEEECCCCCCCCCCCCCCCCCC
Q ss_conf             8717851234332222----222222222222222024788865123221124-78427863055431122222222222
Q gi|254780920|r   74 PDAIVNFAAESHVDRS----ILGADEFITTNIIGTFILLEETRLWWSCLSQDK-KDQFRFLQISTDEVYGSLDKGLFSED  148 (358)
Q Consensus        74 ~d~ViHlAa~~~~~~~----~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~-~~~~~~v~~SS~~vYg~~~~~~~~E~  148 (358)
                      +|+++|.|+.......    .++-...+++|+.|+.++..++--.     ..+ ...-++|.+||.+-+-          
T Consensus        79 iDiLiNNAGi~~~g~~~~~~~~~~~~~~~vN~~g~~~~~~~~lp~-----m~~~~~~G~IVnisS~ag~~----------  143 (272)
T PRK07832         79 MDVVMNIAGISAWGTVDRLTHEQWRRMVDINLMGPIHVIETFVPP-----MVAAGRGGHLVNVSSAAGLV----------  143 (272)
T ss_pred             CCEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHHCCCCEEEEECCHHHCC----------
T ss_conf             888998787688887345899999999998728999999999999-----99838996899975777556----------


Q ss_pred             CCCCCCCCCCCCCCCCEEEECCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222223332210000001233---3222222222222233322222222222222222222222222233221133
Q gi|254780920|r  149 MPYNPSSPYSATKASSDYLVLAWGH---TYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLY  225 (358)
Q Consensus       149 ~~~~p~s~Yg~sK~~~E~~~~~~~~---~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~  225 (358)
                       +.-..+.|+.||.+..-+.+..+.   .+|+.++++-|+.|=-|-....+.     .......|-.-..........+.
T Consensus       144 -~~p~~~~Y~ASK~av~g~~esL~~El~~~gI~V~~v~PG~v~T~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~s  217 (272)
T PRK07832        144 -GLPWHAAYSASKYGLRGLSEVLRFDLARHGIGVSVVVPGAVKTPLVNTVEI-----AGVDRDDPRVQKWVDRFRGHAVT  217 (272)
T ss_pred             -CCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCCC-----CCCCCCCHHHHHHHHHCCCCCCC
T ss_conf             -899980299999999999999999852109789999748898887888563-----46676644578887640256999


Q ss_pred             CCCCCCCEEECCCCCCC
Q ss_conf             22220000000122222
Q gi|254780920|r  226 VEDHVRALYLVLKKGRI  242 (358)
Q Consensus       226 v~D~a~~i~~~~~~~~~  242 (358)
                      .+++|+.++.++++++.
T Consensus       218 pe~vA~~i~~ai~~~k~  234 (272)
T PRK07832        218 PEKAADKILAGVERNRY  234 (272)
T ss_pred             HHHHHHHHHHHHHCCCC
T ss_conf             99999999999965997


No 175
>PRK07097 gluconate 5-dehydrogenase; Provisional
Probab=99.38  E-value=1.1e-12  Score=96.86  Aligned_cols=225  Identities=16%  Similarity=0.070  Sum_probs=143.2

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHH-----CCCC
Q ss_conf             489976788277999999998689879999478876585677762-0379749997638899999999862-----2787
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEI-SQSNLFSFLQVDICDRECIRSALKE-----FQPD   75 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~-~~~~~v~~i~~Di~d~~~l~~~~~~-----~~~d   75 (358)
                      .+|||||++=||+.+++.|+++ |.+|+..|+..... ..-.+.+ ....++..+++|++|.+.+++++..     .++|
T Consensus        12 ~alVTG~s~GIG~aiA~~la~~-Ga~Vii~~~~~~~~-~~~~~~~~~~g~~~~~~~~Dvt~~~~v~~~~~~~~~~~g~iD   89 (265)
T PRK07097         12 IALITGASYGIGFAIAKAYAEA-GATIVFNDIKQELV-DKGLAAYRELGIEAHGYVCDVTDEDGIQAMVAQIEKEVGVID   89 (265)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHHH-HHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCC
T ss_conf             8999585768999999999986-99999995998999-999999995499179999328999999999999999829998


Q ss_pred             EEEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             1785123433222----222222222222222202478886512322112478427863055431122222222222222
Q gi|254780920|r   76 AIVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPY  151 (358)
Q Consensus        76 ~ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~  151 (358)
                      ++++.|+......    +.++....+++|+.|+..+..++...     ..+.+.-++|++||...+..           .
T Consensus        90 iLVnNAG~~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~~~~-----m~~~~~G~IVnisS~~~~~~-----------~  153 (265)
T PRK07097         90 ILVNNAGIIRRIPMLEMSAEDFRQVIDIDLNAPFIVSKAVLPS-----MIKKGHGKIINICSMMSELG-----------R  153 (265)
T ss_pred             EEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHHCCCEEEEEECHHHCCC-----------C
T ss_conf             9998998999988265999999999998607289999999998-----99808975999905211567-----------8


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCC---CCCCCCCCCCCC
Q ss_conf             22222233322100000012333---2222222222222333222222222222222222--222---222222332211
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEG--SHV---FLYGDGQNVRDW  223 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g--~~~---~i~g~g~~~Rdf  223 (358)
                      ....+|+.||.+...+.+..+.+   +|+++-.+-|+.+--|....      +......+  .++   .+-..|  ..-+
T Consensus       154 ~~~~~Y~asKaav~~ltr~lA~e~a~~gIrVN~V~PG~i~T~~~~~------~~~~~~~~~~~~~~~~~~~~~P--~~R~  225 (265)
T PRK07097        154 ETVSAYAAAKGGLKMLTKNIASEYGEANIQCNGIGPGYIATPQTAP------LRERQADGSRHPFDQFIIAKTP--AARW  225 (265)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHH------HHHHHHHHHHHHHHHHHHHCCC--CCCC
T ss_conf             8866899999999999999999970249599999658898863045------6653101112159999984799--8897


Q ss_pred             CCCCCCCCCEEECCCC---CCCCCCCCCCCCC
Q ss_conf             3322220000000122---2222211135786
Q gi|254780920|r  224 LYVEDHVRALYLVLKK---GRIGERYNIGGNN  252 (358)
Q Consensus       224 i~v~D~a~~i~~~~~~---~~~~~~fNigs~~  252 (358)
                      ...+|++.++..++..   ...|+++.|.+|-
T Consensus       226 g~p~dia~~v~FL~Sd~s~~iTGq~i~VDGG~  257 (265)
T PRK07097        226 GTPEDLAGPAVFLASDASNFVNGHILYVDGGI  257 (265)
T ss_pred             CCHHHHHHHHHHHHCCHHCCCCCCEEEECCCC
T ss_conf             88999999999994844248358759979082


No 176
>PRK08226 short chain dehydrogenase; Provisional
Probab=99.38  E-value=3.3e-13  Score=100.05  Aligned_cols=225  Identities=17%  Similarity=0.118  Sum_probs=144.2

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHH-----CCCC
Q ss_conf             489976788277999999998689879999478876585677762-0379749997638899999999862-----2787
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEI-SQSNLFSFLQVDICDRECIRSALKE-----FQPD   75 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~-~~~~~v~~i~~Di~d~~~l~~~~~~-----~~~d   75 (358)
                      .+|||||++=||..+++.|+++ |.+|+..|+...  .....+++ ....+..++++|++|++.++++++.     .++|
T Consensus         8 valVTGas~GIG~aiA~~la~~-Ga~Vvi~d~~~~--~~~~~~~~~~~g~~~~~~~~Dvsd~~~v~~~v~~~~~~~G~iD   84 (263)
T PRK08226          8 TALITGALQGIGEGIARVFARH-GANLILLDISPE--IEKLADELCGRGHRCTAVVADVRDPASVAAAIKRAKEKEGRID   84 (263)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHH--HHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCC
T ss_conf             8999473779999999999987-998999969879--9999999983699179999417999999999999999839986


Q ss_pred             EEEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCC-CC-CCCCCCCCCCCC
Q ss_conf             1785123433222----22222222222222220247888651232211247842786305543-11-222222222222
Q gi|254780920|r   76 AIVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDE-VY-GSLDKGLFSEDM  149 (358)
Q Consensus        76 ~ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~-vY-g~~~~~~~~E~~  149 (358)
                      +++|.|+......    +.++....+++|+.|+..+..++...     ..+.+.-++|.+||.. .+ +.          
T Consensus        85 iLVNNAGi~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~p~-----m~~~~~G~IInisS~~g~~~~~----------  149 (263)
T PRK08226         85 ILVNNAGVCRLGNFLDMSDEDRDFHIDINIKGVWNVTKAVLPE-----MIARKDGRIVMMSSVTGDMVAD----------  149 (263)
T ss_pred             EEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCCEEEEEEHHHCCCCC----------
T ss_conf             9998997789999012999999999999729999999999999-----9983899899997653304489----------


Q ss_pred             CCCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCC--CCC----CCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222233322100000012333---22222222222223332222--222----22222222222222222222332
Q gi|254780920|r  150 PYNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFP--EKL----IPLAITRMIEGSHVFLYGDGQNV  220 (358)
Q Consensus       150 ~~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~--~~~----i~~~i~~~~~g~~~~i~g~g~~~  220 (358)
                        .....|+.||.+...+.+..+.+   +|+++-.+-|+.+--|....  ...    ...++....+.-|         .
T Consensus       150 --~~~~~Y~asKaav~~lTr~lA~Ela~~gIrVNaVaPG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~~P---------l  218 (263)
T PRK08226        150 --PGETAYALTKAAIVGLTKSLAVEYAQSGIRVNAICPGYVRTPMAESIARQSNPEDPESVLTEMAKAIP---------L  218 (263)
T ss_pred             --CCCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCHHHHHHHHHCCCCCHHHHHHHHHHCCC---------C
T ss_conf             --97388999999999999999999624295999997588987689999863275468999999984799---------9


Q ss_pred             CCCCCCCCCCCCEEECCC-C--CCCCCCCCCCCCCCCC
Q ss_conf             211332222000000012-2--2222211135786420
Q gi|254780920|r  221 RDWLYVEDHVRALYLVLK-K--GRIGERYNIGGNNERK  255 (358)
Q Consensus       221 Rdfi~v~D~a~~i~~~~~-~--~~~~~~fNigs~~~~s  255 (358)
                      +-+...+|+++++..+.. .  ...|+.+.+.+|.+++
T Consensus       219 gR~g~peeiA~~v~FLaSd~a~yiTG~~i~VDGG~tlp  256 (263)
T PRK08226        219 RRLADPLEVGELAAFLASDESSYLTGTQNVIDGGSTLP  256 (263)
T ss_pred             CCCCCHHHHHHHHHHHHCCHHCCCCCCEEEECCCCCCC
T ss_conf             99778999999999995836348048828858883078


No 177
>PRK05867 short chain dehydrogenase; Provisional
Probab=99.38  E-value=6.2e-13  Score=98.37  Aligned_cols=222  Identities=18%  Similarity=0.089  Sum_probs=139.4

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHH-HHHH-CCCCEEEEECCCCCHHHHHHHHHHC-----CC
Q ss_conf             489976788277999999998689879999478876585677-7620-3797499976388999999998622-----78
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSL-KEIS-QSNLFSFLQVDICDRECIRSALKEF-----QP   74 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~-~~~~-~~~~v~~i~~Di~d~~~l~~~~~~~-----~~   74 (358)
                      .+|||||++-||+.+++.|+++ |.+|+..|+....  .... +++. ...++.++++|++|++.++++++..     ++
T Consensus        11 valVTGas~GIG~aiA~~la~~-Ga~V~i~~r~~~~--~~~~~~ei~~~g~~~~~~~~Dvt~~~~v~~~v~~~~~~~G~i   87 (253)
T PRK05867         11 RALITGASTGIGKRVALAYVEA-GAQVAIAARHLDA--LEKLADEIGTSGGKVVPVCCDVSQHQQVTSMLDQVTAELGGI   87 (253)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHH--HHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCC
T ss_conf             8999795659999999999986-9999999798899--999999998459919999836999999999999999995998


Q ss_pred             CEEEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCC-CCEEEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             71785123433222----22222222222222220247888651232211247-84278630554311222222222222
Q gi|254780920|r   75 DAIVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKK-DQFRFLQISTDEVYGSLDKGLFSEDM  149 (358)
Q Consensus        75 d~ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~-~~~~~v~~SS~~vYg~~~~~~~~E~~  149 (358)
                      |+++|.|+......    ..++....+++|+.|+..+..++...     ..+. ..-++|.+||.+-+  ...       
T Consensus        88 DiLVnNAG~~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~~~-----m~~~~~gg~IvnisS~~g~--~~~-------  153 (253)
T PRK05867         88 DIAVCNAGIITVTPMLDMPLEEFQRLQNTNVTGVFLTAQAAAKA-----MVKQGQGGVIINTASMSGH--IIN-------  153 (253)
T ss_pred             CEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCCEEEEEEECCCC--CCC-------
T ss_conf             59998997788875010999999999999759999999999999-----9981899803887551112--657-------


Q ss_pred             CCCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222233322100000012333---2222222222222333222222222222222222222222222332211332
Q gi|254780920|r  150 PYNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYV  226 (358)
Q Consensus       150 ~~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v  226 (358)
                      .+.....|+.||.+...+.+..+.+   +|+++-.+-|+.+--|....   ..........  .+.       .+-+...
T Consensus       154 ~~~~~~~Y~asKaav~~ltr~lA~ela~~gIrVN~VaPG~i~T~~~~~---~~~~~~~~~~--~iP-------lgR~g~p  221 (253)
T PRK05867        154 VPQQVSHYCASKAAVIHLTKAMAVELAPHKIRVNSVSPGYILTELVEP---YTEYQPLWEP--KIP-------LGRLGRP  221 (253)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCH---HHHHHHHHHH--CCC-------CCCCCCH
T ss_conf             774027789999999999999999970009299999658899876421---1789999984--799-------8898299


Q ss_pred             CCCCCCEEECCCC---CCCCCCCCCCCCC
Q ss_conf             2220000000122---2222211135786
Q gi|254780920|r  227 EDHVRALYLVLKK---GRIGERYNIGGNN  252 (358)
Q Consensus       227 ~D~a~~i~~~~~~---~~~~~~fNigs~~  252 (358)
                      +|++.++..++..   ...|+++.+.+|-
T Consensus       222 ediA~~v~fLaSd~s~~iTG~~i~VDGG~  250 (253)
T PRK05867        222 EELAGLYLYLASEASSYMTGSDIVIDGGY  250 (253)
T ss_pred             HHHHHHHHHHHCCHHCCCCCCEEEECCCC
T ss_conf             99999999993872148548718858894


No 178
>pfam00106 adh_short short chain dehydrogenase. This family contains a wide variety of dehydrogenases.
Probab=99.38  E-value=1.1e-12  Score=96.82  Aligned_cols=152  Identities=22%  Similarity=0.253  Sum_probs=102.3

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCC-CCCCHH-HHHHHH-CCCCEEEEECCCCCHHHHHHHHHHC-----C
Q ss_conf             4899767882779999999986898799994788-765856-777620-3797499976388999999998622-----7
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLT-YAGNLN-SLKEIS-QSNLFSFLQVDICDRECIRSALKEF-----Q   73 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~-~~~~~~-~~~~~~-~~~~v~~i~~Di~d~~~l~~~~~~~-----~   73 (358)
                      .||||||++=||..++++|+++ |..+++++.+. ...... ....+. ....+.++++|++|++.++++++..     +
T Consensus         2 T~lITGas~GIG~aia~~la~~-Ga~~vv~~~r~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~~g~   80 (167)
T pfam00106         2 TVLITGGTGGLGLALARWLAAE-GARHLVLVSRRGDAPGAAELVAELEALGAEVTVAACDVADRDALAALLAALPAALGP   80 (167)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCCEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHCCC
T ss_conf             8999897878999999999987-994899965996768999999999955985999984699999999999999997599


Q ss_pred             CCEEEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCC-CCCCCCCCCCCC
Q ss_conf             871785123433222----222222222222222202478886512322112478427863055431-122222222222
Q gi|254780920|r   74 PDAIVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEV-YGSLDKGLFSED  148 (358)
Q Consensus        74 ~d~ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~v-Yg~~~~~~~~E~  148 (358)
                      +|++||.|+......    +.++-...+++|+.|+..+..++..         .+.-++|++||..- .|.         
T Consensus        81 iD~linnAG~~~~~~~~~~~~~~~~~~~~vN~~~~~~~~~~~~~---------~~~G~Ii~isS~~g~~~~---------  142 (167)
T pfam00106        81 LDGVVHNAGVLDDGPLEELTPERFERVLAPKVTGAWNLHELTLD---------LDLGAFVLFSSVAGVLGS---------  142 (167)
T ss_pred             CCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHC---------CCCCCEEEEECCCCCCCC---------
T ss_conf             73999887126898656526999999999986999999999755---------358957999351113789---------


Q ss_pred             CCCCCCCCCCCCCCCCEEEECCCCCCC
Q ss_conf             222222222333221000000123332
Q gi|254780920|r  149 MPYNPSSPYSATKASSDYLVLAWGHTY  175 (358)
Q Consensus       149 ~~~~p~s~Yg~sK~~~E~~~~~~~~~~  175 (358)
                         ...+.|+.||.+.+.+.+..+.+.
T Consensus       143 ---~~~~~Y~asKaal~~lt~~La~E~  166 (167)
T pfam00106       143 ---PGQANYAAANAALDALAEHRRAEG  166 (167)
T ss_pred             ---CCCHHHHHHHHHHHHHHHHHHHCC
T ss_conf             ---997789999999999999999767


No 179
>PRK08177 short chain dehydrogenase; Provisional
Probab=99.37  E-value=6e-13  Score=98.43  Aligned_cols=165  Identities=16%  Similarity=0.090  Sum_probs=113.4

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC---CCCEEE
Q ss_conf             48997678827799999999868987999947887658567776203797499976388999999998622---787178
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEF---QPDAIV   78 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~---~~d~Vi   78 (358)
                      +||||||+.=||..++++|+++ |++|++.+|.     ......+....+..+.++|++|.+.++.+++..   .+|++|
T Consensus         3 ~~lITGas~GIG~aia~~l~~~-G~~V~~~~R~-----~~~~~~~~~~~~~~~~~~D~~~~~~i~~~~~~~~~~~iDvli   76 (225)
T PRK08177          3 TALIIGASRGLGLGLVDRLLER-GWQVTATVRG-----PQQDTALQALPGVHIERLDMNDPASLDQLLQRLQGQRFDLLF   76 (225)
T ss_pred             EEEECCCCHHHHHHHHHHHHHC-CCEEEEEECC-----HHHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHCCCCCEEE
T ss_conf             8999273429999999999988-6999999798-----877899872548728998458889999999996067788899


Q ss_pred             EECCCCCCCC------CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             5123433222------2222222222222222024788865123221124784278630554311222222222222222
Q gi|254780920|r   79 NFAAESHVDR------SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYN  152 (358)
Q Consensus        79 HlAa~~~~~~------~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~  152 (358)
                      +.|+..++..      ..++-...+++|+.+...+...+...      .+.+..+++++||..-  ....       +..
T Consensus        77 nNAGi~~~~~~~~~~~~~~~~~~~~~~N~~~~~~l~~~~~~~------l~~~~g~iv~isS~~g--~~~~-------~~~  141 (225)
T PRK08177         77 VNAGISGPAHQSAADATAAEIGQLFLTNAIAPIRLARRLLGQ------VRPGQGVLAFMSSQLG--SVEL-------PDG  141 (225)
T ss_pred             ECCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH------HHHCCCCCCCCCCEEE--EECC-------CCC
T ss_conf             878436767678465999999999999878999999999888------6316787753330133--2014-------898


Q ss_pred             C-CCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCC
Q ss_conf             2-222233322100000012333---2222222222222
Q gi|254780920|r  153 P-SSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNN  187 (358)
Q Consensus       153 p-~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~v  187 (358)
                      | ...|+.||.+.+.+.+..+.+   +++.+..+.|+.|
T Consensus       142 ~~~~~Y~aSKaAl~~lt~sla~El~~~gI~Vn~i~PG~v  180 (225)
T PRK08177        142 GEMPLYKASKAALNSMTRSFVAELGEPDLTVLSMHPGWV  180 (225)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCC
T ss_conf             863677999999999999999984657829999971888


No 180
>PRK12744 short chain dehydrogenase; Provisional
Probab=99.37  E-value=1.7e-12  Score=95.67  Aligned_cols=226  Identities=17%  Similarity=0.199  Sum_probs=134.5

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCH--H-HHHHHH-CCCCEEEEECCCCCHHHHHHHHHH-----C
Q ss_conf             489976788277999999998689879999478876585--6-777620-379749997638899999999862-----2
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNL--N-SLKEIS-QSNLFSFLQVDICDRECIRSALKE-----F   72 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~--~-~~~~~~-~~~~v~~i~~Di~d~~~l~~~~~~-----~   72 (358)
                      .+|||||++=||+.+++.|+++ |.+|+++|........  . ....+. ...++.++++|+++.+.++++++.     .
T Consensus        10 valVTGgs~GIG~aiA~~la~~-Ga~vv~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~~G   88 (257)
T PRK12744         10 VVLIAGGAKNLGGLIARDLAAQ-GAKAVAIHYNSAATKADAEETVAAVKAAGAKAVAFQADLTTAAAVEKLFDDAKAAFG   88 (257)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCC
T ss_conf             8999288758999999999987-998999937874368999999999997399289997688999999999999999809


Q ss_pred             CCCEEEEECCCCCCC----CCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCC
Q ss_conf             787178512343322----2222222222222222202478886512322112478427863055431122222222222
Q gi|254780920|r   73 QPDAIVNFAAESHVD----RSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSED  148 (358)
Q Consensus        73 ~~d~ViHlAa~~~~~----~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~  148 (358)
                      ++|+++|.|+.....    .+.++....+++|+.|+..+..++....      ..+ -++|.++|+..-..   .|    
T Consensus        89 ~iDilVnnAG~~~~~~~~~~~~~~~~~~~~vN~~~~~~~~~~~~~~m------~~~-G~ii~i~ss~~~~~---~~----  154 (257)
T PRK12744         89 RPDIAINTVGKVLKKPIVEISEAEYDEMFAVNSKSAFFFIKEAGRHL------NDN-GKIVTLVTSLLGAF---TP----  154 (257)
T ss_pred             CCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH------HCC-CCEEEEEECHHHCC---CC----
T ss_conf             98899976644567723332288888898888766999999999987------418-94999981154467---89----


Q ss_pred             CCCCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222222233322100000012333---222222222222233322222222222222222222222222233221133
Q gi|254780920|r  149 MPYNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLY  225 (358)
Q Consensus       149 ~~~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~  225 (358)
                          ..+.|+.+|.+.+.+.+..+.+   +|+++-.+-|+.+--|.-... ..+..   ....+..... .+..+.-+..
T Consensus       155 ----~~~~Y~asKaav~~ltr~lA~ela~~gIrVNaVaPG~i~T~~~~~~-~~~~~---~~~~~~~~~~-~~~~~~~~~~  225 (257)
T PRK12744        155 ----FYSAYAGSKAPVEHFTRAASKEFGARGISVTAVGPGPMDTPFFYPQ-EGAEA---VAYHKTAAAL-SPFSKTGLTD  225 (257)
T ss_pred             ----CHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCC-CCHHH---HHHHHHHHHH-CCCCCCCCCC
T ss_conf             ----5188999999999999999999654496999996388987765765-57045---7777788862-8768899999


Q ss_pred             CCCCCCCEEECCCCC--CCCCCCCCCCC
Q ss_conf             222200000001222--22221113578
Q gi|254780920|r  226 VEDHVRALYLVLKKG--RIGERYNIGGN  251 (358)
Q Consensus       226 v~D~a~~i~~~~~~~--~~~~~fNigs~  251 (358)
                      .+|++.++..++...  ..|+++.+.+|
T Consensus       226 pedia~~v~fLaSda~~iTGq~i~VDGG  253 (257)
T PRK12744        226 IEDIVPFIRFLVTDGWWITGQTILINGG  253 (257)
T ss_pred             HHHHHHHHHHHHCCCCCCCCCEEEECCC
T ss_conf             9999999999947588832983897948


No 181
>PRK08628 short chain dehydrogenase; Provisional
Probab=99.37  E-value=1.9e-12  Score=95.38  Aligned_cols=220  Identities=20%  Similarity=0.205  Sum_probs=140.7

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHH-HHCCCCEEEEECCCCCHHHHHHHHHH----C-CCC
Q ss_conf             48997678827799999999868987999947887658567776-20379749997638899999999862----2-787
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKE-ISQSNLFSFLQVDICDRECIRSALKE----F-QPD   75 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~-~~~~~~v~~i~~Di~d~~~l~~~~~~----~-~~d   75 (358)
                      .+|||||++=||..+++.|+++ |..|+.+|+....  ....+. .....++.++++|++|++.++++++.    + ++|
T Consensus         9 valVTG~s~GIG~a~a~~la~~-Ga~v~i~~~~~~~--~~~~~~~~~~~~~~~~~~~Dvs~~~~v~~~v~~~~~~~g~iD   85 (258)
T PRK08628          9 VVIVTGGASGIGAAISLRLAEE-GAIPVVFGRSAPD--DEFAEELRALQPRAEFVQVDLQDDAQCRDAVAQTVAKFGRID   85 (258)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCCCH--HHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCC
T ss_conf             8999277778999999999987-9989998088023--999999995399789999527999999999999999829988


Q ss_pred             EEEEECCCCCCCC---CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCC-CCCCCCCCCCCCCCC
Q ss_conf             1785123433222---222222222222222202478886512322112478427863055431-122222222222222
Q gi|254780920|r   76 AIVNFAAESHVDR---SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEV-YGSLDKGLFSEDMPY  151 (358)
Q Consensus        76 ~ViHlAa~~~~~~---~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~v-Yg~~~~~~~~E~~~~  151 (358)
                      +++|.|+......   ..++....+++|+.++..+..++....      +.+.-++|.+||..- .|.            
T Consensus        86 iLVnnAGi~~~~~~e~~~e~~~~~~~~Nl~~~~~l~~~~~p~l------~~~~GsIInisS~~a~~~~------------  147 (258)
T PRK08628         86 GLVNNAGVNDGVGLDAGRDAFVASLERNLIHYYVMAHYCLPHL------KASRGAIVNISSKTALTGQ------------  147 (258)
T ss_pred             EEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH------HHCCCEEEEEECHHCCCCC------------
T ss_conf             9998882278877789999999999987499999999999988------8549549998122101679------------


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCC------CCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222233322100000012333---22222222222223332222222222------2222222222222222233221
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPL------AITRMIEGSHVFLYGDGQNVRD  222 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~------~i~~~~~g~~~~i~g~g~~~Rd  222 (358)
                      .....|+.||.+...+.+..+.+   +|+++-.+-|+.+.-|...  ..+..      ....+...-|+        .+-
T Consensus       148 ~~~~~Y~asKaal~~ltr~lA~e~~~~gIRvNaI~PG~i~T~~~~--~~~~~~~~~~~~~~~~~~~~pl--------~~R  217 (258)
T PRK08628        148 GGTSGYAAAKGAQLGLTREWAVALAKDGVRVNAVIPAEVMTPLYA--NWLATFDDPEAKLAKITRKIPL--------GHR  217 (258)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHH--HHHHHCCCHHHHHHHHHHCCCC--------CCC
T ss_conf             984889999999999999999996411959999987889876679--8876047869999999954998--------678


Q ss_pred             CCCCCCCCCCEEECCCC---CCCCCCCCCCCCC
Q ss_conf             13322220000000122---2222211135786
Q gi|254780920|r  223 WLYVEDHVRALYLVLKK---GRIGERYNIGGNN  252 (358)
Q Consensus       223 fi~v~D~a~~i~~~~~~---~~~~~~fNigs~~  252 (358)
                      +.-.+|++.++..++..   ...|+++.+.+|-
T Consensus       218 ~g~p~eiA~~v~FL~Sd~s~~iTG~~i~VDGG~  250 (258)
T PRK08628        218 MTTAEEIADTAVFLLSERASHTTGQWLFVDGGY  250 (258)
T ss_pred             CCCHHHHHHHHHHHHCCHHCCCCCCEEEECCCE
T ss_conf             829999999999995834349338879973988


No 182
>PRK06914 short chain dehydrogenase; Provisional
Probab=99.37  E-value=1.6e-12  Score=95.79  Aligned_cols=166  Identities=19%  Similarity=0.209  Sum_probs=113.9

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHH----HHHHCCCCEEEEECCCCCHHHHHHHH---HHC-CC
Q ss_conf             89976788277999999998689879999478876585677----76203797499976388999999998---622-78
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSL----KEISQSNLFSFLQVDICDRECIRSAL---KEF-QP   74 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~----~~~~~~~~v~~i~~Di~d~~~l~~~~---~~~-~~   74 (358)
                      +|||||+.=||..++.+|.++ |++|++.++...  ....+    .......++.++.+|++|.++++.+-   +++ ++
T Consensus         6 alITGassGIG~a~A~~la~~-G~~V~~~~r~~~--~~~~l~~~~~~~~~~~~~~~~~~Dvtd~~~v~~~~~~~~~~g~i   82 (280)
T PRK06914          6 AIITGASSGFGLLTTLELAKK-DYLVIATMRNLE--KQENLISQAAQLNLSQNIKVQQLDVTDQNSIHNFQLFLKEYGRI   82 (280)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHH--HHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHHHHHHCCC
T ss_conf             999073449999999999987-998999989889--99999999996499976699968899999999999999982998


Q ss_pred             CEEEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             71785123433222----22222222222222220247888651232211247842786305543112222222222222
Q gi|254780920|r   75 DAIVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMP  150 (358)
Q Consensus        75 d~ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~  150 (358)
                      |+++|.|+......    +.++-...+++|+.|+..+..++.-.     ..+.+.-++|.+||.+-+-           +
T Consensus        83 DvLVNNAG~~~~~~~~~~~~~~~~~~~~vN~~g~~~~~~~~lp~-----m~~~~~G~IvnisS~~g~~-----------~  146 (280)
T PRK06914         83 DLLVNNAGYANGGFVEEIPVEEYRKQFETNVFGAISVTQAVLPY-----MRKQKSGKIINISSISGQV-----------G  146 (280)
T ss_pred             CEEEECCCCCCCCCHHCCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEEECCHHHCC-----------C
T ss_conf             78997886677874211779999999987128999899999787-----7756995899983413326-----------8


Q ss_pred             CCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCC
Q ss_conf             222222233322100000012333---2222222222222
Q gi|254780920|r  151 YNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNN  187 (358)
Q Consensus       151 ~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~v  187 (358)
                      .-..+.|+.||.+.+-+.+..+.+   +|+.+.++-|+.|
T Consensus       147 ~p~~~~Y~aSK~Al~~~t~sL~~El~~~gI~V~~V~PG~i  186 (280)
T PRK06914        147 FPALSPYVSSKYALEGWSESLRLEVKPFGIDVALIEPGSY  186 (280)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCC
T ss_conf             9987379999999999999999984310938999972898


No 183
>PRK05599 hypothetical protein; Provisional
Probab=99.37  E-value=1.8e-12  Score=95.59  Aligned_cols=207  Identities=16%  Similarity=0.156  Sum_probs=130.5

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHH-HHC--CCCEEEEECCCCCHHHHHHHHHHC-----
Q ss_conf             948997678827799999999868987999947887658567776-203--797499976388999999998622-----
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKE-ISQ--SNLFSFLQVDICDRECIRSALKEF-----   72 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~-~~~--~~~v~~i~~Di~d~~~l~~~~~~~-----   72 (358)
                      |+|||||||.=||..+++.|. + |++|+...|...  ....+.+ +..  ...+..+.+|++|.+.++++++..     
T Consensus         1 MtvlITGASsGIG~a~A~~lA-~-G~~vvl~~R~~e--~l~~l~~~l~~~g~~~v~~~~~Dvtd~~~~~~~v~~~~~~~g   76 (246)
T PRK05599          1 MSILILGGTSDIAGEIATLLA-H-GEDVVLAARRPE--AAGGLAEDLRQLGATSVHVLSFDATDLDSHRELVKQTQELAG   76 (246)
T ss_pred             CEEEEECCCHHHHHHHHHHHH-C-CCCEEEEECCHH--HHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHCC
T ss_conf             989998886899999999998-5-994999999999--999999999862597189972899999999999999998619


Q ss_pred             CCCEEEEECCCCCCC-CCCCC---CCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCC
Q ss_conf             787178512343322-22222---22222222222202478886512322112478427863055431122222222222
Q gi|254780920|r   73 QPDAIVNFAAESHVD-RSILG---ADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSED  148 (358)
Q Consensus        73 ~~d~ViHlAa~~~~~-~~~~~---p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~  148 (358)
                      .+|++++.|+..+.. ....+   ....+++|+.|..+++..+.....    ...+.-++|.+||.+-+-          
T Consensus        77 ~id~lv~naGi~~~~~~~~~d~~~~~~~~~vN~~~~~~~~~~~~~~~~----~~~~~G~Iv~iSSvag~~----------  142 (246)
T PRK05599         77 EISLAVVAFGILGDQERAETDEAHAVEIATVDYTAQVSMLTVLADELR----AQTTPSTIVAFSSIAGWR----------  142 (246)
T ss_pred             CCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH----HCCCCCEEEEEECHHHCC----------
T ss_conf             843999877667873201189999999999886999999999999998----546994799996767578----------


Q ss_pred             CCCCCCCCCCCCCCCCEEEECCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222222333221000000123---33222222222222233322222222222222222222222222233221133
Q gi|254780920|r  149 MPYNPSSPYSATKASSDYLVLAWG---HTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLY  225 (358)
Q Consensus       149 ~~~~p~s~Yg~sK~~~E~~~~~~~---~~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~  225 (358)
                       +....+.|+.||.+.+.+++..+   ..+|+++..++|+.|-.|-.          .. ....|+           .+.
T Consensus       143 -~~~~~~~Y~ASKaal~~~~~~L~~el~~~gI~V~~v~PG~V~T~mt----------~~-~~~~p~-----------~~s  199 (246)
T PRK05599        143 -ARRANYVYGSTKAGLDAFCQGLADSLHGSHVRLIIARPGFVIGSMT----------TG-MKPAPM-----------SVY  199 (246)
T ss_pred             -CCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCC----------CC-CCCCCC-----------CCC
T ss_conf             -7888850869999999999999999537796899984498836200----------79-998987-----------589


Q ss_pred             CCCCCCCEEECCCCCCCCCCCCC
Q ss_conf             22220000000122222221113
Q gi|254780920|r  226 VEDHVRALYLVLKKGRIGERYNI  248 (358)
Q Consensus       226 v~D~a~~i~~~~~~~~~~~~fNi  248 (358)
                      .+++|+.++.++.+.+...++.+
T Consensus       200 pe~~A~~i~~~i~~~k~~~~i~~  222 (246)
T PRK05599        200 PRDVAAAVVSAITSKKRSTTLWI  222 (246)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             99999999999981898669997


No 184
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=99.36  E-value=6.1e-13  Score=98.38  Aligned_cols=220  Identities=20%  Similarity=0.185  Sum_probs=138.9

Q ss_pred             EEEECCC--CHHHHHHHHHHHHHCCCEEEEEECCCCCCC------H---HH-HHHH-HCCCCEEEEECCCCCHHHHHHHH
Q ss_conf             8997678--827799999999868987999947887658------5---67-7762-03797499976388999999998
Q gi|254780920|r    3 LIVTGGA--GFIGSALCRYLVNDLKIQVLVIDKLTYAGN------L---NS-LKEI-SQSNLFSFLQVDICDRECIRSAL   69 (358)
Q Consensus         3 ILItG~t--GfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~------~---~~-~~~~-~~~~~v~~i~~Di~d~~~l~~~~   69 (358)
                      +|||||+  |=||..+++.|+++ |++|+..++......      .   .. .+.+ ....++..+++|+++++.+++++
T Consensus         8 alVTGasr~~GIG~aiA~~la~~-Ga~V~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvs~~~~~~~~~   86 (257)
T PRK12748          8 AIVTGASRLNGIGAAICRVLAQK-GIDIFFTYWSQYDKAMPWGMHDKEPFLLKEEIESYGVRCEMLEIDLSQSYSPNRLF   86 (257)
T ss_pred             EEEECCCCCCCHHHHHHHHHHHC-CCEEEEECCCHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHH
T ss_conf             99928899985499999999987-99999970752554434234606799999999965982899984689999999999


Q ss_pred             HH----C-CCCEEEEECCCCCCCCC----CCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCC
Q ss_conf             62----2-78717851234332222----222222222222222024788865123221124784278630554311222
Q gi|254780920|r   70 KE----F-QPDAIVNFAAESHVDRS----ILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSL  140 (358)
Q Consensus        70 ~~----~-~~d~ViHlAa~~~~~~~----~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~  140 (358)
                      +.    + ++|+++|.|+......-    .++....+++|+.|+..+..+.-..     ....+.-++|.+||.....  
T Consensus        87 ~~~~~~~G~iDiLVnnAg~~~~~~~~~~~~~~~~~~~~vN~~~~~~l~~~~~~~-----m~~~~~G~IInisS~~~~~--  159 (257)
T PRK12748         87 YMVSERLGDPSILINNAAYSTHTRIEELDVEQLDKHYAVNVRATMLLSSLFAKQ-----FASKTGGRIINLTSGQSLG--  159 (257)
T ss_pred             HHHHHHCCCCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEEEECHHHHC--
T ss_conf             999997499989998998899999055999999999999838999999999998-----8653892799982278606--


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222222222222222333221000000123332---222222222222333222222222222222222222222222
Q gi|254780920|r  141 DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDG  217 (358)
Q Consensus       141 ~~~~~~E~~~~~p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g  217 (358)
                               +......|+.+|.+.+.+.+.++.++   |+++-.+-|+.+.-+...     +.....+...-|+      
T Consensus       160 ---------~~~~~~~Y~asKaal~~ltr~lA~ela~~gIrVN~V~PG~i~T~~~~-----~~~~~~~~~~~Pl------  219 (257)
T PRK12748        160 ---------PMPDELAYAATKGAIEAFTKSLAPVLAEKGITVNAVNPGPTDTGWIT-----EELKHHLVPKFPQ------  219 (257)
T ss_pred             ---------CCCCHHHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCCC-----HHHHHHHHHCCCC------
T ss_conf             ---------48760486999999999999999997230949999977878988889-----8999999857998------


Q ss_pred             CCCCCCCCCCCCCCCEEECCCC---CCCCCCCCCCCCCC
Q ss_conf             3322113322220000000122---22222111357864
Q gi|254780920|r  218 QNVRDWLYVEDHVRALYLVLKK---GRIGERYNIGGNNE  253 (358)
Q Consensus       218 ~~~Rdfi~v~D~a~~i~~~~~~---~~~~~~fNigs~~~  253 (358)
                         +-+...+|++.++..++..   ...|.++.+.+|-+
T Consensus       220 ---gR~g~pedia~~v~fL~S~~a~~iTG~~i~VDGG~s  255 (257)
T PRK12748        220 ---GRVGEPVDAARLIAFLASEEAKWITGQVIHSEGGFS  255 (257)
T ss_pred             ---CCCCCHHHHHHHHHHHHCCHHCCEECCEEEECCCCC
T ss_conf             ---998599999999999948553484085589775804


No 185
>PRK07063 short chain dehydrogenase; Provisional
Probab=99.36  E-value=1.7e-12  Score=95.62  Aligned_cols=224  Identities=15%  Similarity=0.087  Sum_probs=145.1

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH--CCCCEEEEECCCCCHHHHHHHHHH-----CCCC
Q ss_conf             899767882779999999986898799994788765856777620--379749997638899999999862-----2787
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS--QSNLFSFLQVDICDRECIRSALKE-----FQPD   75 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~--~~~~v~~i~~Di~d~~~l~~~~~~-----~~~d   75 (358)
                      +|||||++=||..+++.|+++ |.+|+..|+...... ....++.  ...++.++++|++|.+.++++++.     .++|
T Consensus        10 alVTGa~~GIG~aiA~~~a~~-Ga~V~i~~~~~~~~~-~~~~~l~~~~g~~~~~~~~Dvt~~~~v~~~v~~~~~~~G~iD   87 (259)
T PRK07063         10 ALVTGAAQGIGAAIARAFVRE-GAAVALADLDAALAE-RAAAAIARQTGARVLALPADVTRAASVRAAVARAEAAFGPLD   87 (259)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHHHH-HHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             999587878999999999987-998999979878999-999999885099189998368999999999999999819988


Q ss_pred             EEEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             1785123433222----222222222222222202478886512322112478427863055431122222222222222
Q gi|254780920|r   76 AIVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPY  151 (358)
Q Consensus        76 ~ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~  151 (358)
                      ++++.|+......    +.++....+++|+.|+..+..++....     .+.+.-++|.+||..-+-     +      .
T Consensus        88 iLVNNAG~~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~p~m-----~~~~~G~IVnisS~~~~~-----~------~  151 (259)
T PRK07063         88 VLVNNAGINVFADPLAMTDEDWRRCFAVDLDGAWNCCRAVLPGM-----VERGRGSIVNIASTHAFK-----I------I  151 (259)
T ss_pred             EEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHCCCCEEEEECCHHHCC-----C------C
T ss_conf             99989977899990449999999999875288999999999999-----986996699987766567-----7------9


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCC--CCC-CCCCCC-CCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222233322100000012333---22222222222223332222--222-222222-222222222222223322113
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFP--EKL-IPLAIT-RMIEGSHVFLYGDGQNVRDWL  224 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~--~~~-i~~~i~-~~~~g~~~~i~g~g~~~Rdfi  224 (358)
                      ....+|+.||.+...+.+..+.+   +|+++-.+-|+.+.-|....  ... -+...+ .....-|         .+-+.
T Consensus       152 ~~~~~Y~asKaav~~lTr~lA~e~a~~gIrVNaI~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~P---------l~R~g  222 (259)
T PRK07063        152 PGCFPYPVAKHGLLGLTRALGIEYAARNVRVNAIAPGYIETQLTEDWWNAQPDPAAARAETLALQP---------MKRIG  222 (259)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCHHHHHHHHCCCCHHHHHHHHHHCCC---------CCCCC
T ss_conf             996679999999999999999997141929998976779877689887527998999999982799---------99977


Q ss_pred             CCCCCCCCEEECCCC---CCCCCCCCCCCCCC
Q ss_conf             322220000000122---22222111357864
Q gi|254780920|r  225 YVEDHVRALYLVLKK---GRIGERYNIGGNNE  253 (358)
Q Consensus       225 ~v~D~a~~i~~~~~~---~~~~~~fNigs~~~  253 (358)
                      ..+|+|.+++.+...   ...|+++.+.+|.+
T Consensus       223 ~peeiA~~v~FLaSd~as~iTG~~i~VDGG~t  254 (259)
T PRK07063        223 RPEEVAMTAVFLASDEAPFINATCITIDGGRS  254 (259)
T ss_pred             CHHHHHHHHHHHHCCHHCCCCCCEEEECCCHH
T ss_conf             89999999999958652582487189881965


No 186
>PRK12746 short chain dehydrogenase; Provisional
Probab=99.36  E-value=7.5e-13  Score=97.87  Aligned_cols=219  Identities=22%  Similarity=0.236  Sum_probs=134.5

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEE-ECCCCCCCHHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHH---------
Q ss_conf             89976788277999999998689879999-478876585677762-0379749997638899999999862---------
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVI-DKLTYAGNLNSLKEI-SQSNLFSFLQVDICDRECIRSALKE---------   71 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~-d~~~~~~~~~~~~~~-~~~~~v~~i~~Di~d~~~l~~~~~~---------   71 (358)
                      +|||||++=||+.+++.|+++ |++|+.. ++ .......-.+.+ ....+..++++|+++.+.++++++.         
T Consensus         9 alITGga~GIG~aia~~la~~-Ga~V~i~~~~-~~~~~~~~~~~~~~~~~~~~~~~~Dv~~~~~~~~~~~~~~~~~~~~~   86 (254)
T PRK12746          9 ALVTGASRGIGRAIAMRLAND-GALVAIHYGR-NKAAADETIREIESNGGKAFLIEADLNSIDGVKKLVEQLKNELQIRV   86 (254)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEECCC-CHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             999484768999999999987-9999996599-98999999999985599289997577999999999999999986641


Q ss_pred             --CCCCEEEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCC
Q ss_conf             --27871785123433222----222222222222222202478886512322112478427863055431122222222
Q gi|254780920|r   72 --FQPDAIVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLF  145 (358)
Q Consensus        72 --~~~d~ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~  145 (358)
                        .++|+++|.|+......    +.++....+++|+.|+..+..++-...      +. .-++|.+||....-       
T Consensus        87 g~g~iDiLVnnAg~~~~~~~~~~~~~~~~~~~~vNl~~~f~~~k~~~p~m------~~-~G~IVnisS~~~~~-------  152 (254)
T PRK12746         87 GTSEIDILVNNAGIGTQGTIENTTEEIFDEIMAVNIKAPFFLIQQTLPLL------RA-EGRVINISSAEVRL-------  152 (254)
T ss_pred             CCCCCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH------HH-CCCEEEEECHHHCC-------
T ss_conf             68985189979978899991449999999999985346899999999998------61-69669992432335-------


Q ss_pred             CCCCCCCCCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222222222333221000000123332---2222222222223332222222222-222222222222222223322
Q gi|254780920|r  146 SEDMPYNPSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIPL-AITRMIEGSHVFLYGDGQNVR  221 (358)
Q Consensus       146 ~E~~~~~p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~~-~i~~~~~g~~~~i~g~g~~~R  221 (358)
                          .......|+.||.+...+.+.++.++   |+++-.+=|+.+-.|...  .+... -++......+      +  ..
T Consensus       153 ----~~~~~~~Y~asKaal~~ltr~lA~e~a~~gIrVNaVaPG~i~T~~~~--~~~~~~~~~~~~~~~~------~--lg  218 (254)
T PRK12746        153 ----GFTGSIAYGLSKGALNTMTLPLAKHLGERGITVNTIMPGYTKTDINA--KLLDDPEIRNFATNSS------V--FG  218 (254)
T ss_pred             ----CCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHH--HCCCCHHHHHHHHHCC------C--CC
T ss_conf             ----78873778999999999999999996513989999878989863343--3049999999997279------9--78


Q ss_pred             CCCCCCCCCCCEEECCCC---CCCCCCCCCCCC
Q ss_conf             113322220000000122---222221113578
Q gi|254780920|r  222 DWLYVEDHVRALYLVLKK---GRIGERYNIGGN  251 (358)
Q Consensus       222 dfi~v~D~a~~i~~~~~~---~~~~~~fNigs~  251 (358)
                      -+...+|++.++..++..   ...|+++.+.+|
T Consensus       219 R~g~p~dia~~v~FL~S~~s~~iTG~~l~VDGG  251 (254)
T PRK12746        219 RIGQVEDIADAVAFLASSDSRWVTGQIIDVSGG  251 (254)
T ss_pred             CCCCHHHHHHHHHHHHCCHHCCEECCEEEECCC
T ss_conf             975999999999999586323840885887958


No 187
>PRK07806 short chain dehydrogenase; Provisional
Probab=99.36  E-value=1.7e-12  Score=95.68  Aligned_cols=222  Identities=18%  Similarity=0.164  Sum_probs=136.1

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH-CCCCEEEEECCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             899767882779999999986898799994788765856777620-3797499976388999999998622-----7871
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS-QSNLFSFLQVDICDRECIRSALKEF-----QPDA   76 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~-~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d~   76 (358)
                      +|||||+.=||..+++.|.++ |++|+..++.....-..-...+. ...+...+++|++|++.++++++..     ++|+
T Consensus         9 alVTGas~GIG~aiA~~la~~-Ga~Vvi~~~~~~~~a~~~~~~i~~~g~~a~~~~~Dvtd~~~v~~l~~~~~~~~G~iDi   87 (248)
T PRK07806          9 ALVTGSSRGIGAEVAKYLAGA-GAHVVVNYRNKAARAEKVVAEIRAAGGRASAVGADLTDEASVAALMDAIRAEFGGLDA   87 (248)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCCE
T ss_conf             999378859999999999987-9989998389568999999999961983999978999999999999999998499989


Q ss_pred             EEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCC--CCCCCCCCCCCCCCCCC-
Q ss_conf             785123433222222222222222222202478886512322112478427863055431--12222222222222222-
Q gi|254780920|r   77 IVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEV--YGSLDKGLFSEDMPYNP-  153 (358)
Q Consensus        77 ViHlAa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~v--Yg~~~~~~~~E~~~~~p-  153 (358)
                      ++|-|+....  ...++...++.|..+..+++.++.-.      ...+ -++|++||...  ++..         +..| 
T Consensus        88 LVnNAg~~~~--~~~~~~~~~~~n~~~~~~~~~~~~p~------m~~g-g~Ii~isS~~~~~~~~~---------~~~p~  149 (248)
T PRK07806         88 LVLNASGGME--SGMDPDYAMRLNRDAQRRLLTLALPL------MPAG-SRVVFVTSHQAHFIPTV---------KTMPE  149 (248)
T ss_pred             EEECCCCCCC--CCCCHHHHHHHHHHHHHHHHHHHHHH------HCCC-CEEEEECCCHHHCCCCC---------CCCCC
T ss_conf             9989999877--89972268999989999999999977------5049-78999855166156877---------77866


Q ss_pred             CCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222333221000000123332---2222222222223332222222222222222222222222223322113322220
Q gi|254780920|r  154 SSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV  230 (358)
Q Consensus       154 ~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~a  230 (358)
                      ..+|+.||.+.+.+++..+.++   |+++.++-|+.+-+|...  .+....-..........+ |      -+.-.+|+|
T Consensus       150 ~~~y~asK~A~~~~~~~la~ela~~gIrvn~v~pg~i~t~~~~--~~~~~~~~~~~~~~~~p~-g------R~g~pediA  220 (248)
T PRK07806        150 YEAVAASKRAGEDALRALRPELAHAGIGFVVVSGDMIEGTVTA--TLLNRLNPGAIDARRAAA-G------KLYTVSEFA  220 (248)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCCCCCHHHH--HHHCCCCHHHHHHHHCCC-C------CCCCHHHHH
T ss_conf             2899999999999999999997765988999727987851444--432372446898750677-8------998989999


Q ss_pred             CCEEECCCCC-CCCCCCCCCCCC
Q ss_conf             0000001222-222211135786
Q gi|254780920|r  231 RALYLVLKKG-RIGERYNIGGNN  252 (358)
Q Consensus       231 ~~i~~~~~~~-~~~~~fNigs~~  252 (358)
                      .++..+...+ ..|+++++.+|.
T Consensus       221 ~av~fLas~~~~TGqti~VdGG~  243 (248)
T PRK07806        221 AEVARAVTAPVPAGHIVYVGGAD  243 (248)
T ss_pred             HHHHHHHCCCCCCCCEEEECCHH
T ss_conf             99999957998999989988778


No 188
>PRK06523 short chain dehydrogenase; Provisional
Probab=99.36  E-value=1.4e-12  Score=96.19  Aligned_cols=225  Identities=13%  Similarity=0.078  Sum_probs=141.3

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH----C-CCCE
Q ss_conf             4899767882779999999986898799994788765856777620379749997638899999999862----2-7871
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKE----F-QPDA   76 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~----~-~~d~   76 (358)
                      ++|||||++=||..++++|+++ |.+|+..++...         ......+.++++|++|++.+++++++    + ++|+
T Consensus        11 ~alITG~s~GIG~aia~~la~~-Ga~V~~~~r~~~---------~~~~~~~~~~~~Dv~~~~~v~~~v~~~~~~~g~iDi   80 (260)
T PRK06523         11 RALVTGGTKGIGAATVARFREA-GARVVTTARSRP---------DDLPEGVEFVAADLTTAEGCAAVARAVLERLGGVDI   80 (260)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCCC---------CCCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCE
T ss_conf             8999475769999999999987-999999948840---------137986289983799999999999999997499979


Q ss_pred             EEEECCCCCCCC------CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             785123433222------22222222222222220247888651232211247842786305543112222222222222
Q gi|254780920|r   77 IVNFAAESHVDR------SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMP  150 (358)
Q Consensus        77 ViHlAa~~~~~~------~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~  150 (358)
                      ++|.|+.+.+..      +.++....+++|+.|+.++..++...     ..+.+.-++|++||....     .|.     
T Consensus        81 LVnNAG~~~~~~~~~~~~~~~~w~~~~~~Nl~~~~~~~q~~~p~-----m~~~~~G~IinisS~~~~-----~~~-----  145 (260)
T PRK06523         81 LVHVLGGSSAPAGGFAALTDEEWQDELNLNLLAAVRLDRALLPA-----MIARGSGVIIHVTSIQRR-----LPL-----  145 (260)
T ss_pred             EEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCCEEEEEEHHHC-----CCC-----
T ss_conf             99899887679988031999999999999849999999999999-----998399866999552214-----688-----


Q ss_pred             CCCCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCC-CCCCCCCCCCC
Q ss_conf             2222222333221000000123332---222222222222333222222222222222----222222-22222233221
Q gi|254780920|r  151 YNPSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIPLAITRM----IEGSHV-FLYGDGQNVRD  222 (358)
Q Consensus       151 ~~p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~----~~g~~~-~i~g~g~~~Rd  222 (358)
                      +.....|+.+|.+.+.+.+..+.++   |+++-.+-|+.+-.|...  .....+....    ...+.. .-...+-...-
T Consensus       146 ~~~~~~Y~asKaal~~ltk~lA~e~~~~gIrvN~V~PG~i~T~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~iPlgR  223 (260)
T PRK06523        146 PESTTAYAAAKAALSTYSKSLSKEVAPKGVRVNRVSPGWIETEAAV--ALAERLAEAAGTDYEGAKQIIMDSLGGIPLGR  223 (260)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCHH--HHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCC
T ss_conf             8650889999999999999999997343929999964889875278--89999987618998999999998527889889


Q ss_pred             CCCCCCCCCCEEECCC-C--CCCCCCCCCCCCCC
Q ss_conf             1332222000000012-2--22222111357864
Q gi|254780920|r  223 WLYVEDHVRALYLVLK-K--GRIGERYNIGGNNE  253 (358)
Q Consensus       223 fi~v~D~a~~i~~~~~-~--~~~~~~fNigs~~~  253 (358)
                      +...+|+++++..++. .  ...|.++.+.+|--
T Consensus       224 ~g~peeiA~~v~FL~Sd~s~~iTG~~i~VDGG~~  257 (260)
T PRK06523        224 PAEPEEVAELIAFLASDRAASITGTEYVIDGGTV  257 (260)
T ss_pred             CCCHHHHHHHHHHHHCCHHCCEECCEEEECCCCC
T ss_conf             7599999999999948442686085578878895


No 189
>PRK07825 short chain dehydrogenase; Provisional
Probab=99.35  E-value=1.3e-12  Score=96.36  Aligned_cols=199  Identities=19%  Similarity=0.075  Sum_probs=131.5

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHHC-----CCC
Q ss_conf             489976788277999999998689879999478876585677762-03797499976388999999998622-----787
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEI-SQSNLFSFLQVDICDRECIRSALKEF-----QPD   75 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~-~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d   75 (358)
                      .||||||++=||..+++.|.++ |++|+..|+..     ..++.. .....+..+.+|++|+++++++++..     .+|
T Consensus         7 vvlITGassGIG~a~A~~la~~-Ga~V~i~~r~~-----~~l~~~~~~~~~~~~~~~DVtd~~~v~~~~~~~~~~~G~iD   80 (273)
T PRK07825          7 VIAITGGARGIGLATARALAAL-GAKVAIGDLDE-----ALAKESAAELGLVVGGPLDVTDPASFAAFLDAVEADLGPID   80 (273)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCH-----HHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             8999262339999999999987-99899997999-----99999998607855999147999999999999999709977


Q ss_pred             EEEEECCCCCCCCC----CCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             17851234332222----22222222222222202478886512322112478427863055431122222222222222
Q gi|254780920|r   76 AIVNFAAESHVDRS----ILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPY  151 (358)
Q Consensus        76 ~ViHlAa~~~~~~~----~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~  151 (358)
                      ++++.|+.......    .++....+++|+.|+.++..++.-.     ..+.+.-++|.+||.+-+-           +.
T Consensus        81 iLVNNAGi~~~~~~~e~~~e~~~~~~~vNl~g~~~~~~~~lp~-----M~~~~~G~IVnisS~ag~~-----------~~  144 (273)
T PRK07825         81 VLVNNAGIMPVGPFLDEPDRATRRILDVNVYGVILGSKLAAPR-----MVPRGRGHIVNVASLAGKI-----------AV  144 (273)
T ss_pred             EEEECCCCCCCCCHHHCCHHHHHHHHHHCCHHHHHHHHHHHHH-----HHHCCCCEEEEEECHHHHC-----------CC
T ss_conf             8998787789987343999999999886039999999999999-----9973994799984767647-----------79


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222233322100000012333---222222222222233322222222222222222222222222233221133222
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVED  228 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D  228 (358)
                      -..+.|+.||.+..-+.+..+.+   +|+++..+-|+.|-=|          |+.    |.+...      ....+..+|
T Consensus       145 p~~~~Y~ASK~av~g~t~sLa~El~~~gIrVn~V~PG~v~T~----------m~~----g~~~~~------~~~~~~pe~  204 (273)
T PRK07825        145 PGMATYCASKHAVVGLTDALRLELRPTGVHVSVVLPTFVNTE----------LIA----GTKGAK------GLKNAEPED  204 (273)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCC----------CCC----CCCCCC------CCCCCCHHH
T ss_conf             998359999999999999999985230959999970999856----------579----998766------889999999


Q ss_pred             CCCCEEECCCCCCC
Q ss_conf             20000000122222
Q gi|254780920|r  229 HVRALYLVLKKGRI  242 (358)
Q Consensus       229 ~a~~i~~~~~~~~~  242 (358)
                      +|+++..++++++.
T Consensus       205 vA~~iv~~i~~~~~  218 (273)
T PRK07825        205 VAAAIVALVAKPRP  218 (273)
T ss_pred             HHHHHHHHHHCCCC
T ss_conf             99999999968998


No 190
>PRK06139 short chain dehydrogenase; Provisional
Probab=99.35  E-value=1.9e-12  Score=95.41  Aligned_cols=212  Identities=15%  Similarity=0.088  Sum_probs=135.2

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHH-HHH-CCCCEEEEECCCCCHHHHHHHHHH-----CCCC
Q ss_conf             899767882779999999986898799994788765856777-620-379749997638899999999862-----2787
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLK-EIS-QSNLFSFLQVDICDRECIRSALKE-----FQPD   75 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~-~~~-~~~~v~~i~~Di~d~~~l~~~~~~-----~~~d   75 (358)
                      ||||||++=||..+++.|.++ |++|+..++....  ..... ++. ....+..+.+|++|.++++.+++.     ..+|
T Consensus         9 vlITGASsGIG~aiA~~~A~~-Ga~Vvl~~R~~~~--L~~~a~e~~~~G~~~~~v~~DVsd~~~v~~~~~~~~~~~G~ID   85 (324)
T PRK06139          9 VVITGASSGIGRATAEAFARR-GARLVLAARDEEA--LFEVAEECRALGAEVLVVPTDVTHADQVQALATQAASFLGRID   85 (324)
T ss_pred             EEEECHHHHHHHHHHHHHHHC-CCEEEEEECCHHH--HHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCC
T ss_conf             999382549999999999987-9989999899999--9999999995499489997667885789999999999749987


Q ss_pred             EEEEECCCCCCCCCC----CCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             178512343322222----2222222222222202478886512322112478427863055431122222222222222
Q gi|254780920|r   76 AIVNFAAESHVDRSI----LGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPY  151 (358)
Q Consensus        76 ~ViHlAa~~~~~~~~----~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~  151 (358)
                      ++||.|+........    ++-...+++|+.|+.++..++.-.     ..+.+.-+||.+||.+-+-..           
T Consensus        86 iLVNNAGi~~~g~~~e~~~e~~~~vi~vNl~G~~~~~~aalp~-----M~~~g~G~IINisS~ag~~~~-----------  149 (324)
T PRK06139         86 VWFNNVGVGAVGRFEETPLEAHEQVIQTNLIGYLRDAHAALPI-----FKAQGHGIFINMISLGGFAAQ-----------  149 (324)
T ss_pred             EEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEEECCHHHHCCC-----------
T ss_conf             8864575577775355999999999999869999999999999-----986599189997363241369-----------


Q ss_pred             CCCCCCCCCCCCCEEEECCCCC---CC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222223332210000001233---32-222222222222333222222222222222-222222222222332211332
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGH---TY-GIPVLLSNCSNNYGPYHFPEKLIPLAITRM-IEGSHVFLYGDGQNVRDWLYV  226 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~---~~-~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~-~~g~~~~i~g~g~~~Rdfi~v  226 (358)
                      --.+.|+.||.+.+-+.+..+.   .+ ++.++.+-|+.|=-|.         |-+.. ..|..+....      +...-
T Consensus       150 P~~saY~ASK~Av~gftesLr~EL~~~~gI~Vt~V~Pg~v~TP~---------~~~~~~~~~~~~~~~~------p~~~p  214 (324)
T PRK06139        150 PYAAAYSASKFGLRGFSEALRAELTDFPDIHVCDVYPAFVDTPG---------FRHGANYTGRRLTPPP------PMYDP  214 (324)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCC---------CHHHHHCCCCCCCCCC------CCCCH
T ss_conf             99841989999999999999998379989189998579958852---------0143533787889999------98799


Q ss_pred             CCCCCCEEECCCCCCCCCCCCCCC
Q ss_conf             222000000012222222111357
Q gi|254780920|r  227 EDHVRALYLVLKKGRIGERYNIGG  250 (358)
Q Consensus       227 ~D~a~~i~~~~~~~~~~~~fNigs  250 (358)
                      +.+|++++.+.+++.. +++ +|.
T Consensus       215 e~vA~ai~~~~~~~~r-~~~-vG~  236 (324)
T PRK06139        215 RRVAKAMVRLADRPRN-TTT-VGT  236 (324)
T ss_pred             HHHHHHHHHHHHCCCC-EEE-CCH
T ss_conf             9999999999838997-254-186


No 191
>PRK08945 short chain dehydrogenase; Provisional
Probab=99.35  E-value=2.3e-12  Score=94.85  Aligned_cols=199  Identities=13%  Similarity=0.096  Sum_probs=123.0

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHH-HHHH--CCCCEEEEECCC--CCHHHHHHHHHH----C
Q ss_conf             489976788277999999998689879999478876585677-7620--379749997638--899999999862----2
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSL-KEIS--QSNLFSFLQVDI--CDRECIRSALKE----F   72 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~-~~~~--~~~~v~~i~~Di--~d~~~l~~~~~~----~   72 (358)
                      .||||||++=||..+++.|+++ |++|+.+++...  ..... +++.  ..+...++.+|+  .+.+.++++++.    +
T Consensus        15 ~~lITGas~GIG~aiA~~la~~-Ga~Vil~~r~~~--~l~~~~~el~~~~~~~~~~~~~d~~~~~~~~~~~~~~~i~~~~   91 (245)
T PRK08945         15 IILVTGAGDGIGREAALTYARH-GATVILLGRTEE--KLEAVYDEIEAAGGPQPAIIPLDLLGATEQNYQDLADTIEEQF   91 (245)
T ss_pred             EEEEECCCHHHHHHHHHHHHHC-CCEEEEEECCHH--HHHHHHHHHHHCCCCCEEEEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             8999488618999999999987-998999969889--9999999999747984489994467599999999999999980


Q ss_pred             -CCCEEEEECCCCCCCC-----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCC
Q ss_conf             -7871785123433222-----2222222222222222024788865123221124784278630554311222222222
Q gi|254780920|r   73 -QPDAIVNFAAESHVDR-----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFS  146 (358)
Q Consensus        73 -~~d~ViHlAa~~~~~~-----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~  146 (358)
                       ++|+++|.|+..+...     +.++....+++|+.|+..+..++....     .+.+.-++|++||..-..        
T Consensus        92 g~iD~lVnNAG~~~~~~~~~~~~~~~~~~~~~vNl~g~~~l~~~~~p~m-----~~~~~G~Ii~isS~~g~~--------  158 (245)
T PRK08945         92 GRLDGVLHNAGLLGELGPMEQQDPEVWQDVMQVNVNATFMLTQALLPLL-----LKSPAASLVFTSSSVGRQ--------  158 (245)
T ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHCCCCEEEEECCHHHCC--------
T ss_conf             9987999888755789882669999999987567599999999999999-----877997899978621067--------


Q ss_pred             CCCCCCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222222233322100000012333---2222222222222333222222222222222222222222222332211
Q gi|254780920|r  147 EDMPYNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDW  223 (358)
Q Consensus       147 E~~~~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdf  223 (358)
                         +....++|+.||.+.+.+.+..+.+   +|+++..+-|+.+--+.          ..+...+++..-         +
T Consensus       159 ---~~~~~~~Y~asKaal~~lt~~la~El~~~gIrVN~I~PG~v~T~m----------~~~~~~~~~~~~---------~  216 (245)
T PRK08945        159 ---GRAFWGAYAVSKFATEGMMQVLADEYQGTNLRVNCINPGATRTAM----------RASAYPGEDPQK---------L  216 (245)
T ss_pred             ---CCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHH----------HHHCCCCCCHHH---------C
T ss_conf             ---888866899999999999999999857568499999728887741----------453189766332---------6


Q ss_pred             CCCCCCCCCEEECCC
Q ss_conf             332222000000012
Q gi|254780920|r  224 LYVEDHVRALYLVLK  238 (358)
Q Consensus       224 i~v~D~a~~i~~~~~  238 (358)
                      ...+|++.++..++.
T Consensus       217 ~~pedIa~~v~fL~S  231 (245)
T PRK08945        217 KTPEDIMPLYLYLMG  231 (245)
T ss_pred             CCHHHHHHHHHHHHC
T ss_conf             999999999999948


No 192
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional
Probab=99.34  E-value=1.2e-12  Score=96.57  Aligned_cols=225  Identities=13%  Similarity=0.065  Sum_probs=130.3

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHC--CCCEEEEECCCCCHHHHHHHHHHC-----CC
Q ss_conf             48997678827799999999868987999947887658567776203--797499976388999999998622-----78
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQ--SNLFSFLQVDICDRECIRSALKEF-----QP   74 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~--~~~v~~i~~Di~d~~~l~~~~~~~-----~~   74 (358)
                      ++|||||++-||+.+++.|++. |.+|+...+.....-....+++..  ..+..++++|++|++.++++++..     ++
T Consensus        10 ~alVTGgs~GIG~aia~~la~~-Ga~V~i~~~~~~~~~~~~~~~l~~~~g~~~~~~~~Dv~~~~~~~~~~~~i~~~~g~i   88 (260)
T PRK08416         10 TLVISGGTRGIGKAIVYEFAQS-GVNIAFTYNSNVEEADKIAQDLEKKYGIKARAYPLNILEPETYKELFKKIDADFDRV   88 (260)
T ss_pred             EEEEECCCHHHHHHHHHHHHHC-CCEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC
T ss_conf             8999673409999999999987-999999859988999999999988419836999778899999999999999981997


Q ss_pred             CEEEEECCCCCCCC--C--------CCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCC
Q ss_conf             71785123433222--2--------2222222222222220247888651232211247842786305543112222222
Q gi|254780920|r   75 DAIVNFAAESHVDR--S--------ILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGL  144 (358)
Q Consensus        75 d~ViHlAa~~~~~~--~--------~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~  144 (358)
                      |+++|.|+......  .        ..+....++.|+.+.......+..     ...+.+.-++|++||......     
T Consensus        89 DilVnnA~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~m~~~~~GsIv~isS~~~~~~-----  158 (260)
T PRK08416         89 DFFISNAIISGRAVVGGYTKFMRLKPKGLNNIYTATVLAFVVGAQEAAK-----RMEKVGGGSIISLSSTGNLVY-----  158 (260)
T ss_pred             CEEEECCEECCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHH-----HHHHHCCEEEEEECCCCCCCC-----
T ss_conf             8998643422764235777466598999999999998999999999999-----999709908999765445667-----


Q ss_pred             CCCCCCCCCCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222222222333221000000123332---2222222222223332222222222222222222222222223322
Q gi|254780920|r  145 FSEDMPYNPSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVR  221 (358)
Q Consensus       145 ~~E~~~~~p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~R  221 (358)
                            ......|+.||.+.+.+.+..+.++   |+++-++-|+.+-.+......-.+.+.....+.-|+         +
T Consensus       159 ------~~~~~~Y~asKaal~~ltr~lA~ela~~gIrVN~I~PG~i~T~~~~~~~~~~~~~~~~~~~~Pl---------~  223 (260)
T PRK08416        159 ------IENYAGHGTSKAAVEAMVRYAATELGEKNIRVNAVSGGPIDTDALKAFTNYEEVKAKTEELSPL---------N  223 (260)
T ss_pred             ------CCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCHHHHCCCCHHHHHHHHHHCCCC---------C
T ss_conf             ------9851778988889999999999998455959999973779866665169849999999857998---------9


Q ss_pred             CCCCCCCCCCCEEECCCC---CCCCCCCCCCCCC
Q ss_conf             113322220000000122---2222211135786
Q gi|254780920|r  222 DWLYVEDHVRALYLVLKK---GRIGERYNIGGNN  252 (358)
Q Consensus       222 dfi~v~D~a~~i~~~~~~---~~~~~~fNigs~~  252 (358)
                      -+...+|++.++..++..   ...|+++.+.+|-
T Consensus       224 R~g~pediA~~v~fL~S~~ss~iTG~~i~VDGG~  257 (260)
T PRK08416        224 RMGQPEDLAGACLFLCSEKASWLTGQTIIVDGGT  257 (260)
T ss_pred             CCCCHHHHHHHHHHHHCCHHCCCCCCEEEECCCE
T ss_conf             9819999999999994854268659838989775


No 193
>PRK12747 short chain dehydrogenase; Provisional
Probab=99.34  E-value=8.4e-13  Score=97.54  Aligned_cols=222  Identities=16%  Similarity=0.127  Sum_probs=138.0

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH-CCCCEEEEECCCCCHHHHHHHHHH---------
Q ss_conf             4899767882779999999986898799994788765856777620-379749997638899999999862---------
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS-QSNLFSFLQVDICDRECIRSALKE---------   71 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~-~~~~v~~i~~Di~d~~~l~~~~~~---------   71 (358)
                      .+|||||++=||..+++.|+++ |++|...+.............+. .......+.+|+++.+.++.+++.         
T Consensus         6 valITGas~GIG~aiA~~la~~-Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~   84 (252)
T PRK12747          6 VALVTGASRGIGRAIAKRLAND-GALVAIHYGNRKEEAEETVYEIQSNGGSAFSIGANLESLHGVEALYSSLDNELQKRT   84 (252)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             9999484778999999999987-999999659987899999999996499579983363567999999999999999842


Q ss_pred             --CCCCEEEEECCCCCCC----CCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCC
Q ss_conf             --2787178512343322----2222222222222222202478886512322112478427863055431122222222
Q gi|254780920|r   72 --FQPDAIVNFAAESHVD----RSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLF  145 (358)
Q Consensus        72 --~~~d~ViHlAa~~~~~----~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~  145 (358)
                        .++|+.++.|+.....    .+.++-...+++|+.|+..+..++-...      +.+ .++|.+||....-.      
T Consensus        85 g~~~iDiLVnnAG~~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~~~~m------~~~-g~IVnisS~~~~~~------  151 (252)
T PRK12747         85 GSTKFDILINNAGIGPGAFIEETTEQFFDRMVSVNAKAPFFIIQQALSRL------RDN-SRIINISSAATRIS------  151 (252)
T ss_pred             CCCCCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH------HHC-CCCCEEEECCCCCC------
T ss_conf             89981089989999999881349999999999997568999999999999------766-97508985111268------


Q ss_pred             CCCCCCCCCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222222222333221000000123332---2222222222223332222222222-222222222222222223322
Q gi|254780920|r  146 SEDMPYNPSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIPL-AITRMIEGSHVFLYGDGQNVR  221 (358)
Q Consensus       146 ~E~~~~~p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~~-~i~~~~~g~~~~i~g~g~~~R  221 (358)
                           .....+|+.||.+.+.+.+..++++   |+++-.+.|+.+-.|...  ...+. ..++.....+      +  .+
T Consensus       152 -----~~~~~~Y~asKaav~~ltr~lA~ela~~gIrVNaV~PG~i~T~~~~--~~~~~~~~~~~~~~~~------p--~~  216 (252)
T PRK12747        152 -----LPDFIAYSMTKGAINTMTFTLAKQLGARGITVNAILPGFIKTDMNA--ELLSDPMMKQYATTIS------A--FN  216 (252)
T ss_pred             -----CCCCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCHH--HHCCCHHHHHHHHCCC------C--CC
T ss_conf             -----8972778999999999999999997333959988877759873221--1127899999986478------8--79


Q ss_pred             CCCCCCCCCCCEEECCCC---CCCCCCCCCCCCC
Q ss_conf             113322220000000122---2222211135786
Q gi|254780920|r  222 DWLYVEDHVRALYLVLKK---GRIGERYNIGGNN  252 (358)
Q Consensus       222 dfi~v~D~a~~i~~~~~~---~~~~~~fNigs~~  252 (358)
                      -+...+|+|+++..++..   ...|+++.|.+|.
T Consensus       217 R~g~p~dvA~~v~fL~S~~a~~iTG~~i~VDGG~  250 (252)
T PRK12747        217 RLGEVEDIADTAAFLASPDSRWVTGQLIDVSGGS  250 (252)
T ss_pred             CCCCHHHHHHHHHHHHCCHHCCCCCCEEEECCCC
T ss_conf             9859999999999995844338228837489887


No 194
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional
Probab=99.34  E-value=1.1e-12  Score=96.90  Aligned_cols=230  Identities=14%  Similarity=0.092  Sum_probs=142.5

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHH-----CCCCE
Q ss_conf             89976788277999999998689879999478876585677762-0379749997638899999999862-----27871
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEI-SQSNLFSFLQVDICDRECIRSALKE-----FQPDA   76 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~-~~~~~v~~i~~Di~d~~~l~~~~~~-----~~~d~   76 (358)
                      +|||||++=||+.+++.|+++ |.+|+..|+.... -......+ ....++.++++|++|.+.++++++.     .++|+
T Consensus        10 alVTGgs~GIG~a~A~~la~~-Ga~V~i~~~~~~~-~~~~~~~i~~~g~~~~~~~~Dvt~~~~v~~~v~~~~~~~G~iDi   87 (262)
T PRK13394         10 AVVTGAASGIGKEIALELARA-GAAVAIADLNQDG-ANAVADEINKAGGKAIGVAMDVTNEDAVNAGIDKVAERFGSVDI   87 (262)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHH-HHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             999585778999999999987-9999999798899-99999999962993999981589999999999999998199999


Q ss_pred             EEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCC-CCCCCCCCCCCCCCC
Q ss_conf             785123433222----222222222222222202478886512322112478427863055431-122222222222222
Q gi|254780920|r   77 IVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEV-YGSLDKGLFSEDMPY  151 (358)
Q Consensus        77 ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~v-Yg~~~~~~~~E~~~~  151 (358)
                      ++|.|+......    ..++....+++|+.|+..+..++.....    ...+.-++|++||... .|.            
T Consensus        88 LVnnAG~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~p~M~----k~~~~G~IVnisS~~~~~~~------------  151 (262)
T PRK13394         88 LVSNAGIQIVNPIENYSFADWKKMQAIHVDGAFLTTKAALKHMY----KDDRGGVVIYMGSVHSHEAS------------  151 (262)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHCCCCEEEEECCHHHCCCC------------
T ss_conf             99899889999916599999999999975899999999999999----83799689997457767679------------


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCC-C-CCCCCCCCCCCCCC
Q ss_conf             22222233322100000012333---22222222222223332222222222222222-2222-2-22222233221133
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMI-EGSH-V-FLYGDGQNVRDWLY  225 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~-~g~~-~-~i~g~g~~~Rdfi~  225 (358)
                      ...+.|+.||.+...+.+..+.+   +++++-.+-|+.+-.|.-  ...++..-...- .-+. . ..+.+.....-+..
T Consensus       152 ~~~~~Y~asKaal~~ltk~lA~E~a~~gIrVN~V~PG~i~T~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~r~g~  229 (262)
T PRK13394        152 PLKSAYVTAKHGLLGLARVLAKEGAKHNVRSHVVCPGFVRTPLV--DKQIPEQAKELGISEEEVVKKVMLGKTVDGVFTT  229 (262)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCHH--HHHCHHHHHHCCCCHHHHHHHHHHCCCCCCCCCC
T ss_conf             99768999999999999999998523196999997587887023--3136557876378858999999861799889729


Q ss_pred             CCCCCCCEEECCCC---CCCCCCCCCCCCC
Q ss_conf             22220000000122---2222211135786
Q gi|254780920|r  226 VEDHVRALYLVLKK---GRIGERYNIGGNN  252 (358)
Q Consensus       226 v~D~a~~i~~~~~~---~~~~~~fNigs~~  252 (358)
                      .+|++.++..+...   ...|+++.+.+|-
T Consensus       230 p~dvA~~v~fLaS~~a~~iTG~~i~VDGG~  259 (262)
T PRK13394        230 VEDVAQTVLFLSAFPSAALTGQSFVVSHGW  259 (262)
T ss_pred             HHHHHHHHHHHHCHHHCCCCCCEEEECCCH
T ss_conf             999999999993857569169728989276


No 195
>PRK06194 hypothetical protein; Provisional
Probab=99.33  E-value=4.3e-12  Score=93.21  Aligned_cols=171  Identities=12%  Similarity=0.039  Sum_probs=112.3

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHH-HHHH-CCCCEEEEECCCCCHHHHHHHHHHC-----CCC
Q ss_conf             89976788277999999998689879999478876585677-7620-3797499976388999999998622-----787
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSL-KEIS-QSNLFSFLQVDICDRECIRSALKEF-----QPD   75 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~-~~~~-~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d   75 (358)
                      +|||||++=||..+++.|+++ |++|+..|+....  .... ..+. ....+..+.+|++|.+.++++++..     .+|
T Consensus         9 avITGassGIG~a~A~~la~~-Ga~Vvl~d~~~~~--l~~~~~~l~~~g~~v~~~~~DVsd~~~v~~l~~~~~~~fG~iD   85 (301)
T PRK06194          9 AVITGAASGFGREFARIGARL-GMKLVLADVQQDA--LDRAVAELRAQGAEVLGVRTDVSDAAQVEALADAALERFGAVH   85 (301)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHH--HHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCEE
T ss_conf             999273779999999999987-9989999798899--9999999984598499996568999999999999999839937


Q ss_pred             EEEEECCCCCCCCC----CCCCCCCCCCCCCCCCHHHHHHHHHCCCCCC-CCCCCEEEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             17851234332222----2222222222222220247888651232211-247842786305543112222222222222
Q gi|254780920|r   76 AIVNFAAESHVDRS----ILGADEFITTNIIGTFILLEETRLWWSCLSQ-DKKDQFRFLQISTDEVYGSLDKGLFSEDMP  150 (358)
Q Consensus        76 ~ViHlAa~~~~~~~----~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~-~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~  150 (358)
                      ++++.|+.......    .++....+++|+.|+.++..++.-....... .....-++|.+||.+-+-..          
T Consensus        86 iLVNNAGi~~~~~~~e~~~edw~~v~~VNl~G~~~~~r~~lP~M~~~~~~~~~~~G~IVNisSiaG~~~~----------  155 (301)
T PRK06194         86 LLFNNAGVGAGGLLWENSLADWEWVLGVNLMGVIHGVRIFTPLMLAAAEKDPAYEGHIVNTASMAGLLAP----------  155 (301)
T ss_pred             EEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCHHHCCCC----------
T ss_conf             9995576678887344999999999999819999999999999997688788986499994542323589----------


Q ss_pred             CCCCCCCCCCCCCCEEEECCCCC-----CCCCCCCCCCCCCC
Q ss_conf             22222223332210000001233-----32222222222222
Q gi|254780920|r  151 YNPSSPYSATKASSDYLVLAWGH-----TYGIPVLLSNCSNN  187 (358)
Q Consensus       151 ~~p~s~Yg~sK~~~E~~~~~~~~-----~~~l~~~ilR~~~v  187 (358)
                       -..+.|+.||.+..-+.+..+.     .+++++..+=|+.|
T Consensus       156 -p~~~~Y~ASK~AV~glT~sLa~EL~~~~~~IrV~~lcPG~V  196 (301)
T PRK06194        156 -PAMGVYNVSKHAVVSLTETLYQDLRLVTDQVGASVLCPYFV  196 (301)
T ss_pred             -CCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCC
T ss_conf             -99707899999999999999999975697979999972888


No 196
>PRK06484 short chain dehydrogenase; Validated
Probab=99.33  E-value=1.9e-12  Score=95.34  Aligned_cols=216  Identities=19%  Similarity=0.190  Sum_probs=134.7

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             8997678827799999999868987999947887658567776203797499976388999999998622-----78717
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEF-----QPDAI   77 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d~V   77 (358)
                      +|||||++=||+.+++.|+++ |++|+..|+.... -....+.+  ......+++|++|.+.++++++..     ++|++
T Consensus         8 alVTGas~GIG~aiA~~la~~-Ga~V~~~dr~~~~-~~~~~~~~--g~~~~~~~~Dvsd~~~v~~~v~~~~~~~G~iDiL   83 (530)
T PRK06484          8 VLVTGAAGGIGRACCQRFARA-GDRVVMADRDLAA-CTEEAERL--GSRHVALQLDVSDEAQVEHAMDGLLQQFGRIDVL   83 (530)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHH-HHHHHHHC--CCCCEEEEEECCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             999783668999999999987-9999999688899-99999970--9971799984899999999999999972999899


Q ss_pred             EEECCCCCC-----CCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCC-CCCCCCCCCCCCCCC
Q ss_conf             851234332-----22222222222222222202478886512322112478427863055431-122222222222222
Q gi|254780920|r   78 VNFAAESHV-----DRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEV-YGSLDKGLFSEDMPY  151 (358)
Q Consensus        78 iHlAa~~~~-----~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~v-Yg~~~~~~~~E~~~~  151 (358)
                      +|.|+....     +...++....+++|+.|+.++..++....     .+.+ -++|.+||..- .|.            
T Consensus        84 VNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~f~~~~~~~p~m-----~~~g-g~IInisS~~g~~~~------------  145 (530)
T PRK06484         84 VNNAGIGPTMRATLDTPLEDFDRAIAVNLEGPYLVAREALRLM-----GRHG-AAIVNVASLAGLVAN------------  145 (530)
T ss_pred             EECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHC-CEEEEEEECCCCCCC------------
T ss_conf             9899899889861009999999999987299999999999987-----7625-738999833104579------------


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCC--CCC-CCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222333221000000123332---22222222222233322222222--222-222222222222222233221133
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLI--PLA-ITRMIEGSHVFLYGDGQNVRDWLY  225 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i--~~~-i~~~~~g~~~~i~g~g~~~Rdfi~  225 (358)
                      .....|+.||.+...+.+..+.++   |+++-.+-|+.|--|.-.  .+.  +.. ...+...-|+.-         +-.
T Consensus       146 ~~~~~Y~asKaal~~lTkslA~Ela~~gIRVNaVaPG~I~T~m~~--~~~~~~~~~~~~~~~~iPlgR---------~g~  214 (530)
T PRK06484        146 PKRAAYSASKAGVISLTRSLACELAPKGIRVNAVAPGYVRTEMVA--ELERAGKLDRSAVRGRIPMGR---------LAR  214 (530)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCHHH--HHHHCCHHHHHHHHCCCCCCC---------CCC
T ss_conf             996889999999999999999986340949999963788871143--331056447999971799888---------789


Q ss_pred             CCCCCCCEEECCC-C--CCCCCCCCCCCC
Q ss_conf             2222000000012-2--222221113578
Q gi|254780920|r  226 VEDHVRALYLVLK-K--GRIGERYNIGGN  251 (358)
Q Consensus       226 v~D~a~~i~~~~~-~--~~~~~~fNigs~  251 (358)
                      .+|+|.++..+.. .  ...|+++.+-+|
T Consensus       215 PeeiA~~v~FLaSd~asyITG~~i~VDGG  243 (530)
T PRK06484        215 PDEIAEAVHFLASAQASYITGSTLVVDGG  243 (530)
T ss_pred             HHHHHHHHHHHCCHHHCCCCCCEEEEECC
T ss_conf             99999999997683325888987998389


No 197
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated
Probab=99.33  E-value=3.5e-12  Score=93.77  Aligned_cols=223  Identities=14%  Similarity=0.050  Sum_probs=133.5

Q ss_pred             EEEEECCCC--HHHHHHHHHHHHHCCCEEEEEECCCCCCC-HHHHHHHHCC-CCEEEEECCCCCHHHHHHHHHHC-----
Q ss_conf             489976788--27799999999868987999947887658-5677762037-97499976388999999998622-----
Q gi|254780920|r    2 RLIVTGGAG--FIGSALCRYLVNDLKIQVLVIDKLTYAGN-LNSLKEISQS-NLFSFLQVDICDRECIRSALKEF-----   72 (358)
Q Consensus         2 kILItG~tG--fIGs~l~~~Ll~~~~~~V~~~d~~~~~~~-~~~~~~~~~~-~~v~~i~~Di~d~~~l~~~~~~~-----   72 (358)
                      ++|||||+|  =||..+++.|.+. |.+|...+......+ ....+++... ....++++|++|.+.++++++..     
T Consensus         9 ~alVTGaag~~GiG~aia~~la~~-GA~V~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dvs~~~~v~~~~~~~~~~~G   87 (259)
T PRK07370          9 KALVTGIANNRSIAWGIAQQLHAA-GAELGITYLPDEKGRFEKKVRELTEPLNPSLFLPCNVQDDAQIEEVFETIKQKWG   87 (259)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHC-CCEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHC
T ss_conf             899979899857999999999986-9999999478701358999999984128648999128999999999999999858


Q ss_pred             CCCEEEEECCCCCCCC--------CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCC
Q ss_conf             7871785123433222--------22222222222222220247888651232211247842786305543112222222
Q gi|254780920|r   73 QPDAIVNFAAESHVDR--------SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGL  144 (358)
Q Consensus        73 ~~d~ViHlAa~~~~~~--------~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~  144 (358)
                      ++|+++|.|+......        ..++-...+++|+.+...+..++...      ...+ -++|.+||..-..     +
T Consensus        88 ~iDilVnna~~~~~~~~~~~~~~~~~~~~~~~~~vn~~~~~~~~~~~~~~------~~~~-g~Ii~iss~~~~~-----~  155 (259)
T PRK07370         88 QLDILVHCLAFAGKEELSGDFSATSREGFARALEISAYSLAPLCRAAKPL------MSEG-GSIVTLTYLGGVR-----A  155 (259)
T ss_pred             CCCEEEEEECCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH------HCCC-CCEEEEEEECCCC-----C
T ss_conf             98779863011464336799255999999999999879999999999886------0458-8531278741354-----6


Q ss_pred             CCCCCCCCCCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222222222333221000000123332---2222222222223332222222222222222222222222223322
Q gi|254780920|r  145 FSEDMPYNPSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVR  221 (358)
Q Consensus       145 ~~E~~~~~p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~R  221 (358)
                            ....+.|+.+|.+.+.+.+..+.++   |+++-.+.|+.+--+......-.+.++....+.-|+.         
T Consensus       156 ------~~~~~~y~asKaal~~ltr~lA~ela~~gIrVN~I~PG~i~T~~~~~~~~~~~~~~~~~~~~Pl~---------  220 (259)
T PRK07370        156 ------IPNYNVMGVAKAALEASVRYLAAELGPENIRVNAISAGPIRTLASSAVGGILDMIHHVEEKAPLR---------  220 (259)
T ss_pred             ------CCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCHHHCCCCCHHHHHHHHHCCCCC---------
T ss_conf             ------78852058899999999999999837188799998636685512220367299999998579989---------


Q ss_pred             CCCCCCCCCCCEEECCCC---CCCCCCCCCCCCC
Q ss_conf             113322220000000122---2222211135786
Q gi|254780920|r  222 DWLYVEDHVRALYLVLKK---GRIGERYNIGGNN  252 (358)
Q Consensus       222 dfi~v~D~a~~i~~~~~~---~~~~~~fNigs~~  252 (358)
                      -+...+|++.++..++..   ...|+++.+.+|-
T Consensus       221 R~g~peeiA~~v~FL~Sd~s~~iTG~~i~VDGG~  254 (259)
T PRK07370        221 RTVTQTEVGNTAAFLLSDLASGITGQTIYVDAGY  254 (259)
T ss_pred             CCCCHHHHHHHHHHHHCCHHCCCCCCEEEECCCC
T ss_conf             9939999999999995845257438718979691


No 198
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=99.33  E-value=2.5e-12  Score=94.61  Aligned_cols=224  Identities=17%  Similarity=0.087  Sum_probs=134.8

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             89976788277999999998689879999478876585677762-03797499976388999999998622-----7871
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEI-SQSNLFSFLQVDICDRECIRSALKEF-----QPDA   76 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~-~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d~   76 (358)
                      +|||||+.=||..++..|.++ |++|+...+.....-..-.+.+ .......++++|+++.+++++++...     ++|+
T Consensus         6 alITGgs~GIG~aiA~~la~~-Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvs~~~~v~~~~~~~~~~~g~iDi   84 (249)
T PRK06077          6 VVVTGSGRGIGRAIAVRLAKE-GAKVVVNAKKRAEEMNETLRMVKEYGGEGIGVLADVSTREGCRTLAKAALDNFGVVDI   84 (249)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             999263678999999999987-9989998488768999999999975995899984799999999999999998199888


Q ss_pred             EEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             785123433222----2222222222222222024788865123221124784278630554311222222222222222
Q gi|254780920|r   77 IVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYN  152 (358)
Q Consensus        77 ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~  152 (358)
                      ++|.|+......    ..++-...+++|+.|+..+..++....      +.+ -++|.+||..-+.           +..
T Consensus        85 LVnNAG~~~~~~~~~~~~~~~~~~~~vN~~~~~~~~~~~~~~m------~~~-G~IInisS~~~~~-----------~~~  146 (249)
T PRK06077         85 LVNNAGLGLFSPFLNADDRLIEKHISTDLKSVIYCSQEAAKVM------REG-GEIINIASIAGIR-----------PFV  146 (249)
T ss_pred             EEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH------HCC-CEEEECCCHHHCC-----------CCC
T ss_conf             9985775788750109999999999886218999999999996------169-7899826765456-----------899


Q ss_pred             CCCCCCCCCCCCEEEECCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222223332210000001233322--222222222223332222222222222222222222222223322113322220
Q gi|254780920|r  153 PSSPYSATKASSDYLVLAWGHTYG--IPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV  230 (358)
Q Consensus       153 p~s~Yg~sK~~~E~~~~~~~~~~~--l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~a  230 (358)
                      ....|+.||.+...+.+..+.+++  +++-.+-|+.+--|..      ..+....-.... ..........-+...+|++
T Consensus       147 ~~~~Y~asKaal~~ltr~lA~ela~~IrVN~V~PG~i~T~~~------~~~~~~~~~~~~-~~~~~~~~~~R~~~peeia  219 (249)
T PRK06077        147 GLSIYGAMKAAVINLTQYLALELAPRIRVNAVAPGVVKTKMG------ESLVKLLGMTEE-EFAKKHTLTGKILDPEDVA  219 (249)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHH------HHHHHCCCCCHH-HHHHCCCCCCCCCCHHHHH
T ss_conf             977899999999999999999986998899998468987425------555540486789-9986079878973999999


Q ss_pred             CCEEECCCC-CCCCCCCCCCCCC
Q ss_conf             000000122-2222211135786
Q gi|254780920|r  231 RALYLVLKK-GRIGERYNIGGNN  252 (358)
Q Consensus       231 ~~i~~~~~~-~~~~~~fNigs~~  252 (358)
                      +++..++.. ...|+++.+-+|.
T Consensus       220 ~~v~fLas~~~iTGq~i~VDGG~  242 (249)
T PRK06077        220 ELVWALVKIESITGQVIVIDSGE  242 (249)
T ss_pred             HHHHHHHCCCCCCCCEEEECCCH
T ss_conf             99999964589998838868265


No 199
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=99.32  E-value=2.3e-12  Score=94.84  Aligned_cols=217  Identities=19%  Similarity=0.199  Sum_probs=135.9

Q ss_pred             EEEECCCC--HHHHHHHHHHHHHCCCEEEEEECCCCCC------CHH---HH-HHH-HCCCCEEEEECCCCCHHHHHHHH
Q ss_conf             89976788--2779999999986898799994788765------856---77-762-03797499976388999999998
Q gi|254780920|r    3 LIVTGGAG--FIGSALCRYLVNDLKIQVLVIDKLTYAG------NLN---SL-KEI-SQSNLFSFLQVDICDRECIRSAL   69 (358)
Q Consensus         3 ILItG~tG--fIGs~l~~~Ll~~~~~~V~~~d~~~~~~------~~~---~~-~~~-~~~~~v~~i~~Di~d~~~l~~~~   69 (358)
                      +|||||++  =||..+++.|++. |++|+..++.....      ...   .+ +.+ .....+..+++|+++.+.++.++
T Consensus         9 alVTGas~~~GIG~aiA~~la~~-Ga~Vvi~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dl~~~~~~~~~i   87 (257)
T PRK12859          9 AVVTGVSRLDGIGAAICKELAEA-GYDIFFTYWTAYDKEMPWGVDQSEQIQLQEELLKNGVKVSSMELDLTQNDAPKELI   87 (257)
T ss_pred             EEEECCCCCCCHHHHHHHHHHHC-CCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHH
T ss_conf             99928899986299999999987-99899983652011123453757999999999954985999983589999999999


Q ss_pred             HH----C-CCCEEEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCC
Q ss_conf             62----2-7871785123433222----2222222222222222024788865123221124784278630554311222
Q gi|254780920|r   70 KE----F-QPDAIVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSL  140 (358)
Q Consensus        70 ~~----~-~~d~ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~  140 (358)
                      ..    + .+|+++|.|+......    +.++....+++|+.++..+..++...     ..+.+.-++|.+||...+.. 
T Consensus        88 ~~~~~~~g~iDilVnnAg~~~~~~~~~~~~e~~~~~~~vN~~~~~~~~~~~~~~-----m~~~~~G~IInisS~~~~~~-  161 (257)
T PRK12859         88 NKVTEQLGYPHILINNAAYSTNNDFSNLTAEELDKHYMVNIRATTLLSSQFARG-----FDKKSGGRIVNMTSGQFQGP-  161 (257)
T ss_pred             HHHHHHCCCCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEEEECHHHHCC-
T ss_conf             999998299989998999999999055999999999999835789999999998-----75537953999942686076-


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCC
Q ss_conf             22222222222222222333221000000123332---222222222222333222222222222222-22222222222
Q gi|254780920|r  141 DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIPLAITRM-IEGSHVFLYGD  216 (358)
Q Consensus       141 ~~~~~~E~~~~~p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~-~~g~~~~i~g~  216 (358)
                                .....+|+.||.+.+.+.+.++.++   |+++-.+-|+.+--+      .++.-+.+. ...-|+.-   
T Consensus       162 ----------~~~~~~Y~asKaal~~ltrslA~ela~~gIrVN~V~PG~~~T~------~~~~~~~~~~~~~~Pl~R---  222 (257)
T PRK12859        162 ----------MVGELAYATTKGAIDALTSTLSAEVAHLGITVNAINPGPTDTG------WMTEEIKQGLKPMFPFGR---  222 (257)
T ss_pred             ----------CCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCC------CCCHHHHHHHHHCCCCCC---
T ss_conf             ----------8761778999999999999999998551918999976878978------779999998985799899---


Q ss_pred             CCCCCCCCCCCCCCCCEEECCCC---CCCCCCCCCCCC
Q ss_conf             23322113322220000000122---222221113578
Q gi|254780920|r  217 GQNVRDWLYVEDHVRALYLVLKK---GRIGERYNIGGN  251 (358)
Q Consensus       217 g~~~Rdfi~v~D~a~~i~~~~~~---~~~~~~fNigs~  251 (358)
                            +.-.+|+|.++..++..   ...|+++.|.+|
T Consensus       223 ------~g~pediA~~v~FL~S~~a~~iTGq~i~VDGG  254 (257)
T PRK12859        223 ------IGEPKDAARLIKFLVSEEAEWITGQVIHSEGG  254 (257)
T ss_pred             ------CCCHHHHHHHHHHHHCCHHCCEECCEEEECCC
T ss_conf             ------85999999999999585525861875896879


No 200
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional
Probab=99.32  E-value=4.7e-12  Score=92.95  Aligned_cols=221  Identities=12%  Similarity=0.012  Sum_probs=128.3

Q ss_pred             EEEEECCCC--HHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHH---HCCCCEEEEECCCCCHHHHHHHHHHC----
Q ss_conf             489976788--277999999998689879999478876585677762---03797499976388999999998622----
Q gi|254780920|r    2 RLIVTGGAG--FIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEI---SQSNLFSFLQVDICDRECIRSALKEF----   72 (358)
Q Consensus         2 kILItG~tG--fIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~---~~~~~v~~i~~Di~d~~~l~~~~~~~----   72 (358)
                      .+|||||+|  =||..+++.|.++ |.+|+..++...  ........   ....+..++++|++|.+.++++++..    
T Consensus         8 ~~lVTGaag~rGIG~aiA~~la~~-Ga~Vvi~~~~~~--~~~~~~~~~~~~~~~~~~~~~~Dvs~~~~v~~~~~~~~~~~   84 (256)
T PRK08594          8 TYVVMGVANKRSIAWGIARSLHNA-GAKLVFTYAGER--LEKEVRELAETLEQQESLVLPCDVTSDEEITACFETIKKEV   84 (256)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHC-CCEEEEECCCCH--HHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             899989999963999999999987-999999748806--69999999987079947999913899999999999999985


Q ss_pred             -CCCEEEEECCCCCCCCCCC---C--CC---CCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCC
Q ss_conf             -7871785123433222222---2--22---2222222222024788865123221124784278630554311222222
Q gi|254780920|r   73 -QPDAIVNFAAESHVDRSIL---G--AD---EFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKG  143 (358)
Q Consensus        73 -~~d~ViHlAa~~~~~~~~~---~--p~---~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~  143 (358)
                       .+|.++|+|+.........   +  ..   ..++.|..+...+..+++..      ... .-++|.+||....     .
T Consensus        85 g~id~lv~na~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~~~-~GsIv~iss~~~~-----~  152 (256)
T PRK08594         85 GVIHGVAHCIAFANKEDLRGEFLETSRDGFLLAQNISAYSLTAVAREAKKL------MTE-GGSIVTLTYLGGE-----R  152 (256)
T ss_pred             CCCCEEEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH------CCC-CCEEEEEEEECCE-----E
T ss_conf             886746653210234444553001889999998855436777888888765------357-8669985200111-----1


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222222222233322100000012333---2222222222222333222222222222222222222222222332
Q gi|254780920|r  144 LFSEDMPYNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNV  220 (358)
Q Consensus       144 ~~~E~~~~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~  220 (358)
                            +....+.|+.+|.+.+.+++..+.+   +|+++-++.|+.+..+......-.+.+...+.+.-|+.        
T Consensus       153 ------~~~~~~~y~asKaal~~ltr~lA~ela~~gIRVN~V~PG~i~T~~~~~~~~~~~~~~~~~~~~Pl~--------  218 (256)
T PRK08594        153 ------VVQNYNVMGVAKASLEASVKYLANDLGKDGIRVNAISAGPIRTLSAKGVGGFNSILKEIEERAPLR--------  218 (256)
T ss_pred             ------CCCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHHCCCCHHHHHHHHHCCCCC--------
T ss_conf             ------268741357789999999999999853888399998637787712331557399999999679999--------


Q ss_pred             CCCCCCCCCCCCEEECCCC---CCCCCCCCCCCCC
Q ss_conf             2113322220000000122---2222211135786
Q gi|254780920|r  221 RDWLYVEDHVRALYLVLKK---GRIGERYNIGGNN  252 (358)
Q Consensus       221 Rdfi~v~D~a~~i~~~~~~---~~~~~~fNigs~~  252 (358)
                       -+...+|+|.++..++..   ...|+++.+-+|-
T Consensus       219 -R~g~pediA~~v~fL~Sd~s~~iTGq~i~VDGG~  252 (256)
T PRK08594        219 -RTTTQEEVGDTAAFLFSDLSRGVTGENIHVDSGY  252 (256)
T ss_pred             -CCCCHHHHHHHHHHHHCCHHCCCCCCEEEECCCC
T ss_conf             -9969999999999995845248558728979598


No 201
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional
Probab=99.32  E-value=3.4e-12  Score=93.83  Aligned_cols=220  Identities=12%  Similarity=0.021  Sum_probs=126.8

Q ss_pred             EEEEECCCC--HHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC-----CC
Q ss_conf             489976788--27799999999868987999947887658567776203797499976388999999998622-----78
Q gi|254780920|r    2 RLIVTGGAG--FIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEF-----QP   74 (358)
Q Consensus         2 kILItG~tG--fIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~   74 (358)
                      .+|||||+|  =||..+++.|+++ |.+|+..++..  .....+... ..++..++++|++|.+.++++++..     ++
T Consensus         9 ~~lVTGaag~~GIG~a~A~~la~~-Ga~Vv~~~~~~--~~~~~~~~~-~~~~~~~~~~Dvs~~~~v~~~~~~~~~~~G~i   84 (252)
T PRK06079          9 KIVVMGVANKRSIAWGCAQAIKDQ-GATVIYTYQND--RMKKSLQKL-VDEEDLLVECDVASDESIERAFAQIKERFGKI   84 (252)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHC-CCEEEEEECCH--HHHHHHHHH-CCCCCEEEEEECCCHHHHHHHHHHHHHHHCCC
T ss_conf             899989999877999999999986-99999984887--999999985-08886599951899999999999999986888


Q ss_pred             CEEEEECCCCCCCCC---C-CCC----CCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCC
Q ss_conf             717851234332222---2-222----22222222222024788865123221124784278630554311222222222
Q gi|254780920|r   75 DAIVNFAAESHVDRS---I-LGA----DEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFS  146 (358)
Q Consensus        75 d~ViHlAa~~~~~~~---~-~~p----~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~  146 (358)
                      |.++|.|+......-   . +..    ...++.|+.+...+..+++..      . ...-++|.+||.....     +  
T Consensus        85 D~lVnnag~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~------~-~~~g~Iv~iss~~~~~-----~--  150 (252)
T PRK06079         85 DGIVHAIAYAKKEELGGNVTDTSRDGYALAQDISAYSLIAVAKYARPL------L-NPPASIVTLTYFGSER-----A--  150 (252)
T ss_pred             CEEEEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH------C-CCCCEEEEEEEEECCC-----C--
T ss_conf             734433202573102464443889999999988889999999888764------0-3577067886440345-----5--


Q ss_pred             CCCCCCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222222233322100000012333---2222222222222333222222222222222222222222222332211
Q gi|254780920|r  147 EDMPYNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDW  223 (358)
Q Consensus       147 E~~~~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdf  223 (358)
                          ....+.|+.+|.+.+.+.+..+.+   +|+++-.+-|+.+--+......--+.+........|.         +-+
T Consensus       151 ----~p~~~~y~aaKaal~~ltr~lA~ela~~gIRVN~IaPG~i~T~~~~~~~~~~~~~~~~~~~~p~---------gr~  217 (252)
T PRK06079        151 ----IPNYNVMGIAKAALESSVRYLARDLGKKGIRVNAISAGAIKTLAVTGIKGHGDLLKESDSRTVD---------GVS  217 (252)
T ss_pred             ----CCCCCCHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCHHHHHHHHHCCCC---------CCC
T ss_conf             ----7774101778999999999999998438989999963778770101566789999999857998---------999


Q ss_pred             CCCCCCCCCEEECCC---CCCCCCCCCCCCCC
Q ss_conf             332222000000012---22222211135786
Q gi|254780920|r  224 LYVEDHVRALYLVLK---KGRIGERYNIGGNN  252 (358)
Q Consensus       224 i~v~D~a~~i~~~~~---~~~~~~~fNigs~~  252 (358)
                      ...+|++.++..++.   ..-.|+++.+.+|-
T Consensus       218 ~~peeia~~v~FL~Sd~a~~iTGq~i~VDGG~  249 (252)
T PRK06079        218 VTIEEVGNVAAFLLSDLSTGVTGDIIYVDKGV  249 (252)
T ss_pred             CCHHHHHHHHHHHHCCHHCCCCCCEEEECCCH
T ss_conf             89999999999994854168259728979492


No 202
>PRK06196 oxidoreductase; Provisional
Probab=99.32  E-value=7.9e-12  Score=91.59  Aligned_cols=177  Identities=16%  Similarity=0.154  Sum_probs=118.2

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHH-HHHCCCCEEEEECCCCCHHHHHHHHHH-----CCCC
Q ss_conf             4899767882779999999986898799994788765856777-620379749997638899999999862-----2787
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLK-EISQSNLFSFLQVDICDRECIRSALKE-----FQPD   75 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~-~~~~~~~v~~i~~Di~d~~~l~~~~~~-----~~~d   75 (358)
                      .|+||||+.=||...+++|++ .|++|+...|.     ....+ ....-++++++.+|+.|.+.++++.++     -+.|
T Consensus        28 ~~vITGa~sGIG~~tA~~La~-~Ga~Vil~~R~-----~~k~~~a~~~i~~~~~~~lDLs~~~sVr~~a~~~~~~~~~lD  101 (316)
T PRK06196         28 TAIVTGGYSGLGLETTRALAQ-AGAHVVVPARR-----PDAAREALAGIDGVEVVALDLADLASVRAFAERFLDSGRRID  101 (316)
T ss_pred             EEEECCCCCHHHHHHHHHHHH-CCCEEEEEECC-----HHHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHHCCCCE
T ss_conf             899917996799999999997-89989999499-----999999998741785798368899999999999997579832


Q ss_pred             EEEEECCCCCCCCC--CCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCC-CCCCCCCCCCCCCCCC
Q ss_conf             17851234332222--22222222222222202478886512322112478427863055431-1222222222222222
Q gi|254780920|r   76 AIVNFAAESHVDRS--ILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEV-YGSLDKGLFSEDMPYN  152 (358)
Q Consensus        76 ~ViHlAa~~~~~~~--~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~v-Yg~~~~~~~~E~~~~~  152 (358)
                      +.||-|+.-..+..  .+.-+..+.+|.+|...+.....-.  .   .+....|+|..||.+- ++...-...+-...+.
T Consensus       102 vLInNAGi~~~~~~~t~dG~E~~~~vN~lg~flLt~lLlp~--L---~~~~~~RIV~vSS~~h~~~~i~~~d~~~~~~y~  176 (316)
T PRK06196        102 ILINNAGVMACPETRVGDGWEAQFATNHLGHFALVNLLWPA--L---AAGAGARVVAVSSLGHRRSPIRWDDVHFERGYD  176 (316)
T ss_pred             EEEECCCCCCCCCEEECCCHHHHHHHHHCCHHHHHHHHHHH--H---HCCCCCEEEEEECHHHHCCCCCCCCCCCCCCCC
T ss_conf             99957876788753534555776655412287899998899--7---536897799971377643887644546567898


Q ss_pred             CCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCC
Q ss_conf             2222233322100000012333---222222222222233
Q gi|254780920|r  153 PSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYG  189 (358)
Q Consensus       153 p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyG  189 (358)
                      |...|+.||++.-.+.+.+++.   .|+.+.++.|+.|.-
T Consensus       177 ~~~aY~~SKlanilft~~La~rl~~~gI~v~avhPG~v~T  216 (316)
T PRK06196        177 KWLAYGQSKTANALFAVHLDKLGADQGVRAFSVHPGGIAT  216 (316)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCC
T ss_conf             2799999899999999999998368994899973773157


No 203
>PRK08589 short chain dehydrogenase; Validated
Probab=99.31  E-value=4.4e-12  Score=93.16  Aligned_cols=222  Identities=18%  Similarity=0.150  Sum_probs=138.5

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             89976788277999999998689879999478876585677762-03797499976388999999998622-----7871
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEI-SQSNLFSFLQVDICDRECIRSALKEF-----QPDA   76 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~-~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d~   76 (358)
                      +|||||++=||..+++.|+++ |.+|++.|+...  .....+.+ ....++.++++|++|.+.++++++..     ++|+
T Consensus         9 alVTGas~GIG~aiA~~la~~-Ga~Vv~~d~~~~--~~~~~~~i~~~g~~~~~~~~Dvsd~~~v~~~v~~~~~~~G~iDi   85 (272)
T PRK08589          9 AVITGASTGIGQASAIALAQE-GAYVLAVDIAEA--VSETVDKIKSNGGKAKAYHVDISDEQQVKDFASDIKEQFGHIDV   85 (272)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHH--HHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             999782569999999999986-999999838278--99999999955994899996079999999999999998299878


Q ss_pred             EEEECCCCCCCC-----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             785123433222-----222222222222222202478886512322112478427863055431122222222222222
Q gi|254780920|r   77 IVNFAAESHVDR-----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPY  151 (358)
Q Consensus        77 ViHlAa~~~~~~-----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~  151 (358)
                      ++|.|+......     +.++....+++|+.|+..+..++....     .+.+ -++|.+||..-+..           .
T Consensus        86 LVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~f~~~~~~~p~m-----~~~g-G~IVnisS~~g~~~-----------~  148 (272)
T PRK08589         86 LFNNAGVDNAAGRIHEYPVDVFDKIMAVDMRGTFLMTKMLLPLM-----MEQG-GSIINTSSFSGQAA-----------D  148 (272)
T ss_pred             EEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHCC-CEEEEEECHHHCCC-----------C
T ss_conf             99898667888871009999999999998299999999999999-----9759-90799912343677-----------8


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222333221000000123332---22222222222233322222222222----22222222222222223322113
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIPLA----ITRMIEGSHVFLYGDGQNVRDWL  224 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~~~----i~~~~~g~~~~i~g~g~~~Rdfi  224 (358)
                      .....|+.||.+...+.+..+.++   |+++-.+-|+.+.-|...  .+....    -....+...- .    ....-+.
T Consensus       149 ~~~~~Y~asKaal~~lTr~lA~E~a~~gIrVNaVaPG~i~T~~~~--~~~~~~~~~~~~~~~~~~~~-~----~PlgR~g  221 (272)
T PRK08589        149 LYRSGYNAAKGAVINFTKSIAIEYGRDGIRANAIAPGTIETPLVD--KLTGTSEDEAGKTFRENQKW-M----TPLGRLG  221 (272)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCHHHH--HHCCCCHHHHHHHHHHHHHC-C----CCCCCCC
T ss_conf             986689999999999999999997225939999964889864576--65347747889999987544-7----8978977


Q ss_pred             CCCCCCCCEEECCCC---CCCCCCCCCCCC
Q ss_conf             322220000000122---222221113578
Q gi|254780920|r  225 YVEDHVRALYLVLKK---GRIGERYNIGGN  251 (358)
Q Consensus       225 ~v~D~a~~i~~~~~~---~~~~~~fNigs~  251 (358)
                      ..+|++.++..+...   ...|.++.+.+|
T Consensus       222 ~peeiA~~v~FLaSd~asyiTG~~i~VDGG  251 (272)
T PRK08589        222 KPEEVAKLVVFLASDDSSFITGETIRIDGG  251 (272)
T ss_pred             CHHHHHHHHHHHHCCHHCCCCCCEEEECCC
T ss_conf             899999999998185217836854898908


No 204
>PRK12742 oxidoreductase; Provisional
Probab=99.31  E-value=5.7e-12  Score=92.49  Aligned_cols=216  Identities=15%  Similarity=0.139  Sum_probs=135.8

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC-CCCEEEEE
Q ss_conf             48997678827799999999868987999947887658567776203797499976388999999998622-78717851
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEF-QPDAIVNF   80 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~-~~d~ViHl   80 (358)
                      ++|||||++=||..+++.|+++ |++|+...+.    .......+........+..|..|.+.+.++++++ ++|+++|.
T Consensus         8 ~alITGas~GIG~aia~~la~~-Ga~V~i~~~~----~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~g~iD~lVnn   82 (237)
T PRK12742          8 SVLVLGGSRGIGAAIVRRFVTD-GANVVFTYAG----SKDAAERLAAETGATAVFTDSADRDAVIDVVRKSGPLDILVVN   82 (237)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEECCC----CHHHHHHHHHHHCCEEEEECCCCHHHHHHHHHHHCCCCEEEEC
T ss_conf             8999278879999999999987-9999997799----9899999988639828993545899999999986999899989


Q ss_pred             CCCCCCCCC----CCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             234332222----2222222222222220247888651232211247842786305543112222222222222222222
Q gi|254780920|r   81 AAESHVDRS----ILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSP  156 (358)
Q Consensus        81 Aa~~~~~~~----~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~s~  156 (358)
                      |+.......    .++....+++|+.|..++...+....      . ..-++|++||..-  .  ..+      ......
T Consensus        83 Ag~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m------~-~~G~ii~i~S~~~--~--~~~------~~~~~~  145 (237)
T PRK12742         83 AGIALFGDALELDADAIDRLFKINIHAPYHASVEAARQM------P-EGGRILIIGSVNG--D--RMP------VAGMAA  145 (237)
T ss_pred             CCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH------H-CCCEEEEEEEECC--C--CCC------CCCCHH
T ss_conf             977899981349999999999875067999999999971------2-3785999995300--2--368------886078


Q ss_pred             CCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCE
Q ss_conf             2333221000000123332---2222222222223332222222222222222222222222223322113322220000
Q gi|254780920|r  157 YSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRAL  233 (358)
Q Consensus       157 Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~a~~i  233 (358)
                      |+.||.+.+.+.+.++.++   |+++-.+-|+.|-.+......   . .+...... +.       ..-+...+|+++++
T Consensus       146 Y~asKaal~~ltk~lA~ela~~gIrVNaIaPG~i~T~~~~~~~---~-~~~~~~~~-~p-------l~R~g~p~eia~~v  213 (237)
T PRK12742        146 YAASKSALQGMARGLARDFGPRGITINVVQPGPIDTDANPANG---P-MRDLMHSF-MA-------IKRHGRPEEVAGMV  213 (237)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCC---H-HHHHHHHC-CC-------CCCCCCHHHHHHHH
T ss_conf             8999999999999999997402979999962788888886771---7-99999825-99-------89987899999999


Q ss_pred             EECCC-C--CCCCCCCCCCCC
Q ss_conf             00012-2--222221113578
Q gi|254780920|r  234 YLVLK-K--GRIGERYNIGGN  251 (358)
Q Consensus       234 ~~~~~-~--~~~~~~fNigs~  251 (358)
                      ..++. .  ...|.++.|.+|
T Consensus       214 ~fL~S~~a~~iTG~~i~VDGG  234 (237)
T PRK12742        214 AWLAGPEASFVTGAMHTIDGA  234 (237)
T ss_pred             HHHHCCHHCCCCCCEEEECCC
T ss_conf             999586535755881774859


No 205
>PRK06484 short chain dehydrogenase; Validated
Probab=99.30  E-value=4.2e-12  Score=93.30  Aligned_cols=217  Identities=22%  Similarity=0.185  Sum_probs=139.8

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH----C-CCCEE
Q ss_conf             899767882779999999986898799994788765856777620379749997638899999999862----2-78717
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKE----F-QPDAI   77 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~----~-~~d~V   77 (358)
                      +|||||++=||..+++.|.++ |.+|+..|+...  ......... ......+++|++|.+.+++++++    + ++|++
T Consensus       277 alVTGaa~GIG~aiA~~la~~-GA~Vvi~d~~~~--~~~~~~~~~-g~~~~~~~~Dv~~~~~v~~~v~~~~~~fG~iDiL  352 (530)
T PRK06484        277 VCVTGGASGIGAAIADRFAAL-GDRVAIIDSDGE--EAVKLREIL-GGEHLSWQVDITDEASVESAFAGIQGRLGPLDVL  352 (530)
T ss_pred             EEECCCCCHHHHHHHHHHHHC-CCEEEEEECCHH--HHHHHHHHC-CCCCEEEEECCCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             999287678999999999988-798999958889--999999973-9973699953899999999999999982998899


Q ss_pred             EEECCCCCCC-----CCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             8512343322-----22222222222222222024788865123221124784278630554311222222222222222
Q gi|254780920|r   78 VNFAAESHVD-----RSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYN  152 (358)
Q Consensus        78 iHlAa~~~~~-----~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~  152 (358)
                      +|.|+...+.     .+.++....+++|+.|+..+..++....      ..+.-++|.+||.....           +..
T Consensus       353 VNNAGi~~~~~~~~e~t~e~w~~v~~vNl~g~f~~~~~~~~~m------~~~gG~IVnisS~~~~~-----------~~~  415 (530)
T PRK06484        353 VNNAGIAEPFAPSAEQSLEDFRRTIDVNLKGAFHCSREAARQM------GAGGGVIVNLGSITSLL-----------ALP  415 (530)
T ss_pred             EECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH------HCCCCEEEEECCHHHCC-----------CCC
T ss_conf             9897789899980009999999999997199999999999973------14897699971644365-----------889


Q ss_pred             CCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222333221000000123332---222222222222333222222222---222222222222222222332211332
Q gi|254780920|r  153 PSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIP---LAITRMIEGSHVFLYGDGQNVRDWLYV  226 (358)
Q Consensus       153 p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~---~~i~~~~~g~~~~i~g~g~~~Rdfi~v  226 (358)
                      +...|+.||.+...+.+..+.++   |+++-.+-|+.+..|...  .+..   .....+...-|         .+-+...
T Consensus       416 ~~~~Y~asKaav~~lTr~lA~E~a~~gIrVN~I~PG~i~T~~~~--~~~~~~~~~~~~~~~~~P---------l~R~g~p  484 (530)
T PRK06484        416 PRHAYGASKAAITMLTRCLAAELAPHGIRVNTVAPGYILTPAVQ--ALLASGRRDMNSIRRRIP---------LGRLGQP  484 (530)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCHHHH--HHHHCCHHHHHHHHHCCC---------CCCCCCH
T ss_conf             95799999999999999999996043919998987778870454--433135788999985599---------8997789


Q ss_pred             CCCCCCEEECCCC---CCCCCCCCCCCC
Q ss_conf             2220000000122---222221113578
Q gi|254780920|r  227 EDHVRALYLVLKK---GRIGERYNIGGN  251 (358)
Q Consensus       227 ~D~a~~i~~~~~~---~~~~~~fNigs~  251 (358)
                      +|++.++..+...   ...|+++.+.+|
T Consensus       485 ediA~~v~fLaSd~a~~iTG~~i~VDGG  512 (530)
T PRK06484        485 EEVAEAAYFLASPAASYINGATLQVDGG  512 (530)
T ss_pred             HHHHHHHHHHHCCCCCCCCCCEEEECCC
T ss_conf             9999999998285006866887985968


No 206
>PRK07109 short chain dehydrogenase; Provisional
Probab=99.29  E-value=7.9e-12  Score=91.59  Aligned_cols=213  Identities=16%  Similarity=0.130  Sum_probs=133.6

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHH-HH-HCCCCEEEEECCCCCHHHHHHHHHHC-----CCC
Q ss_conf             899767882779999999986898799994788765856777-62-03797499976388999999998622-----787
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLK-EI-SQSNLFSFLQVDICDRECIRSALKEF-----QPD   75 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~-~~-~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d   75 (358)
                      |+||||++=||..+++.|.++ |++|+.+++...  ...... ++ ....++..+.+|++|.+.++++++..     .+|
T Consensus        11 VvITGASsGIGra~A~~fA~~-Ga~Vvl~aR~~~--~L~~~a~e~~~~G~~~~~~~~DVsd~~~v~~~~~~~~~~~G~ID   87 (338)
T PRK07109         11 VVITGASAGVGRATARAFARR-GAKVVLLARGEE--GLEGLAAEIRAAGGEALAVVADVADAEAVQAAADRAEEELGPID   87 (338)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHH--HHHHHHHHHHHCCCEEEEEEEECCCHHHHHHHHHHHHHHHCCCC
T ss_conf             999484349999999999987-998999989999--99999999996398189998017999999999999999849988


Q ss_pred             EEEEECCCCCCCCC----CCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             17851234332222----22222222222222202478886512322112478427863055431122222222222222
Q gi|254780920|r   76 AIVNFAAESHVDRS----ILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPY  151 (358)
Q Consensus        76 ~ViHlAa~~~~~~~----~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~  151 (358)
                      +++|.|+.......    .++....+++|+.|+.++..++-..     ....+.-++|.+||..-+-.           .
T Consensus        88 vlVNNAGi~~~g~~~~~~~e~~~~vi~vNl~G~v~~t~aaLp~-----m~~~~~G~IInvsSvag~~~-----------~  151 (338)
T PRK07109         88 TWVNNAMVTVFGPFEDVTPEEFRRVTDVTYLGVVHGTLAALRH-----MRPRDRGAIIQVGSALAYRS-----------I  151 (338)
T ss_pred             EEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEEECCHHHCCC-----------C
T ss_conf             8865466677876322999999999877518999999999999-----98679978999889555457-----------8


Q ss_pred             CCCCCCCCCCCCCEEEECCCC-----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222333221000000123-----332222222222222333222222222222222222222222222332211332
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWG-----HTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYV  226 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~-----~~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v  226 (358)
                      --.+.|+.||.+..-+.+..+     +..++.++.+-|+.|==|.-       .+.+..+ |..+....      +...-
T Consensus       152 P~~saY~ASK~Av~GftesLr~EL~~~~s~I~Vt~V~Pg~VdTP~f-------~~~~n~~-~~~~~~~p------p~~~p  217 (338)
T PRK07109        152 PLQSAYCAAKHAIRGFTDSLRCELLHDGSPVSVTMVQPPAVNTPQF-------DWARSYL-PVEPQPVP------PIYQP  217 (338)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCHH-------HHHHHCC-CCCCCCCC------CCCCH
T ss_conf             9981799999999999999999998679981899975798779742-------4445237-98888999------99898


Q ss_pred             CCCCCCEEECCCCCCCCCCCCCCC
Q ss_conf             222000000012222222111357
Q gi|254780920|r  227 EDHVRALYLVLKKGRIGERYNIGG  250 (358)
Q Consensus       227 ~D~a~~i~~~~~~~~~~~~fNigs  250 (358)
                      +-+|++++.+..++.. +++ +|.
T Consensus       218 e~vA~ai~~~a~~p~r-~~~-vg~  239 (338)
T PRK07109        218 EVVADAILFAAEHPRR-ELW-VGG  239 (338)
T ss_pred             HHHHHHHHHHHHCCCC-EEE-ECH
T ss_conf             9999999999748985-243-077


No 207
>PRK07904 short chain dehydrogenase; Provisional
Probab=99.29  E-value=1.5e-11  Score=89.84  Aligned_cols=203  Identities=13%  Similarity=0.112  Sum_probs=126.6

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH--CCCCEEEEECCCCCHHHHHHHHH----HCCCC
Q ss_conf             4899767882779999999986898799994788765856777620--37974999763889999999986----22787
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS--QSNLFSFLQVDICDRECIRSALK----EFQPD   75 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~--~~~~v~~i~~Di~d~~~l~~~~~----~~~~d   75 (358)
                      .||||||+.=||..++++|+++++..|+..++...........++.  ....+..+.+|++|.+...++++    ..++|
T Consensus        10 tvlITGassGIG~a~a~~~~~~g~~~v~l~~r~~~~~~~~~~~~~~~~~~~~v~~~~~D~~d~~~~~~~i~~~~~~~~id   89 (253)
T PRK07904         10 TILLLGGTSEIGLAICERYLRNAPARVVLAALPDDPRRDAAVAQMKAAGASSVEVIDFDALDTDSHPKVIDAAFAGGDVD   89 (253)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCEE
T ss_conf             89993565099999999999749898999978973269999999985499718999556679899999999998549935


Q ss_pred             EEEEECCCCCCCC-CCCCCC---CCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             1785123433222-222222---222222222202478886512322112478427863055431122222222222222
Q gi|254780920|r   76 AIVNFAAESHVDR-SILGAD---EFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPY  151 (358)
Q Consensus        76 ~ViHlAa~~~~~~-~~~~p~---~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~  151 (358)
                      ++++.|+...... .+.+..   ..+++|+.|+.++..++...     ....+.-++|.+||.+-+-           +.
T Consensus        90 v~i~~aG~~~~~~~~~~~~~~~~~~~~vN~~~~~~~~~~~~~~-----m~~~~~G~Iv~isSvag~~-----------~~  153 (253)
T PRK07904         90 VAIVAFGLLGDAEELWQNQRKAVQIAEINYTAAVSVGVLLGEK-----MRAQGFGQIIAMSSAAGER-----------VR  153 (253)
T ss_pred             EEEECCCCCCCCHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEEECCCCCCC-----------CC
T ss_conf             9996244567825540229999999989949999999999999-----9754998699966600036-----------79


Q ss_pred             CCCCCCCCCCCCCEEEECCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222333221000000123---33222222222222233322222222222222222222222222233221133222
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWG---HTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVED  228 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~---~~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D  228 (358)
                      .....|+.||.+...+.+..+   ..+|++++.+.|+.|--|-          .... ...|+           .+..+|
T Consensus       154 ~~~~~Y~ASKaal~~f~~~L~~el~~~gIrV~~V~PG~V~T~m----------t~~~-~~~p~-----------~~~~e~  211 (253)
T PRK07904        154 RSNFVYGSTKAGLDGFYLGLGEALREYGVRVLVIRPGQVRTRM----------SADV-KEAPL-----------TVDKED  211 (253)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCC----------CCCC-CCCCC-----------CCCHHH
T ss_conf             9972688999999999999999847728889999727886765----------6899-98997-----------689999


Q ss_pred             CCCCEEECCCCCCC
Q ss_conf             20000000122222
Q gi|254780920|r  229 HVRALYLVLKKGRI  242 (358)
Q Consensus       229 ~a~~i~~~~~~~~~  242 (358)
                      +|+.++.++++++.
T Consensus       212 vA~~i~~ai~~~k~  225 (253)
T PRK07904        212 VANLAVTAVAKGKE  225 (253)
T ss_pred             HHHHHHHHHHCCCC
T ss_conf             99999999985996


No 208
>PRK05876 short chain dehydrogenase; Provisional
Probab=99.29  E-value=6.3e-12  Score=92.21  Aligned_cols=167  Identities=14%  Similarity=-0.004  Sum_probs=112.2

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH-CCCCEEEEECCCCCHHHHHHHHHH-----CCCCE
Q ss_conf             899767882779999999986898799994788765856777620-379749997638899999999862-----27871
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS-QSNLFSFLQVDICDRECIRSALKE-----FQPDA   76 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~-~~~~v~~i~~Di~d~~~l~~~~~~-----~~~d~   76 (358)
                      ++||||++=||..+++.|+++ |.+|+..|+..... ....+.+. ....+..+.+|+++.+++++++..     ..+|+
T Consensus         9 avITGaasGIG~a~A~~la~~-Ga~Vvi~d~~~~~l-~~~~~~l~~~g~~~~~~~~Dvt~~~~v~~l~~~~~~~~G~iDi   86 (275)
T PRK05876          9 AVITGGASGIGLATGTEFARR-GARVVLGDVDKPGL-RQAVNHLRAEGFDVHGVMCDVRHREEVTHLADEAFRLLGHVDV   86 (275)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHHH-HHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             999282669999999999987-99899997988999-9999999826984799978889999999999999998489885


Q ss_pred             EEEECCCCCCCCC----CCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCC-CCEEEEECCCCCC-CCCCCCCCCCCCCC
Q ss_conf             7851234332222----2222222222222220247888651232211247-8427863055431-12222222222222
Q gi|254780920|r   77 IVNFAAESHVDRS----ILGADEFITTNIIGTFILLEETRLWWSCLSQDKK-DQFRFLQISTDEV-YGSLDKGLFSEDMP  150 (358)
Q Consensus        77 ViHlAa~~~~~~~----~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~-~~~~~v~~SS~~v-Yg~~~~~~~~E~~~  150 (358)
                      +++.|+.......    .++-...+++|+.|..++..++.-.     ..+. ..-+||++||.+- .+.           
T Consensus        87 lvnNAGi~~~~~~~~~~~~~w~~~~~vNl~g~~~~~~~~lP~-----m~~~g~~G~IvntsS~agl~~~-----------  150 (275)
T PRK05876         87 VFSNAGIVVGGPIVEMTHDDWRWVIDVDLWGSIHTVEAFLPR-----LLEQGTGGHVVFTASFAGLVPN-----------  150 (275)
T ss_pred             EECCCCCCCCCCCCCCCHHHHHHHHHHCCHHHHHHHHHHHHH-----HHHHCCCCEEEEECCHHHCCCC-----------
T ss_conf             121574468987232999999998764138999999999999-----9981999499996867753899-----------


Q ss_pred             CCCCCCCCCCCCCCEEEECCCCC---CCCCCCCCCCCCCCC
Q ss_conf             22222223332210000001233---322222222222223
Q gi|254780920|r  151 YNPSSPYSATKASSDYLVLAWGH---TYGIPVLLSNCSNNY  188 (358)
Q Consensus       151 ~~p~s~Yg~sK~~~E~~~~~~~~---~~~l~~~ilR~~~vy  188 (358)
                       -..++|+.||.+..-+.+..+.   .+|+.+.++-|+.|-
T Consensus       151 -~~~~~Y~asK~av~~lte~La~El~~~gI~V~~l~Pg~V~  190 (275)
T PRK05876        151 -AGLGAYGVAKYGVVGLAETLAREVTADGIGVSVLCPMVVE  190 (275)
T ss_pred             -CCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCCCC
T ss_conf             -9974699999999999999999851129389999718899


No 209
>PRK05854 short chain dehydrogenase; Provisional
Probab=99.27  E-value=1.5e-11  Score=89.97  Aligned_cols=179  Identities=16%  Similarity=0.189  Sum_probs=118.2

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCC--HHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC-----CCC
Q ss_conf             8997678827799999999868987999947887658--567776203797499976388999999998622-----787
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGN--LNSLKEISQSNLFSFLQVDICDRECIRSALKEF-----QPD   75 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~--~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d   75 (358)
                      ++||||+.=||...+++|+. .|++|+..-|......  ...++......+++++.+|+.|.++++++.+.+     ..|
T Consensus        17 ~vITGa~sGIG~~~a~~La~-~Ga~Vil~~R~~~k~~~a~~~i~~~~~~~~v~~~~lDLs~l~sVr~~a~~~~~~~~~lD   95 (314)
T PRK05854         17 AVVTGASSGLGFGLARRLAA-AGADVILPVRNRAKGEAAVAAIRTAVPDAKLTIRALDLSSLASVAALGEQLLAEGRPIH   95 (314)
T ss_pred             EEECCCCCHHHHHHHHHHHH-CCCEEEEEECCHHHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHHHCCCCCC
T ss_conf             99906882999999999997-84989999799999999999999868998569996463168999999998753068752


Q ss_pred             EEEEECCCCCCCC---CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCC-CCCCCCCCCCCCCC
Q ss_conf             1785123433222---2222222222222222024788865123221124784278630554311-22222222222222
Q gi|254780920|r   76 AIVNFAAESHVDR---SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVY-GSLDKGLFSEDMPY  151 (358)
Q Consensus        76 ~ViHlAa~~~~~~---~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vY-g~~~~~~~~E~~~~  151 (358)
                      ++|+-|+.-.++.   ..+.-+..+.+|.+|...+.......      .+.+..|+|..||.+.. +...-..++-+..+
T Consensus        96 iLInNAGv~~~~~~~~T~dG~E~~f~vN~LghflLt~~Llp~------l~~~~~RIV~vsS~~~~~~~i~~~dl~~~~~y  169 (314)
T PRK05854         96 LLINNAGVMTPPERQTTADGFELQFGTNHLGHFALTAHLLPL------LRAGRARVTSQSSIAARRGRINFDDLNFERSY  169 (314)
T ss_pred             EEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHH------HCCCCCEEEEECCCCCCCCCCCCCCCCCCCCC
T ss_conf             787267666588654057763665553457788898877876------32578705664342011577654568864568


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCC-----CCCCCCCCCCCCCC
Q ss_conf             22222233322100000012333-----22222222222223
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGHT-----YGIPVLLSNCSNNY  188 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~~-----~~l~~~ilR~~~vy  188 (358)
                      .|...|+.||++.-.+....+++     .++.+.++.|+.|.
T Consensus       170 ~~~~aY~~SKlanilf~~eLarr~~~~~~~v~~~~vhPG~v~  211 (314)
T PRK05854        170 APMTAYGQSKLAVLMFALELDRRSRAAGWGITSNAAHPGLAK  211 (314)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCC
T ss_conf             861888899999999999998652406989799997998435


No 210
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=99.26  E-value=1.3e-11  Score=90.27  Aligned_cols=222  Identities=20%  Similarity=0.176  Sum_probs=134.6

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH-CCCCEEEEECCCCCHHHHHHHHHH----CCCCEE
Q ss_conf             899767882779999999986898799994788765856777620-379749997638899999999862----278717
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS-QSNLFSFLQVDICDRECIRSALKE----FQPDAI   77 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~-~~~~v~~i~~Di~d~~~l~~~~~~----~~~d~V   77 (358)
                      +|||||++=||+.++..|.+. |.+|+..|......-..-...+. ...+..++.+|++|.+.++.+++.    .++|++
T Consensus        12 alVTGas~GIGraiA~~lA~~-GA~Vvi~d~~~~~~~~~~~~ei~~~G~~~~~~~~Dvsd~~~v~~lv~~~~~~G~iDiL   90 (303)
T PRK07792         12 AVVTGAAAGLGRAEALGLARL-GATVVVNDIASALDASDVLDEIRAAGAKAVAVAGDISQRATADELVATADGLGGLDIV   90 (303)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEE
T ss_conf             999288668999999999986-9999997189724799999999844993899966768999999999999983999699


Q ss_pred             EEECCCCCCC----CCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCC--CEEEEECCCCCC-CCCCCCCCCCCCCC
Q ss_conf             8512343322----2222222222222222202478886512322112478--427863055431-12222222222222
Q gi|254780920|r   78 VNFAAESHVD----RSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKD--QFRFLQISTDEV-YGSLDKGLFSEDMP  150 (358)
Q Consensus        78 iHlAa~~~~~----~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~--~~~~v~~SS~~v-Yg~~~~~~~~E~~~  150 (358)
                      +|.|+.....    .+.++.+..+++|+.|+..+..++..+.........+  .-++|.+||.+- .|.           
T Consensus        91 VNNAGi~~~~~~~~~t~e~wd~v~~vNL~g~f~~~r~a~~~m~~~~~~~~g~~~G~IInisS~ag~~g~-----------  159 (303)
T PRK07792         91 VNNAGITRDRMLFNMSDEEWDAVIAVHLRGHFLLTRNAAAYWRAKAKEAGGPVYGRIVNTSSEAGLVGP-----------  159 (303)
T ss_pred             EECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCHHHCCCC-----------
T ss_conf             988855678761009999999999887389999999999999997451699863499997447656689-----------


Q ss_pred             CCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222233322100000012333---22222222222223332222222222222222222222222223322113322
Q gi|254780920|r  151 YNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVE  227 (358)
Q Consensus       151 ~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~  227 (358)
                       .....|+.||.+...+.+..+.+   ||+++-++=|.      -..     .+........+-..    ....+.+-.+
T Consensus       160 -~g~~~Y~AsKagv~~lTrslA~Ela~~gIRVNaIaP~------a~t-----~~~~~~~~~~~~~~----~~~~~p~~Pe  223 (303)
T PRK07792        160 -VGQANYGAAKAGITALTLSAARALGRYGVRANAICPR------ART-----AMTADVFGDAPDVA----AGGIDPLSPE  223 (303)
T ss_pred             -CCCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCC------CCC-----HHHHHHHHHCHHHH----HHCCCCCCHH
T ss_conf             -9858899999999999999999985519699998999------987-----02244420177779----7577999999


Q ss_pred             CCCCCEEECCC---CCCCCCCCCCCCCC
Q ss_conf             22000000012---22222211135786
Q gi|254780920|r  228 DHVRALYLVLK---KGRIGERYNIGGNN  252 (358)
Q Consensus       228 D~a~~i~~~~~---~~~~~~~fNigs~~  252 (358)
                      |+|.++..+..   ....|++|.+.+|.
T Consensus       224 eVA~~v~fLaSd~as~ITGq~l~VdGG~  251 (303)
T PRK07792        224 HVVTLVQFLASPAAAGVNGQLFIVYGPQ  251 (303)
T ss_pred             HHHHHHHHHCCCCCCCCCCCEEEECCCE
T ss_conf             9999999973910069879879986999


No 211
>PRK08278 short chain dehydrogenase; Provisional
Probab=99.26  E-value=1.7e-11  Score=89.50  Aligned_cols=204  Identities=19%  Similarity=0.179  Sum_probs=127.7

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCC-C----HHH-HHHHH-CCCCEEEEECCCCCHHHHHHHHHH----
Q ss_conf             899767882779999999986898799994788765-8----567-77620-379749997638899999999862----
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAG-N----LNS-LKEIS-QSNLFSFLQVDICDRECIRSALKE----   71 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~-~----~~~-~~~~~-~~~~v~~i~~Di~d~~~l~~~~~~----   71 (358)
                      +|||||++=||+.++++|+++ |++|+..++..... .    ... .+++. ...+...+++|++|++.++++++.    
T Consensus         9 alVTGas~GIG~aiA~~la~~-Ga~Vvi~~r~~~~~~~l~~~~~~~a~e~~~~g~~~~~~~~Dv~~~~~v~~~v~~~~~~   87 (273)
T PRK08278          9 LFITGASRGIGLAIALRAARD-GANIVIAAKTAEPHPKLPGTIHTAAAEIEAAGGQALPLVGDVRDEDQVAAAVAKTVER   87 (273)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             999487659999999999987-9989999677222133454899999999974990899971179999999999999998


Q ss_pred             -CCCCEEEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCC
Q ss_conf             -27871785123433222----2222222222222222024788865123221124784278630554311222222222
Q gi|254780920|r   72 -FQPDAIVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFS  146 (358)
Q Consensus        72 -~~~d~ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~  146 (358)
                       ..+|+++|.|+......    +.++....+++|+.|+..+..++..+     ..+.+.-++|.+||..-...  .    
T Consensus        88 ~G~iDiLVNNAG~~~~~~~~~~~~~~~~~~~~vNl~g~~~~~~~~~p~-----m~~~~~G~IinisS~~~~~~--~----  156 (273)
T PRK08278         88 FGGIDICVNNASAINLTGTEDTPMKRFDLMQGINVRGTFLVSQACLPH-----LKKSANPHILTLSPPLNLDP--K----  156 (273)
T ss_pred             HCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHHHCHHHHHHHHHHHHH-----HHHCCCCEEEEECCHHHCCC--C----
T ss_conf             599629998786666750777518999999998355999999876567-----66579978999888787468--7----


Q ss_pred             CCCCCCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCC
Q ss_conf             2222222222233322100000012333---22222222222223332222222222222222222-2222222233221
Q gi|254780920|r  147 EDMPYNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGS-HVFLYGDGQNVRD  222 (358)
Q Consensus       147 E~~~~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~-~~~i~g~g~~~Rd  222 (358)
                         ...+...|+.||.+.+.+.+..+.+   +|+++-.+-|.....         +..++....+. ++.-+|       
T Consensus       157 ---~~~~~~aY~asKaal~~ltrslA~Ela~~gIrVNaVaP~~~~~---------t~~~~~~~~~~~~l~R~g-------  217 (273)
T PRK08278        157 ---WFAPHTAYTMAKYGMSLCTLGLAEEFREDGIAVNALWPRTMIA---------TAAVQNLLGGDEAMRRSR-------  217 (273)
T ss_pred             ---CCCCCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCCCCCC---------CHHHHHHCCCCCHHHCCC-------
T ss_conf             ---7788479999999999999999999603098999972798176---------899984104721221467-------


Q ss_pred             CCCCCCCCCCEEECCCC
Q ss_conf             13322220000000122
Q gi|254780920|r  223 WLYVEDHVRALYLVLKK  239 (358)
Q Consensus       223 fi~v~D~a~~i~~~~~~  239 (358)
                        -.+|+|.+...++..
T Consensus       218 --~PediA~av~FL~Sd  232 (273)
T PRK08278        218 --TPEIMADAAHAILTR  232 (273)
T ss_pred             --CHHHHHHHHHHHHCC
T ss_conf             --889999999999387


No 212
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional
Probab=99.24  E-value=1.1e-11  Score=90.76  Aligned_cols=222  Identities=13%  Similarity=0.046  Sum_probs=124.9

Q ss_pred             EEEEECCCC--HHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCC-CCEEEEECCCCCHHHHHHHHHHC-----C
Q ss_conf             489976788--277999999998689879999478876585677762037-97499976388999999998622-----7
Q gi|254780920|r    2 RLIVTGGAG--FIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQS-NLFSFLQVDICDRECIRSALKEF-----Q   73 (358)
Q Consensus         2 kILItG~tG--fIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~-~~v~~i~~Di~d~~~l~~~~~~~-----~   73 (358)
                      ++|||||+|  =||..+++.|.+. |.+|+..++...  .....+.+... ....++++|++|.+.+++++...     +
T Consensus         9 ~alITGaa~~~GIG~aiA~~La~~-GA~V~i~~~~e~--~~~~~~~~~~~~g~~~~~~~Dvsd~~~v~~~v~~~~~~~G~   85 (271)
T PRK06505          9 RGLIMGVANDHSIAWGIAKQLAAQ-GAELAFTYQGDA--LGKRVKPLAESLGSDLVLPCDVEDIASVDAVFEALEKKWGK   85 (271)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHC-CCEEEEEECCHH--HHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHCC
T ss_conf             799979999854999999999986-999999818668--89999999996498189983799999999999999998399


Q ss_pred             CCEEEEECCCCCCCC--------CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCC
Q ss_conf             871785123433222--------222222222222222202478886512322112478427863055431122222222
Q gi|254780920|r   74 PDAIVNFAAESHVDR--------SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLF  145 (358)
Q Consensus        74 ~d~ViHlAa~~~~~~--------~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~  145 (358)
                      +|+++|.|+......        ..++-...+..|..++..+   ++.....   .. ..-++|.+||...-.     +.
T Consensus        86 iDiLVnnAG~~~~~~~~~~~~d~~~e~~~~~~~~n~~~~~~~---~~~~~~~---~~-~~Gsii~iss~~~~~-----~~  153 (271)
T PRK06505         86 LDFVVHAIGFSDKNELKGRYADTTRENFSRTMVISCFSFTEI---AKRAAKL---MP-DGGSMLTLTYGGSTR-----VM  153 (271)
T ss_pred             CCEEEECCCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHH---HHHHHCC---CC-CCCCEEEEECCCCCC-----CC
T ss_conf             878985664467544445412267999999999997999999---9986001---26-788602463254344-----57


Q ss_pred             CCCCCCCCCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222222222333221000000123332---22222222222233322222222222222222222222222233221
Q gi|254780920|r  146 SEDMPYNPSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRD  222 (358)
Q Consensus       146 ~E~~~~~p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rd  222 (358)
                            -..+.|+.+|.+.+.+.+..+.++   |+++-.+-|+.+--+....-.--+.+.......-|+         +-
T Consensus       154 ------p~~~~Y~asKaal~~ltr~lA~e~a~~gIRVN~IaPG~i~T~~~~~~~~~~~~~~~~~~~~Pl---------~R  218 (271)
T PRK06505        154 ------PNYNVMGVAKAALEASVRYLAADYGPQGIRVNAISAGPVRTLAGAGIGDARAMFSYQQRNSPL---------RR  218 (271)
T ss_pred             ------CCCCHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHCCCC---------CC
T ss_conf             ------874134787877999999999997023989999975777655424477679999999868898---------99


Q ss_pred             CCCCCCCCCCEEECCCC---CCCCCCCCCCCCCC
Q ss_conf             13322220000000122---22222111357864
Q gi|254780920|r  223 WLYVEDHVRALYLVLKK---GRIGERYNIGGNNE  253 (358)
Q Consensus       223 fi~v~D~a~~i~~~~~~---~~~~~~fNigs~~~  253 (358)
                      +...+|++.++..++..   ...|+++.+-+|-+
T Consensus       219 ~g~~ediA~~v~fL~Sd~s~~iTGq~i~VDGG~s  252 (271)
T PRK06505        219 TVTIDEVGGSALYLLSDLSSGVTGEIHFVDSGYN  252 (271)
T ss_pred             CCCHHHHHHHHHHHHCCHHCCCCCCEEEECCCCC
T ss_conf             9699999999999957542474587089796930


No 213
>PRK08703 short chain dehydrogenase; Provisional
Probab=99.23  E-value=2.2e-11  Score=88.88  Aligned_cols=208  Identities=14%  Similarity=0.108  Sum_probs=123.9

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHH-HHHH--CCCCEEEEECCCCCHH--HHHHHH----HH-
Q ss_conf             489976788277999999998689879999478876585677-7620--3797499976388999--999998----62-
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSL-KEIS--QSNLFSFLQVDICDRE--CIRSAL----KE-   71 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~-~~~~--~~~~v~~i~~Di~d~~--~l~~~~----~~-   71 (358)
                      .||||||++=||..+++.|+++ |++|+.+++....  .... +.+.  ..+....+.+|+.+.+  .++++.    +. 
T Consensus         8 ~~lITGas~GIG~aiA~~la~~-Ga~V~l~~r~~~~--l~~~~~~l~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~   84 (239)
T PRK08703          8 TILVTGASQGLGEQVAKAYAAA-GATVILVARHQKK--LEKVYDAIVEAGHPEPFAIRFDLMSAEEKEFEQFAATIAEAT   84 (239)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHH--HHHHHHHHHHCCCCCEEEEEEECCCCHHHHHHHHHHHHHHHH
T ss_conf             8999488628999999999987-9989999798889--999999999737995499998505630789999999999983


Q ss_pred             -CCCCEEEEECCCCCC--CC---CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCC
Q ss_conf             -278717851234332--22---222222222222222202478886512322112478427863055431122222222
Q gi|254780920|r   72 -FQPDAIVNFAAESHV--DR---SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLF  145 (358)
Q Consensus        72 -~~~d~ViHlAa~~~~--~~---~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~  145 (358)
                       .++|+++|+|+....  +.   +.++-...+++|+.|+.++..++.-.     ..+.+.-++|++||...+.       
T Consensus        85 ~G~lD~lvnnAG~~~~~~~~~~~~~~~~~~~~~vN~~~~~~l~~~~~p~-----m~~~~~g~Ii~isS~~~~~-------  152 (239)
T PRK08703         85 QGKLDGIVHCAGYFYALSPLDFQTVAEWVNQYRINTVAPMGLTRALFPL-----LKQSPDASVIFVGESHGET-------  152 (239)
T ss_pred             CCCCCEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCEEEEEEECHHHCC-------
T ss_conf             7997689966654578895332899999999988808999999999999-----9877990899981445477-------


Q ss_pred             CCCCCCCCCCCCCCCCCCCEEEECCCCCCC---C-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222222222333221000000123332---2-222222222223332222222222222222222222222223322
Q gi|254780920|r  146 SEDMPYNPSSPYSATKASSDYLVLAWGHTY---G-IPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVR  221 (358)
Q Consensus       146 ~E~~~~~p~s~Yg~sK~~~E~~~~~~~~~~---~-l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~R  221 (358)
                          +......|+.||.+.+.+.+..+.++   | +++-.+=|+.|--|..         . +...++         ..+
T Consensus       153 ----~~~~~~~Y~asKaal~~ltk~lA~E~~~~g~IrVN~i~PG~i~T~~~---------~-~~~~~~---------~~~  209 (239)
T PRK08703        153 ----PKAYWGGFGASKAALNYLCKVAADEWERFGNLRANVLVPGPINSPQR---------I-KSHPGE---------AKS  209 (239)
T ss_pred             ----CCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCCH---------H-HHCCCC---------CHH
T ss_conf             ----89886689999999999999999984789898999998488979681---------5-458697---------601


Q ss_pred             CCCCCCCCCCCEEECCCCC---CCCCCCC
Q ss_conf             1133222200000001222---2222111
Q gi|254780920|r  222 DWLYVEDHVRALYLVLKKG---RIGERYN  247 (358)
Q Consensus       222 dfi~v~D~a~~i~~~~~~~---~~~~~fN  247 (358)
                      ..-..+|++.+++.++...   -.|++++
T Consensus       210 ~~~~~~dia~a~~~LaS~~s~~itGq~i~  238 (239)
T PRK08703        210 ERKSYGDVLPAFVWWASAESKGRSGEIVY  238 (239)
T ss_pred             CCCCHHHHHHHHHHHHCHHHCCCCEEEEE
T ss_conf             05999999999999838877799520676


No 214
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only]
Probab=99.21  E-value=2.5e-11  Score=88.56  Aligned_cols=203  Identities=21%  Similarity=0.208  Sum_probs=129.8

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHH----HC--CCCEEEEECCCCCHHHHHHHHHH----
Q ss_conf             489976788277999999998689879999478876585677762----03--79749997638899999999862----
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEI----SQ--SNLFSFLQVDICDRECIRSALKE----   71 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~----~~--~~~v~~i~~Di~d~~~l~~~~~~----   71 (358)
                      ++||||||+=||..++++|.+ .|++|+.+.|.     ..++.++    .+  .-.++.+.+||++++.++++..+    
T Consensus         8 ~~lITGASsGIG~~~A~~lA~-~g~~liLvaR~-----~~kL~~la~~l~~~~~v~v~vi~~DLs~~~~~~~l~~~l~~~   81 (265)
T COG0300           8 TALITGASSGIGAELAKQLAR-RGYNLILVARR-----EDKLEALAKELEDKTGVEVEVIPADLSDPEALERLEDELKER   81 (265)
T ss_pred             EEEEECCCCHHHHHHHHHHHH-CCCEEEEEECC-----HHHHHHHHHHHHHHHCCEEEEEECCCCCHHHHHHHHHHHHHC
T ss_conf             799977886489999999997-79979999676-----999999999998730862799977678836799999999824


Q ss_pred             -CCCCEEEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCC
Q ss_conf             -27871785123433222----2222222222222222024788865123221124784278630554311222222222
Q gi|254780920|r   72 -FQPDAIVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFS  146 (358)
Q Consensus        72 -~~~d~ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~  146 (358)
                       ..+|+.++.|+......    ++++-.+.++.|+.+...+-.+..-     ...+.+.-.+|.++|.+-|-        
T Consensus        82 ~~~IdvLVNNAG~g~~g~f~~~~~~~~~~mi~lN~~a~~~LT~~~lp-----~m~~~~~G~IiNI~S~ag~~--------  148 (265)
T COG0300          82 GGPIDVLVNNAGFGTFGPFLELSLDEEEEMIQLNILALTRLTKAVLP-----GMVERGAGHIINIGSAAGLI--------  148 (265)
T ss_pred             CCCCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHH-----HHHHCCCCEEEEEECHHHCC--------
T ss_conf             88523899778747766542188589999999999999999999999-----99865896699984345328--------


Q ss_pred             CCCCCCC-CCCCCCCCCCCEEEECCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222-2222333221000000123---33222222222222233322222222222222222222222222233221
Q gi|254780920|r  147 EDMPYNP-SSPYSATKASSDYLVLAWG---HTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRD  222 (358)
Q Consensus       147 E~~~~~p-~s~Yg~sK~~~E~~~~~~~---~~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rd  222 (358)
                          +.| .+.|+.||.+.-.+....+   +.+|+.++.+-|+.+.-+.          ..  ..+.....   ....+-
T Consensus       149 ----p~p~~avY~ATKa~v~~fSeaL~~EL~~~gV~V~~v~PG~~~T~f----------~~--~~~~~~~~---~~~~~~  209 (265)
T COG0300         149 ----PTPYMAVYSATKAFVLSFSEALREELKGTGVKVTAVCPGPTRTEF----------FD--AKGSDVYL---LSPGEL  209 (265)
T ss_pred             ----CCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCC----------CC--CCCCCCCC---CCCHHH
T ss_conf             ----886327999999999999999999835898499999657333553----------33--44443211---232123


Q ss_pred             CCCCCCCCCCEEECCCCCCC
Q ss_conf             13322220000000122222
Q gi|254780920|r  223 WLYVEDHVRALYLVLKKGRI  242 (358)
Q Consensus       223 fi~v~D~a~~i~~~~~~~~~  242 (358)
                      ++..+|+|+..+.++.+++.
T Consensus       210 ~~~~~~va~~~~~~l~~~k~  229 (265)
T COG0300         210 VLSPEDVAEAALKALEKGKR  229 (265)
T ss_pred             CCCHHHHHHHHHHHHHCCCC
T ss_conf             06999999999999850983


No 215
>PRK07791 short chain dehydrogenase; Provisional
Probab=99.21  E-value=3.5e-11  Score=87.66  Aligned_cols=221  Identities=21%  Similarity=0.197  Sum_probs=134.1

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCC----CCHHHH----HHHH-CCCCEEEEECCCCCHHHHHHHHHH-
Q ss_conf             489976788277999999998689879999478876----585677----7620-379749997638899999999862-
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYA----GNLNSL----KEIS-QSNLFSFLQVDICDRECIRSALKE-   71 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~----~~~~~~----~~~~-~~~~v~~i~~Di~d~~~l~~~~~~-   71 (358)
                      .+|||||++=||+.+++.|.++ |.+|+..|.....    ......    +++. .......+.+|++|.+.++++++. 
T Consensus         8 valVTGas~GIG~aiA~~lA~~-GA~Vvi~D~~~~~~~~~~~~~~a~~~~~ei~~~g~~~~~~~~Dvsd~~~v~~~v~~~   86 (285)
T PRK07791          8 VVIVTGAGGGIGRAHALAFAAE-GARVVVNDIGVGLDGSPASGGAAQAVVDEITAAGGEAVANGDDIADWDQAANLVDAA   86 (285)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHH
T ss_conf             7999286768999999999986-999999837643122445679999999999974983999968999999999999999


Q ss_pred             ----CCCCEEEEECCCCCCC----CCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCC---CEEEEECCCCCC-CCC
Q ss_conf             ----2787178512343322----2222222222222222202478886512322112478---427863055431-122
Q gi|254780920|r   72 ----FQPDAIVNFAAESHVD----RSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKD---QFRFLQISTDEV-YGS  139 (358)
Q Consensus        72 ----~~~d~ViHlAa~~~~~----~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~---~~~~v~~SS~~v-Yg~  139 (358)
                          .++|+++|.|+.....    .+.++....+++|+.|+..+...+..+...  ..+.+   .-++|.+||..- .|.
T Consensus        87 ~~~fG~iDiLVNNAGi~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~~~m~~--~~~~g~~~~G~IInisS~~g~~g~  164 (285)
T PRK07791         87 VETFGGLDVLVNNAGILRDRMFANTSEEEWDAVIRVHLKGHFATLRHAAAYWRD--QSKAGKAVDARIINTSSGAGLQGS  164 (285)
T ss_pred             HHHHCCCCEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHCCCCCCEEEEEECCHHHCCCC
T ss_conf             998399869997886678887566999999999999838899999999999999--864589984599996644537799


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222222222222222333221000000123332---22222222222233322222222222222222222222222
Q gi|254780920|r  140 LDKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGD  216 (358)
Q Consensus       140 ~~~~~~~E~~~~~p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~  216 (358)
                                  .....|+.||.+...+.+..+.++   |+++-.+-|.    ...   .+.......... ++      
T Consensus       165 ------------~~~~~Y~asKaav~~lTr~lA~Ela~~gIrVNaVaPg----~~t---~~~~~~~~~~~~-~~------  218 (285)
T PRK07791        165 ------------VGQANYSAAKAGIAALTLVAAAELGRYGVTVNAIAPA----ART---RMTETVFADMMA-KP------  218 (285)
T ss_pred             ------------CCCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCC----CCC---CCCCHHHHHHHH-CC------
T ss_conf             ------------9867899999999999999999963129599998377----888---876334799874-64------


Q ss_pred             CCCCCCCCCCCCCCCCEEECCCC---CCCCCCCCCCCCC
Q ss_conf             23322113322220000000122---2222211135786
Q gi|254780920|r  217 GQNVRDWLYVEDHVRALYLVLKK---GRIGERYNIGGNN  252 (358)
Q Consensus       217 g~~~Rdfi~v~D~a~~i~~~~~~---~~~~~~fNigs~~  252 (358)
                       ...+...-.+|+|.++..+...   ...|+++.+.+|.
T Consensus       219 -~~~~~~~~PedIA~~v~FLaSd~asyITGq~l~VDGG~  256 (285)
T PRK07791        219 -EDGFDAMAPENVSPLVVWLGSAESRDVTGKVFEVEGGK  256 (285)
T ss_pred             -CCCCCCCCHHHHHHHHHHHCCCCCCCCCCCEEEECCCE
T ss_conf             -00368889999999999981740078778759977993


No 216
>PRK07453 protochlorophyllide oxidoreductase; Validated
Probab=99.21  E-value=6.6e-11  Score=85.94  Aligned_cols=179  Identities=20%  Similarity=0.255  Sum_probs=112.2

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHHC-----CCC
Q ss_conf             489976788277999999998689879999478876585677762-03797499976388999999998622-----787
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEI-SQSNLFSFLQVDICDRECIRSALKEF-----QPD   75 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~-~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d   75 (358)
                      .|+||||+.=||...+++|++ .|++|+..-|....+ ..-.+.+ ....+++++.+||.|.++++++.+++     ..|
T Consensus         8 TvvITGansGIG~eta~~La~-~ga~Vil~~R~~~k~-~~a~~~i~~~~~~~~~~~lDLssl~SVr~~a~~~~~~~~~lD   85 (322)
T PRK07453          8 TVLITGASSGVGLYAAKALAK-RGWHVIMACRSLKKA-EAAAQELGIPPDSYTIIHIDLGDLDSVRRFVDDFRALGKPLD   85 (322)
T ss_pred             EEEEECCCCHHHHHHHHHHHH-CCCEEEEEECCHHHH-HHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCE
T ss_conf             399968886899999999997-899899997999999-999999618898779998988999999999999998659840


Q ss_pred             EEEEECCCCCC-----CCCCCCCCCCCCCCCCCCC----HHHHHHHHHCCCCCCCCCCCEEEEECCCCCC-CCCC-CCCC
Q ss_conf             17851234332-----2222222222222222220----2478886512322112478427863055431-1222-2222
Q gi|254780920|r   76 AIVNFAAESHV-----DRSILGADEFITTNIIGTF----ILLEETRLWWSCLSQDKKDQFRFLQISTDEV-YGSL-DKGL  144 (358)
Q Consensus        76 ~ViHlAa~~~~-----~~~~~~p~~~~~~Nv~gt~----nil~~~~~~~~~~~~~~~~~~~~v~~SS~~v-Yg~~-~~~~  144 (358)
                      +.|+-|+.-.+     ....+.-+..+.+|.+|-.    .||+..+..       .....|+|..||.+- +... ...+
T Consensus        86 iLInNAGv~~p~~~~~~~T~dG~E~~f~vNhLghFlLt~lLlp~L~~s-------~~~~~RIV~vsS~~h~~~~~~~~~~  158 (322)
T PRK07453         86 ALVCNAAVYKPLLKEPLRSPQGYELSMATNHLGHFLLCNLLLEDLKKS-------PAPDPRLVILGTVTANPKELGGKIP  158 (322)
T ss_pred             EEEECCCCCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHHHHHHHHHHC-------CCCCCCEEEECCHHHCCCCCCCCCC
T ss_conf             898656544655678734588763454310588999999889999727-------8999818998122432302377556


Q ss_pred             ------C----------------CCCCCCCCCCCCCCCCCCCEEEECCCCCCC----CCCCCCCCCCCCCC
Q ss_conf             ------2----------------222222222222333221000000123332----22222222222233
Q gi|254780920|r  145 ------F----------------SEDMPYNPSSPYSATKASSDYLVLAWGHTY----GIPVLLSNCSNNYG  189 (358)
Q Consensus       145 ------~----------------~E~~~~~p~s~Yg~sK~~~E~~~~~~~~~~----~l~~~ilR~~~vyG  189 (358)
                            +                .+...+.|...||.||++.-......++++    ++.+.++.|+.|.+
T Consensus       159 ~p~~~d~~dl~~~~~~~~~~~~~~~~~~y~~~~aY~~SKlanilf~~eL~rrl~~~~~i~~~a~hPG~V~~  229 (322)
T PRK07453        159 IPAPADLGDLSGFEAGFKAPISMADGKKFKPGKAYKDSKLCNMLTMRELHRRYHESTGITFSSLYPGCVAD  229 (322)
T ss_pred             CCCCCCCCHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCEEC
T ss_conf             67777720234555314673101257757808789999999999999999861247893799717824116


No 217
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional
Probab=99.20  E-value=1.6e-11  Score=89.72  Aligned_cols=221  Identities=13%  Similarity=0.020  Sum_probs=128.0

Q ss_pred             EEEEECCCC--HHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCC-CCEEEEECCCCCHHHHHHHHHHC-----C
Q ss_conf             489976788--277999999998689879999478876585677762037-97499976388999999998622-----7
Q gi|254780920|r    2 RLIVTGGAG--FIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQS-NLFSFLQVDICDRECIRSALKEF-----Q   73 (358)
Q Consensus         2 kILItG~tG--fIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~-~~v~~i~~Di~d~~~l~~~~~~~-----~   73 (358)
                      ++|||||+|  =||..+++.|+++ |.+|...++..  ......+.+... .....+++|++|++.++++++..     .
T Consensus         7 ~alITGaag~~GIG~aiA~~la~~-GA~V~i~~~~~--~~~~~~~~l~~~~g~~~~~~~Dvs~~~~v~~~~~~i~~~~G~   83 (274)
T PRK08415          7 KGLIVGVANNKSIAYGIAKACFEQ-GAELAFTYLND--ALKKRVEPIAQELGSPYVYELDVSKEEHFKSLAESIKKDLGE   83 (274)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHC-CCEEEEEECCH--HHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHCC
T ss_conf             799989999837999999999986-99999984887--899999999986299769990289999999999999998589


Q ss_pred             CCEEEEECCCCCCCC--------CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCC
Q ss_conf             871785123433222--------222222222222222202478886512322112478427863055431122222222
Q gi|254780920|r   74 PDAIVNFAAESHVDR--------SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLF  145 (358)
Q Consensus        74 ~d~ViHlAa~~~~~~--------~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~  145 (358)
                      +|+++|.|+......        ..++....++.|+.++..+..++...      .+.+ -+++.+||..-.     .  
T Consensus        84 iDilVnnag~~~~~~~~~~~~d~~~~~~~~~~~~n~~~~~~~~~~~~~~------m~~~-GsIi~iss~~~~-----~--  149 (274)
T PRK08415         84 IDFIVHSVAFAPKEALEGSFLETSKEAFDIAMEISVYSLIELTRALLPL------LNDG-GSVLTLSYLGGV-----K--  149 (274)
T ss_pred             CCEEEECCCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH------HHCC-CCCCCCCCCCCC-----C--
T ss_conf             8888533555764334687333899999999999999999999999987------4307-987642202465-----6--


Q ss_pred             CCCCCCCCCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222222222333221000000123332---22222222222233322222222222222222222222222233221
Q gi|254780920|r  146 SEDMPYNPSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRD  222 (358)
Q Consensus       146 ~E~~~~~p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rd  222 (358)
                          +....+.|+.||.+.+.+.+..+.++   |+++-++-|+.+--+......-...+.+.....-|+         +-
T Consensus       150 ----~~p~~~~y~asKaal~~ltk~lA~Ela~~gIRVN~IaPG~i~T~~~~~~~~~~~~~~~~~~~~Pl---------~R  216 (274)
T PRK08415        150 ----YVPHYNVMGVAKAALESSVRYLAVDLGKKGIRVNAISAGPIKTLAASGIGDFRMILKWNEINAPL---------KK  216 (274)
T ss_pred             ----CCCCCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHCCCC---------CC
T ss_conf             ----66630036777899999999999998354969999876877761001388899999878748997---------89


Q ss_pred             CCCCCCCCCCEEECCCC---CCCCCCCCCCCCC
Q ss_conf             13322220000000122---2222211135786
Q gi|254780920|r  223 WLYVEDHVRALYLVLKK---GRIGERYNIGGNN  252 (358)
Q Consensus       223 fi~v~D~a~~i~~~~~~---~~~~~~fNigs~~  252 (358)
                      +...+|++.++..++..   ...|+++.+.+|-
T Consensus       217 ~g~pediA~av~FLaSd~ss~iTG~~i~VDGG~  249 (274)
T PRK08415        217 NVSIEEVGNSAMYLLSDLASGVTGEIHYVDAGY  249 (274)
T ss_pred             CCCHHHHHHHHHHHHCCHHCCCCCCEEEECCCH
T ss_conf             969999999999995845357368715778793


No 218
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional
Probab=99.20  E-value=2.4e-11  Score=88.69  Aligned_cols=221  Identities=12%  Similarity=0.010  Sum_probs=127.7

Q ss_pred             EEEEECCCCH--HHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHC-CCCEEEEECCCCCHHHHHHHHHHC-----C
Q ss_conf             4899767882--7799999999868987999947887658567776203-797499976388999999998622-----7
Q gi|254780920|r    2 RLIVTGGAGF--IGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQ-SNLFSFLQVDICDRECIRSALKEF-----Q   73 (358)
Q Consensus         2 kILItG~tGf--IGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~-~~~v~~i~~Di~d~~~l~~~~~~~-----~   73 (358)
                      ++|||||+|-  ||..+++.|.+ .|.+|+..++...  .....+.+.. .....++++|+++.+.++++++..     +
T Consensus         8 ~alVTGaa~g~GIG~aiA~~la~-~Ga~V~i~~~~~~--~~~~~~~~~~~~~~~~~~~~Dvt~~~~v~~~~~~~~~~~G~   84 (254)
T PRK07533          8 RGLVVGIANEQSIAWGCARAFRA-LGAELAVTYLNDK--ARPYVEPLAEELDAPLLMPLDVREPGQLEAVFARIAEEWGR   84 (254)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHH-CCCEEEEEECCHH--HHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHCC
T ss_conf             89996888980899999999998-7999999828877--89999999974598189991699999999999999998499


Q ss_pred             CCEEEEECCCCCCC--------CCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCC
Q ss_conf             87178512343322--------2222222222222222202478886512322112478427863055431122222222
Q gi|254780920|r   74 PDAIVNFAAESHVD--------RSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLF  145 (358)
Q Consensus        74 ~d~ViHlAa~~~~~--------~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~  145 (358)
                      +|+++|-|+.....        .+.++....+++|+.+...+...+...      .+.+ -.++.+||....     .  
T Consensus        85 iDilVnna~~~~~~~~~~~~~d~~~~~~~~~~~vn~~~~~~~~~~~~~~------m~~g-G~iv~iss~~~~-----~--  150 (254)
T PRK07533         85 LDFVLHSIAFAPKEDLHGRVVDCSREGFALAMDVSCHSFIRMARLAEPL------MTNG-GSLLTMSYYGAE-----K--  150 (254)
T ss_pred             CCEEEECCCCCCCHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH------HHHC-CCEEEEEEHHHC-----C--
T ss_conf             7789742212660111476014999999999999859999999998888------6517-831567320011-----4--


Q ss_pred             CCCCCCCCCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222222222333221000000123332---22222222222233322222222222222222222222222233221
Q gi|254780920|r  146 SEDMPYNPSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRD  222 (358)
Q Consensus       146 ~E~~~~~p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rd  222 (358)
                          .....+.|+.+|.+.+.+++..+.++   |+++-.+.|+.+.-+......-.+.+..+....-|+         +-
T Consensus       151 ----~~~~~~~y~~aKaal~~ltr~lA~ela~~gIrVN~I~PG~i~T~~~~~~~~~~~~~~~~~~~~P~---------~R  217 (254)
T PRK07533        151 ----VVENYNLMGPVKAALESSVRYLAAELGPRGIRVHAISPGPLKTRAASGIDDFDALLEDARERAPL---------HR  217 (254)
T ss_pred             ----CCCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHCCCCCHHHHHHHHHHCCCC---------CC
T ss_conf             ----67773157889999999999999983766879999865777662320688759999999965998---------99


Q ss_pred             CCCCCCCCCCEEECCCC---CCCCCCCCCCCCC
Q ss_conf             13322220000000122---2222211135786
Q gi|254780920|r  223 WLYVEDHVRALYLVLKK---GRIGERYNIGGNN  252 (358)
Q Consensus       223 fi~v~D~a~~i~~~~~~---~~~~~~fNigs~~  252 (358)
                      +.-.+|+++++..++..   ...|+++.+.+|-
T Consensus       218 ~~~pedvA~~v~fL~Sd~a~~iTG~~i~vDGG~  250 (254)
T PRK07533        218 LVDIDDVGAVAAFLASDAARALTGNTLYIDGGY  250 (254)
T ss_pred             CCCHHHHHHHHHHHHCCHHCCCCCCEEEECCCC
T ss_conf             989999999999995883248558817879393


No 219
>KOG3019 consensus
Probab=99.19  E-value=1.6e-11  Score=89.80  Aligned_cols=276  Identities=15%  Similarity=0.083  Sum_probs=157.6

Q ss_pred             EEECCCCHHHHHHHH-----HHHHHCC----CEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCC
Q ss_conf             997678827799999-----9998689----8799994788765856777620379749997638899999999862278
Q gi|254780920|r    4 IVTGGAGFIGSALCR-----YLVNDLK----IQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQP   74 (358)
Q Consensus         4 LItG~tGfIGs~l~~-----~Ll~~~~----~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~   74 (358)
                      ++-+++|+|+.+|..     ++- +.+    |.|.++.|.....            +++|-..|-.-..      -  ..
T Consensus        16 ~~~~~~g~i~~nl~~~~~~~H~t-~~~~a~~h~vtv~sR~pg~~------------ritw~el~~~Gip------~--sc   74 (315)
T KOG3019          16 VSNWSNGIIRENLGSETSCCHDT-NVHSADNHAVTVLSRSPGKA------------RITWPELDFPGIP------I--SC   74 (315)
T ss_pred             CCCCCCCCHHCCCCCCCCCCCCC-CCCCCCCCCEEEEECCCCCC------------CCCCCHHCCCCCC------E--EH
T ss_conf             88766640320136763001248-88865543169996489975------------2345022079985------0--26


Q ss_pred             CEEEEECCC-CCCCCCCCCCCCCCCCCC-----CCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCC
Q ss_conf             717851234-332222222222222222-----22202478886512322112478427863055431122222222222
Q gi|254780920|r   75 DAIVNFAAE-SHVDRSILGADEFITTNI-----IGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSED  148 (358)
Q Consensus        75 d~ViHlAa~-~~~~~~~~~p~~~~~~Nv-----~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~  148 (358)
                      +.+.+++++ ...+..  .-...++-+|     ..|..+.++....       -...+.+|..|-.++|-..+..-++|+
T Consensus        75 ~a~vna~g~n~l~P~r--RWsp~fqkev~gSRi~~t~~la~aI~~a-------Pq~~~~~Vlv~gva~y~pS~s~eY~e~  145 (315)
T KOG3019          75 VAGVNAVGNNALLPIR--RWSPEFQKEVKGSRIRVTSKLADAINNA-------PQEARPTVLVSGVAVYVPSESQEYSEK  145 (315)
T ss_pred             HHHHHHHHHHCCCCHH--HCCHHHHHHHHCCEEEHHHHHHHHHHCC-------CCCCCCEEEEEEEEEECCCCCCCCCCC
T ss_conf             8777566553249232--1697788775324200889999998549-------887877589876688614511003322


Q ss_pred             CCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222222333221000000123332222222222222333222-2222222222222222222222223322113322
Q gi|254780920|r  149 MPYNPSSPYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHF-PEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVE  227 (358)
Q Consensus       149 ~~~~p~s~Yg~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~-~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~  227 (358)
                      .+....+..+.  +..|.-..+..-...++.+++|.+.|.|.++. ..++++-|  ++-.|+|+   |+|+|..+|||++
T Consensus       146 ~~~qgfd~~sr--L~l~WE~aA~~~~~~~r~~~iR~GvVlG~gGGa~~~M~lpF--~~g~GGPl---GsG~Q~fpWIHv~  218 (315)
T KOG3019         146 IVHQGFDILSR--LCLEWEGAALKANKDVRVALIRIGVVLGKGGGALAMMILPF--QMGAGGPL---GSGQQWFPWIHVD  218 (315)
T ss_pred             CCCCCHHHHHH--HHHHHHHHHHCCCCCEEEEEEEEEEEEECCCCCHHHHHHHH--HHCCCCCC---CCCCEEEEEEEHH
T ss_conf             65677579999--98988887634676404799997579833874012322222--30367867---8877443356667


Q ss_pred             CCCCCEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCC-EEECCCCCCCCCEECC-----CHHHH
Q ss_conf             22000000012222222111357864202688999988603426555686430-2334889986530031-----71899
Q gi|254780920|r  228 DHVRALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTEL-IRFIEDRPGHDRRYAI-----DSSKI  301 (358)
Q Consensus       228 D~a~~i~~~~~~~~~~~~fNigs~~~~s~~e~~~~i~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~-----d~~K~  301 (358)
                      |+|..+..+++++...++.|-..+++++..|+++.+...+....-.....--. .-|.+.|.    -..+     -..|+
T Consensus       219 DL~~li~~ale~~~v~GViNgvAP~~~~n~Ef~q~lg~aL~Rp~~~pvP~fvvqA~fG~erA----~~vLeGqKV~Pqra  294 (315)
T KOG3019         219 DLVNLIYEALENPSVKGVINGVAPNPVRNGEFCQQLGSALSRPSWLPVPDFVVQALFGPERA----TVVLEGQKVLPQRA  294 (315)
T ss_pred             HHHHHHHHHHHCCCCCCEECCCCCCCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHCCCCE----EEEEECCCCCCHHH
T ss_conf             78999999975689774234658984405899999998857885357709999987474440----69960770143667


Q ss_pred             HHHHCCCCCCC-HHHHHHHHH
Q ss_conf             99818966108-999999999
Q gi|254780920|r  302 KSEIGWFPQEN-MESGLNKTV  321 (358)
Q Consensus       302 ~~~Lgw~p~~~-l~egi~~~i  321 (358)
                      .+ +||+.+|. +.++++..+
T Consensus       295 l~-~Gf~f~yp~vk~Al~~i~  314 (315)
T KOG3019         295 LE-LGFEFKYPYVKDALRAIM  314 (315)
T ss_pred             HH-CCCEEECHHHHHHHHHHH
T ss_conf             64-376330647999999974


No 220
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional
Probab=99.18  E-value=4.3e-11  Score=87.12  Aligned_cols=217  Identities=12%  Similarity=0.043  Sum_probs=126.2

Q ss_pred             EEEEECCCC--HHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH-CCCCEEEEECCCCCHHHHHHHHHHC-----C
Q ss_conf             489976788--2779999999986898799994788765856777620-3797499976388999999998622-----7
Q gi|254780920|r    2 RLIVTGGAG--FIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS-QSNLFSFLQVDICDRECIRSALKEF-----Q   73 (358)
Q Consensus         2 kILItG~tG--fIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~-~~~~v~~i~~Di~d~~~l~~~~~~~-----~   73 (358)
                      ++||||++|  =||..+++.|+++ |.+|+...+..  ........+. .......+++|++|+++++++++..     +
T Consensus        12 ~alITGaag~~GIG~aiA~~la~~-GA~V~i~~~~~--~~~~~~~~l~~~~g~~~~~~~Dvtd~~~v~~~v~~~~~~~G~   88 (272)
T PRK08159         12 RGLILGVANNRSIAWGIAKACRAA-GAELAFTYQGD--ALKKRVEPLAAELGAFVVGHCDVTDEASIDAVFETLEKKWGK   88 (272)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHC-CCEEEEECCCH--HHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCC
T ss_conf             999988999868999999999986-99999974866--899999999986498189983789999999999999998699


Q ss_pred             CCEEEEECCCCCCCC--------CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCC
Q ss_conf             871785123433222--------222222222222222202478886512322112478427863055431122222222
Q gi|254780920|r   74 PDAIVNFAAESHVDR--------SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLF  145 (358)
Q Consensus        74 ~d~ViHlAa~~~~~~--------~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~  145 (358)
                      +|.++|.|+......        ..++....++.|+.+...+...+...      ... .-.+|.+||.....       
T Consensus        89 iDiLVnnag~~~~~~~~~~~~d~~~~~~~~~~~vn~~~~~~~~~~~~~~------m~~-ggsIv~iss~~~~~-------  154 (272)
T PRK08159         89 LDFVVHAIGFSDKDELTGRYVDTSEDNFSMTMLISVYSLTAVAQRAEKL------MTD-GGSILTLTYYGAEK-------  154 (272)
T ss_pred             CCEEEECCCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH------CCC-CCCEEEEEEECCCC-------
T ss_conf             7889853544666445665432889999999988868999999887654------047-87034787541233-------


Q ss_pred             CCCCCCCC-CCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCC
Q ss_conf             22222222-2222333221000000123332---22222222222233322222222222---22222222222222223
Q gi|254780920|r  146 SEDMPYNP-SSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIPLA---ITRMIEGSHVFLYGDGQ  218 (358)
Q Consensus       146 ~E~~~~~p-~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~~~---i~~~~~g~~~~i~g~g~  218 (358)
                           ..| .++|+.+|.+.+.+++..+.++   |+++-.+-|+.+.-+..  . .++.+   .+......|+       
T Consensus       155 -----~~p~~~~y~~sKaAl~~ltr~lA~elg~~gIRVNaVaPG~i~T~~~--~-~~~~~~~~~~~~~~~~pl-------  219 (272)
T PRK08159        155 -----VMPHYNVMGVAKAALEASVRYLAVDLGPKNIRVNAISAGPIKTLAA--S-GIGDFRYILKWNEYNAPL-------  219 (272)
T ss_pred             -----CCCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCHH--C-CCCCHHHHHHHHHHCCCC-------
T ss_conf             -----4775202567899999999999997578998999986377777100--0-487789999868737997-------


Q ss_pred             CCCCCCCCCCCCCCEEECCCC---CCCCCCCCCCCCC
Q ss_conf             322113322220000000122---2222211135786
Q gi|254780920|r  219 NVRDWLYVEDHVRALYLVLKK---GRIGERYNIGGNN  252 (358)
Q Consensus       219 ~~Rdfi~v~D~a~~i~~~~~~---~~~~~~fNigs~~  252 (358)
                        +-+.-.+|++.++..++..   ...|+++.+.+|-
T Consensus       220 --~R~g~pedvA~av~fL~Sd~s~~iTGq~l~VDGG~  254 (272)
T PRK08159        220 --RRTVTIEEVGDSALYLLSDLSRGVTGEVHHVDSGY  254 (272)
T ss_pred             --CCCCCHHHHHHHHHHHHCCHHCCCCCCEEEECCCH
T ss_conf             --89849999999999995862158548708879692


No 221
>PRK05884 short chain dehydrogenase; Provisional
Probab=99.17  E-value=7.2e-11  Score=85.73  Aligned_cols=201  Identities=16%  Similarity=0.203  Sum_probs=122.3

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC--CCCEEE
Q ss_conf             948997678827799999999868987999947887658567776203797499976388999999998622--787178
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEF--QPDAIV   78 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~--~~d~Vi   78 (358)
                      ||||||||++-||+.+++.|.++ |++|+..++..     ..+......-..+.+.+|++|.+.++++...+  ..|.++
T Consensus         1 ~~VlVTGgs~GIG~aiA~~la~~-Ga~V~i~~r~~-----~~l~~~~~el~~~~~~~d~~d~~~~~~~~~~~~~~~d~lv   74 (223)
T PRK05884          1 MEVLVTGGDTDLGRTIAEGFRND-GHKVTLVGARR-----DDLEVAAKELDVDAIVCDNTDPASLEEARGLFPHHLDTIV   74 (223)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCH-----HHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHHHCCEE
T ss_conf             93999878879999999999987-99999995987-----8999998534876899852788999999999998619478


Q ss_pred             EECCCC---CCCC--CCCC----CCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             512343---3222--2222----222222222222024788865123221124784278630554311222222222222
Q gi|254780920|r   79 NFAAES---HVDR--SILG----ADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDM  149 (358)
Q Consensus        79 HlAa~~---~~~~--~~~~----p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~  149 (358)
                      |.++..   ..+.  ...+    ....++.|+.++..+..++....      +. .-++|.+||...             
T Consensus        75 n~~~~~~~~~~~~~~~~~d~~~~w~~~~~~nl~~~~~~~~~~~~~m------~~-~G~Iini~s~~~-------------  134 (223)
T PRK05884         75 NVPAPSWDAGDPRTYSLADTANAWRNALDATVLSAVLTVQSVGDHL------RS-GGSIINVVPENP-------------  134 (223)
T ss_pred             EEEEEECCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHC------CC-CCEEEEEECCCC-------------
T ss_conf             8412302478755562121599999999999799999999999861------58-987999945767-------------


Q ss_pred             CCCCCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222222333221000000123332---222222222222333222222222222222222222222222332211332
Q gi|254780920|r  150 PYNPSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYV  226 (358)
Q Consensus       150 ~~~p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v  226 (358)
                       +. .+.|+.+|.+...+.+..+.++   |+++-.+-|+.+..|..          ..+ ...+..            -.
T Consensus       135 -~~-~~~~~asKaal~~~t~~lA~e~~~~gIrVN~IaPG~~~~~~~----------~~~-~~~~~~------------~~  189 (223)
T PRK05884        135 -PA-GSADAAIKAALSNWTAGQAEVFGTRGITINAVACGRSVQPGY----------DGL-SRTPPP------------VA  189 (223)
T ss_pred             -CC-CCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHH----------HHH-HCCCCC------------CH
T ss_conf             -88-758999999999999999999676597997980799888315----------687-168999------------78


Q ss_pred             CCCCCCEEECCC-C--CCCCCCCCCCCCC
Q ss_conf             222000000012-2--2222211135786
Q gi|254780920|r  227 EDHVRALYLVLK-K--GRIGERYNIGGNN  252 (358)
Q Consensus       227 ~D~a~~i~~~~~-~--~~~~~~fNigs~~  252 (358)
                      +|+++....+.. .  ...|+++.+.+|-
T Consensus       190 ~evA~~~~FLaS~~as~iTGq~i~VDGG~  218 (223)
T PRK05884        190 AEIARLALFLTTPAARHITGQTLHVSHGA  218 (223)
T ss_pred             HHHHHHHHHHCCCHHCCEECCEEEECCCC
T ss_conf             99999999980943187427478958681


No 222
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional
Probab=99.16  E-value=3.7e-11  Score=87.46  Aligned_cols=221  Identities=11%  Similarity=0.003  Sum_probs=125.9

Q ss_pred             EEEEECCCCHHH--HHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEE-EEECCCCCHHHHHHHHHH-----CC
Q ss_conf             489976788277--9999999986898799994788765856777620379749-997638899999999862-----27
Q gi|254780920|r    2 RLIVTGGAGFIG--SALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFS-FLQVDICDRECIRSALKE-----FQ   73 (358)
Q Consensus         2 kILItG~tGfIG--s~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~-~i~~Di~d~~~l~~~~~~-----~~   73 (358)
                      ++|||||++=+|  ..+++.+. +.|.+|+...+.  .......+.+....... ..++|++|++.+++++..     .+
T Consensus        10 ~alVTGaa~g~Gig~aia~~~~-~~Ga~V~i~~~~--~~~~~~~~~l~~~~g~~~~~~~Dvt~~~~v~~~~~~~~~~~G~   86 (260)
T PRK06603         10 KGLITGIANNMSISWAIAQLAK-KHGAELWFTYQS--EVLEKRVKPLAEEIGCNFVSELDVTNPKSISNLFDDIKEKWGS   86 (260)
T ss_pred             EEEEECCCCCHHHHHHHHHHHH-HCCCEEEEECCC--HHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHCC
T ss_conf             8999899996689999999999-879999996686--7999999999984383769865799999999999999998699


Q ss_pred             CCEEEEECCCCCCCC--------CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCC
Q ss_conf             871785123433222--------222222222222222202478886512322112478427863055431122222222
Q gi|254780920|r   74 PDAIVNFAAESHVDR--------SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLF  145 (358)
Q Consensus        74 ~d~ViHlAa~~~~~~--------~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~  145 (358)
                      +|+++|.|+......        ..++....++.|+.++..+..++...      . .+.-++|.+||....-       
T Consensus        87 iDiLVnnag~~~~~~~~~~~~d~~~~~~~~~~~~n~~~~~~~~~~a~~~------m-~~~GsIi~iss~~~~~-------  152 (260)
T PRK06603         87 FDFLLHGMAFADKNELKGRYVDTSLENFHNSLHISCYSLLELSRSAEAL------M-HDGGSIVTLTYYGAEK-------  152 (260)
T ss_pred             CCEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH------H-CCCCCCCCCCCCCCCC-------
T ss_conf             7789964423777656775102989999999999989999999997787------4-1797302342210013-------


Q ss_pred             CCCCCCCC-CCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222222-222233322100000012333---22222222222223332222222222222222222222222223322
Q gi|254780920|r  146 SEDMPYNP-SSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVR  221 (358)
Q Consensus       146 ~E~~~~~p-~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~R  221 (358)
                           ..| .+.|+.+|.+.+.+.+..+.+   +++++-.+-|+.+.-+....-.-.+.+........|+.         
T Consensus       153 -----~~p~~~~Y~asKaal~~ltr~lA~ela~~gIRVNaIaPG~i~T~~~~~~~~~~~~~~~~~~~~Pl~---------  218 (260)
T PRK06603        153 -----VIPNYNVMGVAKAALEASVKYLANDMGENNIRVNAISAGPIKTLASSAIGDFSTMLKSHAATAPLK---------  218 (260)
T ss_pred             -----CCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCHHHHCCCHHHHHHHHHHCCCCC---------
T ss_conf             -----478642006659999999999999966348089997327765642220467799999998579989---------


Q ss_pred             CCCCCCCCCCCEEECCCC---CCCCCCCCCCCCCC
Q ss_conf             113322220000000122---22222111357864
Q gi|254780920|r  222 DWLYVEDHVRALYLVLKK---GRIGERYNIGGNNE  253 (358)
Q Consensus       222 dfi~v~D~a~~i~~~~~~---~~~~~~fNigs~~~  253 (358)
                      -+...+|++.++..++..   ...|+++.+-+|-+
T Consensus       219 R~g~pedia~~~~FLaSd~s~~iTG~~i~vDGG~s  253 (260)
T PRK06603        219 RNTTQEDVGGAAVYLFSELSKGVTGEIHYVDCGYN  253 (260)
T ss_pred             CCCCHHHHHHHHHHHHCCHHCCCCCCEEEECCCCC
T ss_conf             99599999999999966822372587178897980


No 223
>KOG1205 consensus
Probab=99.16  E-value=1.6e-10  Score=83.56  Aligned_cols=164  Identities=20%  Similarity=0.209  Sum_probs=110.8

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHH----HHHHCCCCEEEEECCCCCHHHHHHHHHH-----C
Q ss_conf             489976788277999999998689879999478876585677----7620379749997638899999999862-----2
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSL----KEISQSNLFSFLQVDICDRECIRSALKE-----F   72 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~----~~~~~~~~v~~i~~Di~d~~~l~~~~~~-----~   72 (358)
                      -|+||||+.=||.+|+.+|.+. |.+++.+.++.  .++..+    +.....+++..+++|++|.++++++++.     .
T Consensus        14 vVvITGASsGIG~~lA~~la~~-G~~l~lvar~~--rrl~~v~~~l~~~~~~~~v~~~~~Dvs~~~~~~~~~~~~~~~fg   90 (282)
T KOG1205          14 VVLITGASSGIGEALAYELAKR-GAKLVLVARRA--RRLERVAEELRKLGSLEKVLVLQLDVSDEESVKKFVEWAIRHFG   90 (282)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCCEEEEEHHH--HHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHHCC
T ss_conf             8999578717889999999867-77347742432--02899999999747867647996765887889999999998658


Q ss_pred             CCCEEEEECCCCCCCCCC----CCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCC
Q ss_conf             787178512343322222----2222222222222202478886512322112478427863055431122222222222
Q gi|254780920|r   73 QPDAIVNFAAESHVDRSI----LGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSED  148 (358)
Q Consensus        73 ~~d~ViHlAa~~~~~~~~----~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~  148 (358)
                      +.|+.++-|+.+......    .+-...+++|+.|+..+..++--.     ..+.+.-+||.+||.+-+  . ..     
T Consensus        91 ~vDvLVNNAG~~~~~~~~~~~~~~~~~~mdtN~~G~V~~Tk~alp~-----m~~r~~GhIVvisSiaG~--~-~~-----  157 (282)
T KOG1205          91 RVDVLVNNAGISLVGFLEDTDIEDVRNVMDTNVFGTVYLTKAALPS-----MKKRNDGHIVVISSIAGK--M-PL-----  157 (282)
T ss_pred             CCCEEEECCCCCCCCCCCCCCHHHHHHHHHHHCHHHHHHHHHHHHH-----HHHCCCCEEEEEECCCCC--C-CC-----
T ss_conf             8888984686565553344768988877100040248999999887-----663289749998061015--5-78-----


Q ss_pred             CCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCC
Q ss_conf             222222222333221000000123332222222222
Q gi|254780920|r  149 MPYNPSSPYSATKASSDYLVLAWGHTYGIPVLLSNC  184 (358)
Q Consensus       149 ~~~~p~s~Yg~sK~~~E~~~~~~~~~~~l~~~ilR~  184 (358)
                       |.  .+.|..||.|.+-+...++.++.-..++++.
T Consensus       158 -P~--~~~Y~ASK~Al~~f~etLR~El~~~~~~i~i  190 (282)
T KOG1205         158 -PF--RSIYSASKHALEGFFETLRQELIPLGTIIII  190 (282)
T ss_pred             -CC--CCCCCHHHHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             -86--5541567999999999999996405845999


No 224
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase; InterPro: IPR011283   This entry represent acetoacetyl-CoA reductase, a member of the family short-chain-alcohol dehydrogenases. Note that, despite the precision implied by the enzyme name, the reaction of 1.1.1.36 from EC is defined more generally as (R)-3-hydroxyacyl-CoA + NADP+ = 3-oxoacyl-CoA + NADPH. Members of this family may act in the biosynthesis of poly-beta-hydroxybutyrate (e.g. Rhizobium meliloti) and related poly-beta-hydroxyalkanoates. Note that the member of this family from Azospirillum brasilense, designated NodG, appears to lack acetoacetyl-CoA reductase activity and to act instead in the production of nodulation factor. ; GO: 0018454 acetoacetyl-CoA reductase activity, 0042619 poly-hydroxybutyrate biosynthetic process, 0005737 cytoplasm.
Probab=99.16  E-value=1.1e-10  Score=84.55  Aligned_cols=213  Identities=23%  Similarity=0.265  Sum_probs=132.9

Q ss_pred             EE-EEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCC-----CEEEEECCCCCHHHHHHHHHHC---
Q ss_conf             48-99767882779999999986898799994788765856777620379-----7499976388999999998622---
Q gi|254780920|r    2 RL-IVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSN-----LFSFLQVDICDRECIRSALKEF---   72 (358)
Q Consensus         2 kI-LItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~-----~v~~i~~Di~d~~~l~~~~~~~---   72 (358)
                      || |||||+|=||+.+|++|.++ ||.|++-  . .+++...-+++.+..     .+.++++|+.|.++....+++.   
T Consensus         1 rvALVTGg~GGIGtAIC~rL~~d-G~~V~An--~-~p~N~~~a~~W~~~~~~~g~~~~~~~~DV~~~e~c~~~v~~v~a~   76 (244)
T TIGR01829         1 RVALVTGGTGGIGTAICTRLAKD-GYRVAAN--Y-VPSNEERAEAWLQEQGAQGFDFAVVEGDVSSFEDCKAAVAKVEAE   76 (244)
T ss_pred             CEEEEECCCCCHHHHHHHHHHHC-CCEEEEC--C-CCCCHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHHHHHC
T ss_conf             94788578774468999999875-9889881--7-898258999999862698514789872767778999999999971


Q ss_pred             --CCCEEEEECCCCC----CCCCCCCCCCCCCCCCCCCCH----HHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCC
Q ss_conf             --7871785123433----222222222222222222202----478886512322112478427863055431122222
Q gi|254780920|r   73 --QPDAIVNFAAESH----VDRSILGADEFITTNIIGTFI----LLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDK  142 (358)
Q Consensus        73 --~~d~ViHlAa~~~----~~~~~~~p~~~~~~Nv~gt~n----il~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~  142 (358)
                        .+|++++.|+.+-    -....++-.+.+++|+.+..|    |++.|+         ..+-=|+|.+||.  -|....
T Consensus        77 lGpvDvLVNNAGITRD~~F~KM~~~qW~~VI~TNL~SvFNVT~pV~~gM~---------eRGwGRIiNISSv--NG~KGQ  145 (244)
T TIGR01829        77 LGPVDVLVNNAGITRDKTFKKMTYEQWSEVIDTNLNSVFNVTRPVIEGMR---------ERGWGRIINISSV--NGQKGQ  145 (244)
T ss_pred             CCCEEEEEECCCCCCCHHHCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHH---------HCCCCCEEEEEEE--CCCCCC
T ss_conf             19536898688644030312499846888986313244155400147662---------1688416884121--477565


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCC--CC-CCCCC-CCCCCCCCCCC
Q ss_conf             222222222222222333221000000123332---2222222222223332222222--22-22222-22222222222
Q gi|254780920|r  143 GLFSEDMPYNPSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKL--IP-LAITR-MIEGSHVFLYG  215 (358)
Q Consensus       143 ~~~~E~~~~~p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~--i~-~~i~~-~~~g~~~~i~g  215 (358)
                               -.++=|+.+|+-..=+.++.+++.   |+.+=.+=|+.+-     ++++  +| ..+.+ +..+=|+.-+|
T Consensus       146 ---------fGQtNYSAAKAG~iGFTkALA~E~A~kGvTVN~i~PGYi~-----T~MV~A~redVl~~rIva~IP~~RLg  211 (244)
T TIGR01829       146 ---------FGQTNYSAAKAGMIGFTKALAQEGARKGVTVNVIAPGYIA-----TDMVMAVREDVLQSRIVAQIPVKRLG  211 (244)
T ss_pred             ---------CCHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCC-----CHHHHHHHHHHHHCCCCCCCCCCCCC
T ss_conf             ---------4304589886215677799997211038567545588988-----66778636888740577889832157


Q ss_pred             CCCCCCCCCCCCCCCCCEE-ECCCCCC--CCCCCCCCCCC
Q ss_conf             2233221133222200000-0012222--22211135786
Q gi|254780920|r  216 DGQNVRDWLYVEDHVRALY-LVLKKGR--IGERYNIGGNN  252 (358)
Q Consensus       216 ~g~~~Rdfi~v~D~a~~i~-~~~~~~~--~~~~fNigs~~  252 (358)
                      .|+.         .|.++. ++.+...  .|+.+.|-+|.
T Consensus       212 ~PeE---------IA~aV~fLase~agy~TG~tL~~NGGl  242 (244)
T TIGR01829       212 RPEE---------IAAAVAFLASEEAGYVTGATLSINGGL  242 (244)
T ss_pred             CHHH---------HHHHHHHHHHHCCCEECCCCCCCCCCC
T ss_conf             8157---------888998865410330016657768876


No 225
>PRK06197 short chain dehydrogenase; Provisional
Probab=99.16  E-value=1.1e-10  Score=84.70  Aligned_cols=179  Identities=15%  Similarity=0.147  Sum_probs=109.8

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCC--HHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC-----CCC
Q ss_conf             8997678827799999999868987999947887658--567776203797499976388999999998622-----787
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGN--LNSLKEISQSNLFSFLQVDICDRECIRSALKEF-----QPD   75 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~--~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d   75 (358)
                      |+||||+.=||...+++|++ .|+.|+..-|....+.  ...+.......+++++.+|+.+.++++++.+++     +.|
T Consensus        19 ~lITGa~sGIG~~~A~~La~-~ga~Vil~~R~~~k~~~a~~~i~~~~~~~~i~~~~lDLssl~sV~~~a~~~~~~~~~lD   97 (306)
T PRK06197         19 AVVTGANTGLGYETAAALAA-KGAHVVLAVRNLDKGNAAAARITAAHPGADVTLQELDLASLASVRAAADALRAAYPRID   97 (306)
T ss_pred             EEECCCCCHHHHHHHHHHHH-CCCEEEEEECCHHHHHHHHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHHHHCCCCCC
T ss_conf             99916895999999999997-84989999798999999999999768998579997664307789999999996189876


Q ss_pred             EEEEECCCCCCCC--CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCC-C-CCCCCCCCCCCCC
Q ss_conf             1785123433222--2222222222222222024788865123221124784278630554311-2-2222222222222
Q gi|254780920|r   76 AIVNFAAESHVDR--SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVY-G-SLDKGLFSEDMPY  151 (358)
Q Consensus        76 ~ViHlAa~~~~~~--~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vY-g-~~~~~~~~E~~~~  151 (358)
                      +.|+-|+...++.  ..+.-+..+.+|.+|-.-+......  ..   ......|+|..||..-. + ...-..++.+..+
T Consensus        98 vLinNAGi~~~~~~~T~dG~E~~f~vN~lghflLt~lLl~--~l---~~~~~~RIV~vsS~~h~~~~~~~~ddl~~~~~y  172 (306)
T PRK06197         98 LLINNAGVMYTPKQTTADGFELQFGTNHLGHFALTGLLLD--RL---LPVPGSRVVTVSSGGHRIRAAIHFDDLQWERRY  172 (306)
T ss_pred             EEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH--HH---HCCCCCCEEEEECHHHHCCCCCCCCCCCCCCCC
T ss_conf             8997784456887226765333333313688888887778--75---315788269994457605778884245765678


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCCC---CCCCCC--CCCCCC
Q ss_conf             222222333221000000123332---222222--222222
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGHTY---GIPVLL--SNCSNN  187 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~i--lR~~~v  187 (358)
                      .+...|+.||++.-......+++.   +.++++  +.|+.|
T Consensus       173 ~~~~aY~~SKLanilft~eL~rrl~~~~~~v~~~a~hPG~v  213 (306)
T PRK06197        173 NRVAAYGQSKLANLLFTYELQRRLAAAGATTIAVAAHPGVS  213 (306)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCC
T ss_conf             74788888899999999999998760599869999279861


No 226
>PRK05855 short chain dehydrogenase; Validated
Probab=99.16  E-value=6.1e-11  Score=86.17  Aligned_cols=219  Identities=16%  Similarity=0.076  Sum_probs=128.6

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH-CCCCEEEEECCCCCHHHHHHHHHH----C-CCCE
Q ss_conf             899767882779999999986898799994788765856777620-379749997638899999999862----2-7871
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS-QSNLFSFLQVDICDRECIRSALKE----F-QPDA   76 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~-~~~~v~~i~~Di~d~~~l~~~~~~----~-~~d~   76 (358)
                      ++||||+.=||..++..|.+ .|.+|+..|+..... ..-...+. .......+.+|++|.+.++.+++.    + .+|+
T Consensus       318 AvVTGA~sGIGrA~A~~fA~-~GA~Vvl~Dr~~~~l-~eta~ei~~~G~~a~~~~~DVtd~~av~al~~~v~~~~G~iDI  395 (582)
T PRK05855        318 VVVTGAGSGIGRATALAFAR-EGAEVVASDIDEAAA-ERTAALIRAAGAVAHAYRVDVSDADAMEALAEWVGAEHGVPDI  395 (582)
T ss_pred             EEEECCCCHHHHHHHHHHHH-CCCEEEEECCCHHHH-HHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCCE
T ss_conf             99958757899999999997-799999960799999-9999999951984899975589999999999999997699999


Q ss_pred             EEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCC-CEEEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             785123433222----222222222222222202478886512322112478-427863055431122222222222222
Q gi|254780920|r   77 IVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKD-QFRFLQISTDEVYGSLDKGLFSEDMPY  151 (358)
Q Consensus        77 ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~-~~~~v~~SS~~vYg~~~~~~~~E~~~~  151 (358)
                      +++.|+......    +.++-...+++|+.|+.+...+.-..     ..+.+ .-+||.+||.+-+-           +.
T Consensus       396 LVNNAGI~~~g~~~d~s~e~w~~v~dVNl~Gv~~~~ra~lp~-----M~~rg~gG~IVNiSSiag~~-----------~~  459 (582)
T PRK05855        396 VVNNAGIGMAGGFLDTSAEEWDRVLDVNLWGVIHGCRLFGRQ-----MVERGTGGHIVNVASAAAYA-----------PS  459 (582)
T ss_pred             EEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCCEEEEECCHHHCC-----------CC
T ss_conf             998987589978032999999999988649999999999999-----99649980899967864577-----------89


Q ss_pred             CCCCCCCCCCCCCEEEECCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222223332210000001233---3222222222222233322222222222222222222222222233221133222
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGH---TYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVED  228 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~---~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D  228 (358)
                      ...+.|+.||.+...+.+..+.   .+|+.++.+-|+.|-=+--... .++..-..-.....- -.....+.| -...++
T Consensus       460 p~~~aY~ASKaAV~gftesLr~ELa~~GI~V~aVcPG~I~T~I~~~a-~~~g~~~~~~~~~~~-~~~~~~~~~-~~~Pe~  536 (582)
T PRK05855        460 RSLPAYATSKAAVLMLSECLRAELAEAGIGVTAICPGFVDTNIVATT-RFAGADAEDEARRRK-RADKLYARR-GYGPEK  536 (582)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCC-CCCCCCHHHHHHHHH-HHHHHHHCC-CCCHHH
T ss_conf             88646899999999999999998530297799993184646755556-647876025677888-776665405-999999


Q ss_pred             CCCCEEECCCCCCC
Q ss_conf             20000000122222
Q gi|254780920|r  229 HVRALYLVLKKGRI  242 (358)
Q Consensus       229 ~a~~i~~~~~~~~~  242 (358)
                      +|++++.++++++.
T Consensus       537 vA~~Il~aV~rnr~  550 (582)
T PRK05855        537 VAKAIVSAVKRNKA  550 (582)
T ss_pred             HHHHHHHHHHCCCC
T ss_conf             99999999855998


No 227
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional
Probab=99.16  E-value=5.3e-11  Score=86.53  Aligned_cols=223  Identities=15%  Similarity=0.048  Sum_probs=123.5

Q ss_pred             EEEEECCCC--HHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH-CCCCEEEEECCCCCHHHHHHHHHHC-----C
Q ss_conf             489976788--2779999999986898799994788765856777620-3797499976388999999998622-----7
Q gi|254780920|r    2 RLIVTGGAG--FIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS-QSNLFSFLQVDICDRECIRSALKEF-----Q   73 (358)
Q Consensus         2 kILItG~tG--fIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~-~~~~v~~i~~Di~d~~~l~~~~~~~-----~   73 (358)
                      ++|||||++  =||..+++.|.++ |.+|+..++..  .......++. .......+++|++|.+.+++++++.     +
T Consensus         8 ~alVTGaa~~~GiG~aiA~~la~~-GA~V~i~~~~~--~~~~~~~~~~~~~~~~~~~~~Dvs~~~~v~~~~~~~~~~~g~   84 (262)
T PRK07984          8 RILVTGVASKLSIAYGIAQAMHRE-GAELAFTYQND--KLKGRVEEFAAQLGSDIVLQCDVAEDASIDAMFAELGKVWPK   84 (262)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHC-CCEEEEEECCH--HHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHCC
T ss_conf             799989999725999999999987-99999982777--899999999975498289988899999999999999998387


Q ss_pred             CCEEEEECCCCCCCCCCCCCCC---------CCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCC
Q ss_conf             8717851234332222222222---------2222222220247888651232211247842786305543112222222
Q gi|254780920|r   74 PDAIVNFAAESHVDRSILGADE---------FITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGL  144 (358)
Q Consensus        74 ~d~ViHlAa~~~~~~~~~~p~~---------~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~  144 (358)
                      +|.++|.|+.........++.+         .++.|..+...+..+++.      .. .....++.+||.....      
T Consensus        85 iD~lVnnag~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~~-~~~~~iv~iss~~~~~------  151 (262)
T PRK07984         85 FDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRS------ML-NPGSALLTLSYLGAER------  151 (262)
T ss_pred             CCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------HH-CCCCEEEEEECHHHCC------
T ss_conf             7889995022763224631788860999999998878999999998887------51-4797599995044326------


Q ss_pred             CCCCCCCCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222222222233322100000012333---22222222222223332222222222222222222222222223322
Q gi|254780920|r  145 FSEDMPYNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVR  221 (358)
Q Consensus       145 ~~E~~~~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~R  221 (358)
                           +.-..+.|+.+|.+.+.+.+..+.+   +|+++-.+.|+.+--+......-...+........|+         +
T Consensus       152 -----~~p~~~~y~~sKaal~~ltr~lA~el~~~gIRVNaIaPG~i~T~~~~~~~~~~~~~~~~~~~~Pl---------~  217 (262)
T PRK07984        152 -----AIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPI---------R  217 (262)
T ss_pred             -----CCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCHHCCCCCHHHHHHHHHHCCCC---------C
T ss_conf             -----67872088888889999999999994858879999864776552001486779999999867998---------9


Q ss_pred             CCCCCCCCCCCEEECCCC---CCCCCCCCCCCCCCC
Q ss_conf             113322220000000122---222221113578642
Q gi|254780920|r  222 DWLYVEDHVRALYLVLKK---GRIGERYNIGGNNER  254 (358)
Q Consensus       222 dfi~v~D~a~~i~~~~~~---~~~~~~fNigs~~~~  254 (358)
                      -+...+|++.++..++..   ...|+++++.+|-+.
T Consensus       218 R~g~pediA~~v~fL~Sd~s~~iTG~~i~VDGG~tl  253 (262)
T PRK07984        218 RTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSI  253 (262)
T ss_pred             CCCCHHHHHHHHHHHHCCHHCCCCCCEEEECCCHHH
T ss_conf             995999999999999686425843873896949766


No 228
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only]
Probab=99.14  E-value=1.8e-10  Score=83.32  Aligned_cols=167  Identities=23%  Similarity=0.223  Sum_probs=109.5

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH-CC--CCEEEEECCCCC-HHHHHHHHHHC----
Q ss_conf             94899767882779999999986898799994788765856777620-37--974999763889-99999998622----
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS-QS--NLFSFLQVDICD-RECIRSALKEF----   72 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~-~~--~~v~~i~~Di~d-~~~l~~~~~~~----   72 (358)
                      +.||||||++-||..+++.|+ +.|+.|+++.+.............. ..  ..+.+.++|+++ .+.++.+++..    
T Consensus         6 k~vlITGas~GiG~aia~~l~-~~G~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dv~~~~~~v~~~~~~~~~~~   84 (251)
T COG1028           6 KVALVTGASSGIGRAIARALA-REGARVVVAARRSEEEAAEALAAAIKEAGGGRAAAVAADVSDDEESVEALVAAAEEEF   84 (251)
T ss_pred             CEEEEECCCCHHHHHHHHHHH-HCCCEEEEEECCCCHHHHHHHHHHHHHCCCCCEEEEEEECCCCHHHHHHHHHHHHHHC
T ss_conf             889998988718999999999-8899799996797351699999997545787279997208999999999999999971


Q ss_pred             -CCCEEEEECCCCCC----C-CCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCC
Q ss_conf             -78717851234332----2-22222222222222222024788865123221124784278630554311222222222
Q gi|254780920|r   73 -QPDAIVNFAAESHV----D-RSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFS  146 (358)
Q Consensus        73 -~~d~ViHlAa~~~~----~-~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~  146 (358)
                       .+|+++|.|+....    . ...++....+++|+.|+..+..++....      ...  ++|.+||..-+ ....   .
T Consensus        85 g~idvlvnnAg~~~~~~~~~~~~~~~~~~~~~~n~~g~~~~~~~~~~~~------~~~--~Iv~isS~~~~-~~~~---~  152 (251)
T COG1028          85 GRIDILVNNAGIAGPDAPLEELTEEDWDRVIDVNLLGAFLLTRAALPLM------KKQ--RIVNISSVAGL-GGPP---G  152 (251)
T ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH------HCC--EEEEECCCCCC-CCCC---C
T ss_conf             9987999998676457872337999999999998399999999863662------335--89998852103-7887---7


Q ss_pred             CCCCCCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCC
Q ss_conf             2222222222233322100000012333---2222222222222
Q gi|254780920|r  147 EDMPYNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNN  187 (358)
Q Consensus       147 E~~~~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~v  187 (358)
                             ...|+.||.+.+.+.+.++.+   +|+.+..+-|+.+
T Consensus       153 -------~~~Y~~sK~al~~~~~~la~el~~~gI~v~~v~PG~~  189 (251)
T COG1028         153 -------QAAYAASKAALIGLTKALALELAPRGIRVNAVAPGYI  189 (251)
T ss_pred             -------CHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCC
T ss_conf             -------3079999999999999999982416879999964986


No 229
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional
Probab=99.14  E-value=6.1e-11  Score=86.18  Aligned_cols=219  Identities=12%  Similarity=0.045  Sum_probs=120.3

Q ss_pred             EEEEEC--CCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC-----CC
Q ss_conf             489976--78827799999999868987999947887658567776203797499976388999999998622-----78
Q gi|254780920|r    2 RLIVTG--GAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEF-----QP   74 (358)
Q Consensus         2 kILItG--~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~   74 (358)
                      ++||||  ++.=||..+++.|+++ |.+|+..++..... ...+.. ........+++|++|.++++++++..     ++
T Consensus         9 ~~lVTG~~~~~GIG~a~A~~la~~-GA~Vvi~~~~~~~~-~~~~~~-~~~~~~~~i~~Dv~~~~~v~~~~~~~~~~~G~l   85 (256)
T PRK07889          9 RILVTGVITDSSIAFHIARVAQEQ-GAEVVLTGFRRLRL-TERIAK-RLPEPAPVLELDVTNEEHLASLADRVREHIGGL   85 (256)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHC-CCEEEEEECCCHHH-HHHHHH-HCCCCCEEEEEECCCHHHHHHHHHHHHHHHCCC
T ss_conf             799989988568999999999987-99999983893589-999998-658887599942889999999999999986897


Q ss_pred             CEEEEECCCCCCCC----C-----CCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCC
Q ss_conf             71785123433222----2-----22222222222222202478886512322112478427863055431122222222
Q gi|254780920|r   75 DAIVNFAAESHVDR----S-----ILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLF  145 (358)
Q Consensus        75 d~ViHlAa~~~~~~----~-----~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~  145 (358)
                      |.++|.|+......    .     +.+-...++.|..+...+..++..      .. ...-++|.+|+....+.      
T Consensus        86 D~lVnnag~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~~-~~gg~Iv~~s~~~~~~~------  152 (256)
T PRK07889         86 DGVVHSIGFAPQTALGGNPFLDAPWEDVATALHISAYSLASLAKALLP------LM-NPGGSIVGLDFDATVAW------  152 (256)
T ss_pred             CEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH------HH-CCCCCEEEECCCCCCCC------
T ss_conf             879742134774434676520035888888998999999999999765------42-16887467457555456------


Q ss_pred             CCCCCCCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222222222233322100000012333---22222222222223332222222222--22222222222222222332
Q gi|254780920|r  146 SEDMPYNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPL--AITRMIEGSHVFLYGDGQNV  220 (358)
Q Consensus       146 ~E~~~~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~--~i~~~~~g~~~~i~g~g~~~  220 (358)
                            -..+.|+.+|.+.+.+.+..+.+   +|+++-.+-|+.+--+...   -++.  ......... ..+      .
T Consensus       153 ------p~~~~y~asKaal~~ltr~lA~el~~~gIRVNaVaPG~i~T~~~~---~~~~~~~~~~~~~~~-~pl------~  216 (256)
T PRK07889        153 ------PAYDWMGVAKAALESTNRYLARELGPRGVRSNLVAAGPIRTLAAK---AIPGFELLEEGWDQR-APL------G  216 (256)
T ss_pred             ------CCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCHHHH---CCCCHHHHHHHHHHC-CCC------C
T ss_conf             ------742467778999999999999997340979999974788773443---379869999999866-998------8


Q ss_pred             CCCCCCCCCCCCEEECCCC---CCCCCCCCCCCCC
Q ss_conf             2113322220000000122---2222211135786
Q gi|254780920|r  221 RDWLYVEDHVRALYLVLKK---GRIGERYNIGGNN  252 (358)
Q Consensus       221 Rdfi~v~D~a~~i~~~~~~---~~~~~~fNigs~~  252 (358)
                      |.+...+|+++++..++..   ...|+++.+.+|-
T Consensus       217 ~r~~~pediA~~v~fL~Sd~s~~iTG~~l~VDGG~  251 (256)
T PRK07889        217 WDMKDPTPVAKTVVALLSDWFPATTGEIIHVDGGA  251 (256)
T ss_pred             CCCCCHHHHHHHHHHHHCCHHCCCCCCEEEECCCC
T ss_conf             78989999999999996782237168858879590


No 230
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional
Probab=99.13  E-value=9.2e-11  Score=85.09  Aligned_cols=224  Identities=9%  Similarity=0.011  Sum_probs=128.4

Q ss_pred             EEEEEC--CCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHC-CCCEEEEECCCCCHHHHHHHHHHC-----C
Q ss_conf             489976--78827799999999868987999947887658567776203-797499976388999999998622-----7
Q gi|254780920|r    2 RLIVTG--GAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQ-SNLFSFLQVDICDRECIRSALKEF-----Q   73 (358)
Q Consensus         2 kILItG--~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~-~~~v~~i~~Di~d~~~l~~~~~~~-----~   73 (358)
                      ++||||  +++=||..+++.|+++ |.+|...+...  ......+.... ......+++|++|.+.+++++.+.     .
T Consensus         8 ~~lVTGa~~~~GIG~aia~~la~~-Ga~v~~~~~~~--~~~~~~~~~~~~~g~~~~~~~Dv~~~~~v~~~~~~~~~~~G~   84 (261)
T PRK08690          8 KILITGMISERSIAYGIAKACREQ-GAELAFTYVVD--KLEERVRKMAAELDSELVFRCDVASDDEINQVFADLGKHWDG   84 (261)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHC-CCEEEEECCCC--HHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHCC
T ss_conf             899989878638999999999985-99999973761--559999999987398089988999999999999999999689


Q ss_pred             CCEEEEECCCCCCCCCCCC---------CCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCC
Q ss_conf             8717851234332222222---------2222222222220247888651232211247842786305543112222222
Q gi|254780920|r   74 PDAIVNFAAESHVDRSILG---------ADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGL  144 (358)
Q Consensus        74 ~d~ViHlAa~~~~~~~~~~---------p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~  144 (358)
                      .|+++|.|+......-..+         -...++.|+.+...+..+++..      .+...-.+|.+||......     
T Consensus        85 iD~LVnnaG~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~g~Ii~iss~~~~~~-----  153 (261)
T PRK08690         85 LDGLVHSIGFAPKEALSGDFLDSISREAFNTAHEISAYSLPALAKAARPM------MRGRNSAIVALSYLGAVRA-----  153 (261)
T ss_pred             CCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------HCCCCCCEEEEEEEEEECC-----
T ss_conf             87897525547633345424756159999999998767789999987687------6057841465433320015-----


Q ss_pred             CCCCCCCCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222222222233322100000012333---22222222222223332222222222222222222222222223322
Q gi|254780920|r  145 FSEDMPYNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVR  221 (358)
Q Consensus       145 ~~E~~~~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~R  221 (358)
                            ....+.|+.+|.+.+.+++..+.+   +|+++-.+.|+.+.-+....-.-...+........|+.         
T Consensus       154 ------~~~~~~y~~sKaal~~ltr~lA~el~~~gIRVN~I~PG~i~T~~~~~~~~~~~~~~~~~~~~Pl~---------  218 (261)
T PRK08690        154 ------IPNYNVMGMAKASLEAGIRFTAACLGKEGIRCNGISAGPIKTLAASGIADFGKLLGHVAAHNPLR---------  218 (261)
T ss_pred             ------CCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHCCCCHHHHHHHHHHCCCCC---------
T ss_conf             ------66310457889999999999999725896899898777885544424787699999998679989---------


Q ss_pred             CCCCCCCCCCCEEECCCC---CCCCCCCCCCCCCCC
Q ss_conf             113322220000000122---222221113578642
Q gi|254780920|r  222 DWLYVEDHVRALYLVLKK---GRIGERYNIGGNNER  254 (358)
Q Consensus       222 dfi~v~D~a~~i~~~~~~---~~~~~~fNigs~~~~  254 (358)
                      -+...+|++.++..++..   ...|+++.+-+|-++
T Consensus       219 R~g~peeia~~v~FL~Sd~ss~iTG~~i~VDGG~ti  254 (261)
T PRK08690        219 RNVTIEEVGNTAAFLLSDLSSGITGEITYVDGGYSI  254 (261)
T ss_pred             CCCCHHHHHHHHHHHHCCHHCCCCCCEEEECCCCCC
T ss_conf             994999999999999385524705863997969301


No 231
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional
Probab=99.12  E-value=7.8e-11  Score=85.51  Aligned_cols=221  Identities=13%  Similarity=0.024  Sum_probs=127.0

Q ss_pred             EEEEEC--CCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH-CCCCEEEEECCCCCHHHHHHHHHHC-----C
Q ss_conf             489976--7882779999999986898799994788765856777620-3797499976388999999998622-----7
Q gi|254780920|r    2 RLIVTG--GAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS-QSNLFSFLQVDICDRECIRSALKEF-----Q   73 (358)
Q Consensus         2 kILItG--~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~-~~~~v~~i~~Di~d~~~l~~~~~~~-----~   73 (358)
                      ++||||  ++.=||..+++.|+++ |.+|...++...  ......++. .......+++|++|.+.++++++..     .
T Consensus         8 ~~lVTG~a~~~GIG~aiA~~la~~-Ga~V~~~~~~~~--~~~~~~~~~~~~g~~~~~~~Dv~~~~~v~~~v~~~~~~~g~   84 (260)
T PRK06997          8 RILLTGLLSNRSIAYGIAKACKRE-GAELAFTYVGDR--FKDRITEFAAEFGSDLVFPCDVADDAQIDALFASLGTRWDG   84 (260)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHC-CCEEEEECCCHH--HHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHCC
T ss_conf             899989988728999999999985-999999808806--69999999986298479983799999999999999998499


Q ss_pred             CCEEEEECCCCCCCCC----C-----CCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCC
Q ss_conf             8717851234332222----2-----222222222222220247888651232211247842786305543112222222
Q gi|254780920|r   74 PDAIVNFAAESHVDRS----I-----LGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGL  144 (358)
Q Consensus        74 ~d~ViHlAa~~~~~~~----~-----~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~  144 (358)
                      +|.++|-|+......-    .     ++-...++.|..+...+..++...       ..+...++.+||.....      
T Consensus        85 iD~LVnNAG~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~k~~~~~-------~~~~g~iv~iss~~~~~------  151 (260)
T PRK06997         85 LDGLVHSIGFAPREAIAGDFLDGLTRENFRIAHDISAYSFPALAKAALPM-------LSDDASLLTLSYLGAER------  151 (260)
T ss_pred             CCEEEECCCCCCCCCCCCCHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-------HCCCCCCCCCEEEECEE------
T ss_conf             89896447767732235334665589999999998889999999999876-------31677632301220100------


Q ss_pred             CCCCCCCCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222222222233322100000012333---22222222222223332222222222222222222222222223322
Q gi|254780920|r  145 FSEDMPYNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVR  221 (358)
Q Consensus       145 ~~E~~~~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~R  221 (358)
                           +.-..+.|+.+|.+.+.+.+..+.+   +|+++-.+.|+.+.-+....-.-.+.+.......-|+         +
T Consensus       152 -----~~p~~~~y~asKaal~~ltr~lA~elg~~gIRVNaV~PG~i~t~~~~~~~~~~~~~~~~~~~~Pl---------~  217 (260)
T PRK06997        152 -----VVPNYNTMGLAKASLEASVRYLAVSLGPKGIRVNAISAGPIKTLAASGIKDFGKILDFVESNAPL---------R  217 (260)
T ss_pred             -----CCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHCCCCHHHHHHHHHHCCCC---------C
T ss_conf             -----36874223778899999999999986117978988733753356652689759999999857998---------9


Q ss_pred             CCCCCCCCCCCEEECCCC---CCCCCCCCCCCCC
Q ss_conf             113322220000000122---2222211135786
Q gi|254780920|r  222 DWLYVEDHVRALYLVLKK---GRIGERYNIGGNN  252 (358)
Q Consensus       222 dfi~v~D~a~~i~~~~~~---~~~~~~fNigs~~  252 (358)
                      -+.-.+|++.++..++..   ...|+++++.+|-
T Consensus       218 R~g~peeiA~~v~FL~Sd~as~iTGq~i~VDGG~  251 (260)
T PRK06997        218 RNVTIEQVGNVAAFLLSDLASGVTGEITHVDSGF  251 (260)
T ss_pred             CCCCHHHHHHHHHHHHCCHHCCCCCCEEEECCCH
T ss_conf             9959999999999995835337058726879785


No 232
>COG2910 Putative NADH-flavin reductase [General function prediction only]
Probab=99.12  E-value=1.3e-10  Score=84.18  Aligned_cols=206  Identities=18%  Similarity=0.190  Sum_probs=130.4

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEE
Q ss_conf             94899767882779999999986898799994788765856777620379749997638899999999862278717851
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNF   80 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~ViHl   80 (358)
                      |||-|.||||.+|++++++.++ .||+|+++-|-     ...+.   .-+.+..++.||.|+..+.+.+.++  |+||-.
T Consensus         1 mKIaiIgAsG~~Gs~i~~EA~~-RGHeVTAivRn-----~~K~~---~~~~~~i~q~Difd~~~~a~~l~g~--DaVIsA   69 (211)
T COG2910           1 MKIAIIGASGKAGSRILKEALK-RGHEVTAIVRN-----ASKLA---ARQGVTILQKDIFDLTSLASDLAGH--DAVISA   69 (211)
T ss_pred             CEEEEEECCCHHHHHHHHHHHH-CCCEEEEEEEC-----HHHCC---CCCCCEEECCCCCCHHHHHHHHCCC--CEEEEE
T ss_conf             9078995374567999999986-79804899807-----67665---2235302000222745667663587--669972


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCC-CCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             23433222222222222222222202478886512322112478427863055-43112222222222222222222233
Q gi|254780920|r   81 AAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQIST-DEVYGSLDKGLFSEDMPYNPSSPYSA  159 (358)
Q Consensus        81 Aa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS-~~vYg~~~~~~~~E~~~~~p~s~Yg~  159 (358)
                      -+...     .++......   ....+++..+         ..++.|++..+- ++.|=++.  .--.++|.-|.-.|..
T Consensus        70 ~~~~~-----~~~~~~~~k---~~~~li~~l~---------~agv~RllVVGGAGSL~id~g--~rLvD~p~fP~ey~~~  130 (211)
T COG2910          70 FGAGA-----SDNDELHSK---SIEALIEALK---------GAGVPRLLVVGGAGSLEIDEG--TRLVDTPDFPAEYKPE  130 (211)
T ss_pred             CCCCC-----CCHHHHHHH---HHHHHHHHHH---------HCCCEEEEEECCCCCEEECCC--CEEECCCCCCHHHHHH
T ss_conf             15788-----871577888---9999999986---------159705999847420587688--4550589985667799


Q ss_pred             CCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCEEECCC
Q ss_conf             32210000001233322222222222223332222222222222222222222222-22332211332222000000012
Q gi|254780920|r  160 TKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYG-DGQNVRDWLYVEDHVRALYLVLK  238 (358)
Q Consensus       160 sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g-~g~~~Rdfi~v~D~a~~i~~~~~  238 (358)
                      ++..+|.+-. ......++.+-+-|+-.+-|++.+.+        ...|+...+.+ .|+   ++|...|.|-+++--++
T Consensus       131 A~~~ae~L~~-Lr~~~~l~WTfvSPaa~f~PGerTg~--------yrlggD~ll~n~~G~---SrIS~aDYAiA~lDe~E  198 (211)
T COG2910         131 ALAQAEFLDS-LRAEKSLDWTFVSPAAFFEPGERTGN--------YRLGGDQLLVNAKGE---SRISYADYAIAVLDELE  198 (211)
T ss_pred             HHHHHHHHHH-HHHCCCCCEEEECCHHHCCCCCCCCC--------EEECCCEEEECCCCC---EEEEHHHHHHHHHHHHH
T ss_conf             9877899999-86356764599671784577655685--------676363577748885---03448999999998774


Q ss_pred             CCCC-CCCCCC
Q ss_conf             2222-221113
Q gi|254780920|r  239 KGRI-GERYNI  248 (358)
Q Consensus       239 ~~~~-~~~fNi  248 (358)
                      ++.. .+.|-+
T Consensus       199 ~~~h~rqRftv  209 (211)
T COG2910         199 KPQHIRQRFTV  209 (211)
T ss_pred             CCCCCCEEEEE
T ss_conf             64531125641


No 233
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only]
Probab=99.11  E-value=2.3e-10  Score=82.62  Aligned_cols=207  Identities=20%  Similarity=0.206  Sum_probs=131.1

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCC---CCEEEEECCCCCHHHHHHHHH----HC-CC
Q ss_conf             89976788277999999998689879999478876585677762037---974999763889999999986----22-78
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQS---NLFSFLQVDICDRECIRSALK----EF-QP   74 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~---~~v~~i~~Di~d~~~l~~~~~----~~-~~   74 (358)
                      ||||||+.=||...++.|.+. |++|+...|+     .+++..+...   ..+..+..|++|++.++.+++    .+ ++
T Consensus         9 ~lITGASSGiG~A~A~~l~~~-G~~vvl~aRR-----~drL~~la~~~~~~~~~~~~~DVtD~~~~~~~i~~~~~~~g~i   82 (246)
T COG4221           9 ALITGASSGIGEATARALAEA-GAKVVLAARR-----EERLEALADEIGAGAALALALDVTDRAAVEAAIEALPEEFGRI   82 (246)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECC-----HHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCC
T ss_conf             999468656889999999978-9969998636-----8899999986256743789613678899999999999751760


Q ss_pred             CEEEEECCCCCCCC-C---CCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             71785123433222-2---2222222222222220247888651232211247842786305543112222222222222
Q gi|254780920|r   75 DAIVNFAAESHVDR-S---ILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMP  150 (358)
Q Consensus        75 d~ViHlAa~~~~~~-~---~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~  150 (358)
                      |+.+|-|+....+. .   .++-...+++|+.|.++...+.--.     ....+.-.+|.+||.+-     ..      +
T Consensus        83 DiLvNNAGl~~g~~~~~~~~~dw~~Mid~Ni~G~l~~~~avLP~-----m~~r~~G~IiN~~SiAG-----~~------~  146 (246)
T COG4221          83 DILVNNAGLALGDPLDEADLDDWDRMIDTNVKGLLNGTRAVLPG-----MVERKSGHIINLGSIAG-----RY------P  146 (246)
T ss_pred             CEEEECCCCCCCCHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEEECCCCC-----CC------C
T ss_conf             58996687776870354899999999998889999999886668-----88647963999535133-----36------6


Q ss_pred             CCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCC
Q ss_conf             222222233322100000012333---2222222222222333222222222222222222222-222222332211332
Q gi|254780920|r  151 YNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHV-FLYGDGQNVRDWLYV  226 (358)
Q Consensus       151 ~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~-~i~g~g~~~Rdfi~v  226 (358)
                      +-..+.|+.||.+...+....+.+   ++++++.+-|+-|-...      ++.. +.--..+.. .++    ..-.++..
T Consensus       147 y~~~~vY~ATK~aV~~fs~~LR~e~~g~~IRVt~I~PG~v~~~~------~s~v-~~~g~~~~~~~~y----~~~~~l~p  215 (246)
T COG4221         147 YPGGAVYGATKAAVRAFSLGLRQELAGTGIRVTVISPGLVETTE------FSTV-RFEGDDERADKVY----KGGTALTP  215 (246)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCEECCEE------CCCC-CCCCHHHHHHHHH----CCCCCCCH
T ss_conf             79986002369999999999998733798469986376021000------3434-6874066677776----05877998


Q ss_pred             CCCCCCEEECCCCCCC
Q ss_conf             2220000000122222
Q gi|254780920|r  227 EDHVRALYLVLKKGRI  242 (358)
Q Consensus       227 ~D~a~~i~~~~~~~~~  242 (358)
                      +|.|+++..+++.+..
T Consensus       216 ~dIA~~V~~~~~~P~~  231 (246)
T COG4221         216 EDIAEAVLFAATQPQH  231 (246)
T ss_pred             HHHHHHHHHHHHCCCC
T ss_conf             9999999999859985


No 234
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional
Probab=99.08  E-value=3.2e-10  Score=81.78  Aligned_cols=220  Identities=19%  Similarity=0.143  Sum_probs=130.6

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC--CCCEEEE
Q ss_conf             48997678827799999999868987999947887658567776203797499976388999999998622--7871785
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEF--QPDAIVN   79 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~--~~d~ViH   79 (358)
                      .+|||||++=||..+++.|+++ |.+|+++|+.....           ....++++|++|++.++++++..  +.|.++|
T Consensus         7 ~alVTG~s~GIG~aia~~la~~-GA~V~~~d~~~~~~-----------~~~~~~~~D~~~~~~v~~~v~~~~g~id~lvn   74 (261)
T PRK12428          7 TIVVTGVASGIGAEVARLLRFL-GARVIGLDRRPPGM-----------TLDGFHQADLGDPASIDAAVAALPGRIDALFN   74 (261)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCCCCC-----------CCCCEEECCCCCHHHHHHHHHHHCCCCCEEEE
T ss_conf             8999785779999999999986-99999996885545-----------61317673789999999999983798878998


Q ss_pred             ECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCC----C------CCC--
Q ss_conf             1234332222222222222222222024788865123221124784278630554311222222----2------222--
Q gi|254780920|r   80 FAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKG----L------FSE--  147 (358)
Q Consensus        80 lAa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~----~------~~E--  147 (358)
                      +|+.+..    .++....+.|..|+..+.+......       .....++.++|..-.......    .      +..  
T Consensus        75 ~Ag~~~~----~~~~~~~~vn~~g~~~~~~~~~~~~-------~~~~~ivn~~s~~~~~~~~~~~~~~~~~~~~~~~~~~  143 (261)
T PRK12428         75 VAGVPGT----GPPELVARVNFLGLRHLTEALLPRL-------APGGAIVNVSSLAGAGWPERLELHKALAATASFDEGL  143 (261)
T ss_pred             CCCCCCC----CCHHHHHHHHHHHHHHHHHHHHHHH-------HCCCEEEEEECHHHHCCCCCHHHHHHHHHCCCHHHHH
T ss_conf             6777875----4288999898899999999999986-------5287599960123311211014565553002124567


Q ss_pred             ----CCCCCCCCCCCCCCCCCEEEECCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             ----2222222222333221000000123----33222222222222233322222222222222222222222222233
Q gi|254780920|r  148 ----DMPYNPSSPYSATKASSDYLVLAWG----HTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQN  219 (358)
Q Consensus       148 ----~~~~~p~s~Yg~sK~~~E~~~~~~~----~~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~  219 (358)
                          .++......|+.||.+...+.+..+    ..+|+++-.+-|+.+.-|..      ..+...... +...  .....
T Consensus       144 ~~~~~~~~~~~~~Y~asK~al~~~t~~~a~~~l~~~gIRvNaV~PG~i~T~~~------~~~~~~~~~-~~~~--~~~~P  214 (261)
T PRK12428        144 AWLAEHPVALGTGYQLSKEALILWTMRQAQPWFGARGIRVNCVAPGPVETPIL------GQFRSMLGQ-ERVD--SDAKR  214 (261)
T ss_pred             HHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCHHH------HHHHHHCCH-HHHH--HCCCC
T ss_conf             88863477653589999999999999999999746497798874065777557------988865339-8997--43067


Q ss_pred             CCCCCCCCCCCCCEEECCCC---CCCCCCCCCCCCCC
Q ss_conf             22113322220000000122---22222111357864
Q gi|254780920|r  220 VRDWLYVEDHVRALYLVLKK---GRIGERYNIGGNNE  253 (358)
Q Consensus       220 ~Rdfi~v~D~a~~i~~~~~~---~~~~~~fNigs~~~  253 (358)
                      ..-+...+|++.++..++..   .-.|+++.+.+|-.
T Consensus       215 lgR~g~peeiA~~v~fLaSd~as~iTG~~i~VDGG~s  251 (261)
T PRK12428        215 LGRPATADEQAAVLVFLCSDAARWINGVNLPVDGGLA  251 (261)
T ss_pred             CCCCCCHHHHHHHHHHHHCCHHCCCCCCEEECCCCHH
T ss_conf             6898099999999999949632573684288291688


No 235
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=99.08  E-value=2.3e-10  Score=82.61  Aligned_cols=218  Identities=19%  Similarity=0.127  Sum_probs=132.7

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             8997678827799999999868987999947887658567776203797499976388999999998622-----78717
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEF-----QPDAI   77 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d~V   77 (358)
                      .|||||+.=||..+++.|..+ |.+|+++|...   ....+......-+-..+.+|+++.+.++++++..     .+|++
T Consensus       210 ALVTGAArGIG~AIA~~LAre-GA~VVi~Di~~---a~~~l~~~a~elgg~al~~DVt~~~a~~~lv~~~~~~~G~lDIL  285 (447)
T PRK08261        210 ALVTGAARGIGAAIAEVLARD-GAHVVCLDVPQ---AGDDLAAVAARLGGTALALDITAPDAPAKIAEHLAERHGGLDIV  285 (447)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCH---HHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             999172578999999999986-99999982711---48999999987098089953689999999999999964999899


Q ss_pred             EEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             85123433222----22222222222222220247888651232211247842786305543112222222222222222
Q gi|254780920|r   78 VNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNP  153 (358)
Q Consensus        78 iHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p  153 (358)
                      +|.|+......    ..++....+++|+.|+..+.+++...     ....+.-++|.+||.+-+-.           ...
T Consensus       286 VnNAGi~~~~~l~~~~~e~Wd~v~~vNl~g~~~l~qall~~-----m~~~~gG~IVnIsSiag~~g-----------~~g  349 (447)
T PRK08261        286 VHNAGITRDKTLANMDEARWDSVIAVNLLAPLRITEALLDN-----GALGDGGRIVCVSSISGIAG-----------NRG  349 (447)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEEECCEECCCC-----------CCC
T ss_conf             98997899977111999999999999869999999999997-----76547957998502000467-----------887


Q ss_pred             CCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222333221000000123332---2222222222223332222222222222222222222222223322113322220
Q gi|254780920|r  154 SSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV  230 (358)
Q Consensus       154 ~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~a  230 (358)
                      .+.|+.||.+...+.+..+.++   |+.+-.+-|+.+--+.   ...+|...+.+.  ..+.-.+      ..---+|+|
T Consensus       350 ~~~YaaSKaAv~~ltrslA~ela~~GIRVNaVaPG~I~T~m---ta~~p~~~re~~--rr~~sL~------r~G~PeDVA  418 (447)
T PRK08261        350 QTNYAASKAGVIGLVQALAPLLAARGITINAVAPGFIETQM---TAAIPFAIREAG--RRMNSLS------QGGLPVDVA  418 (447)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCH---HHCCCHHHHHHH--HHCCCCC------CCCCHHHHH
T ss_conf             42879999999999999999960409599999768888630---103773569998--8508667------897999999


Q ss_pred             CCEEECCCC---CCCCCCCCCCCC
Q ss_conf             000000122---222221113578
Q gi|254780920|r  231 RALYLVLKK---GRIGERYNIGGN  251 (358)
Q Consensus       231 ~~i~~~~~~---~~~~~~fNigs~  251 (358)
                      +++..+...   ...|.++.++++
T Consensus       419 ~aVaFLASd~A~~ITGqvL~VDG~  442 (447)
T PRK08261        419 ETIAWFASPASGAVTGNVVRVCGQ  442 (447)
T ss_pred             HHHHHHHCHHHCCCCCCEEEECCC
T ss_conf             999997094327987977898987


No 236
>KOG1203 consensus
Probab=99.07  E-value=4.3e-10  Score=80.97  Aligned_cols=162  Identities=12%  Similarity=0.098  Sum_probs=94.0

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCH-HHHHHHHHHCC--CCEE
Q ss_conf             94899767882779999999986898799994788765856777620379749997638899-99999986227--8717
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR-ECIRSALKEFQ--PDAI   77 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~-~~l~~~~~~~~--~d~V   77 (358)
                      |.|||+||||.+|+-+++.|++. |+.|.++-|. .............+....-+..+.... +.+..+.+...  ..+|
T Consensus        80 ~~VlVvGatG~vG~~iv~~llkr-gf~vra~VRd-~~~a~~~~~~~~~d~~~~~v~~~~~~~~d~~~~~~~~~~~~~~~v  157 (411)
T KOG1203          80 TTVLVVGATGKVGRRIVKILLKR-GFSVRALVRD-EQKAEDLLGVFFVDLGLQNVEADVVTAIDILKKLVEAVPKGVVIV  157 (411)
T ss_pred             CEEEEECCCCCHHHHHHHHHHHC-CCEEEEECCC-HHHHHHHHCCCCCCCCCCEEEECCCCCCCHHHHHHHHCCCCCEEE
T ss_conf             74999558873639999999977-9702342157-365544432533344422243022565412256663013453158


Q ss_pred             EEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCC--
Q ss_conf             851234332222222222222222222024788865123221124784278630554311222222222222222222--
Q gi|254780920|r   78 VNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSS--  155 (358)
Q Consensus        78 iHlAa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~s--  155 (358)
                      +-+++  +.+.- +|...-..+...|+.|+++||+.         .++++|++.||...   ..   +  ++++.+..  
T Consensus       158 ~~~~g--grp~~-ed~~~p~~VD~~g~knlvdA~~~---------aGvk~~vlv~si~~---~~---~--~~~~~~~~~~  217 (411)
T KOG1203         158 IKGAG--GRPEE-EDIVTPEKVDYEGTKNLVDACKK---------AGVKRVVLVGSIGG---TK---F--NQPPNILLLN  217 (411)
T ss_pred             EECCC--CCCCC-CCCCCCCEECHHHHHHHHHHHHH---------HCCCEEEEEEEECC---CC---C--CCCCHHHHHH
T ss_conf             74234--77875-45788442167888999999998---------38745999976347---64---6--7772555554


Q ss_pred             -CCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             -223332210000001233322222222222223
Q gi|254780920|r  156 -PYSATKASSDYLVLAWGHTYGIPVLLSNCSNNY  188 (358)
Q Consensus       156 -~Yg~sK~~~E~~~~~~~~~~~l~~~ilR~~~vy  188 (358)
                       .+-.+|+.+|.+++    ..|++++|+|+....
T Consensus       218 ~~~~~~k~~~e~~~~----~Sgl~ytiIR~g~~~  247 (411)
T KOG1203         218 GLVLKAKLKAEKFLQ----DSGLPYTIIRPGGLE  247 (411)
T ss_pred             HHHHHHHHHHHHHHH----HCCCCCEEEECCCCC
T ss_conf             435678776999998----658986799532100


No 237
>PRK06940 short chain dehydrogenase; Provisional
Probab=99.05  E-value=1.6e-10  Score=83.61  Aligned_cols=229  Identities=18%  Similarity=0.089  Sum_probs=129.5

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHH-HHHHC-CCCEEEEECCCCCHHHHHHHHHH----CCCC
Q ss_conf             489976788277999999998689879999478876585677-76203-79749997638899999999862----2787
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSL-KEISQ-SNLFSFLQVDICDRECIRSALKE----FQPD   75 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~-~~~~~-~~~v~~i~~Di~d~~~l~~~~~~----~~~d   75 (358)
                      ||+||||+|=||..+++.|. . |.+|+..|+....  .... +.+.. ...+..+++|++|.+.++.+++.    .++|
T Consensus         6 kV~v~tGa~GIG~aiA~~la-~-Ga~vvi~~~~~~~--l~~~~~~l~~~g~~~~~~~~Dvs~~~~v~~l~~~~~~~G~id   81 (277)
T PRK06940          6 EVVVVIGAGGMGQAIARRVG-S-GKTVLLADYNEEN--LQAVARTLREAGFDVITQQVDVSSRESVKALAQTAATLGAVT   81 (277)
T ss_pred             CEEEECCCCHHHHHHHHHHH-H-CCEEEEEECCHHH--HHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             29999781699999999998-1-9989999898899--999999987228829999825799899999999999869987


Q ss_pred             EEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCC--------------
Q ss_conf             178512343322222222222222222220247888651232211247842786305543112222--------------
Q gi|254780920|r   76 AIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLD--------------  141 (358)
Q Consensus        76 ~ViHlAa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~--------------  141 (358)
                      +++|.|+.+..   ...+...++.|+.++...++......      ..+.. .+++++..-+-.+.              
T Consensus        82 iLVnnAG~~~~---~~~~~~~~~~d~~~~~~~~~~~~~~~------~~~~~-~~~i~~~~~~~~~~~~~~~~~~~~~~~~  151 (277)
T PRK06940         82 GLVHTAGVSPS---QASPEAILKVDLYGTALVLEEFGKVI------APGGA-GVVIASMSGHRLPALTAEQEQALATTPT  151 (277)
T ss_pred             EEEECCCCCCC---CCCHHHHHHHHHHHHHHHHHHHHHHH------HHCCE-EEEEECHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             99988867866---57899999886688999999999999------84982-8998604443111445666545402676


Q ss_pred             ----CCCCC-CCCCCCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCC
Q ss_conf             ----22222-2222222222233322100000012333---22222222222223332222--22222222222222222
Q gi|254780920|r  142 ----KGLFS-EDMPYNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFP--EKLIPLAITRMIEGSHV  211 (358)
Q Consensus       142 ----~~~~~-E~~~~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~--~~~i~~~i~~~~~g~~~  211 (358)
                          ..+.- -.....+...|+.+|.+...+.+..+.+   +|+++-++-|+.+.-|....  ..--..+.+++....|+
T Consensus       152 ~~i~~~~~~~~~~~~~~~~aY~~sK~a~~~ltk~lA~e~a~~gIRVN~V~PG~i~T~~~~~~~~~~~~~~~~~~~~~~P~  231 (277)
T PRK06940        152 EELLSLPFLQPDSIEDPLHAYQFAKRANVLRVRAAAVKWGARGARINSISPGIISTPMGQDELAGPRGDGYRAMIAKSGT  231 (277)
T ss_pred             CCEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEECCEECCHHHHHHCCCCHHHHHHHHHCCCC
T ss_conf             52664100023335632399999999999999999999986496577875576727356877536658999999856998


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCEEECCCC---CCCCCCCCCCCCCC
Q ss_conf             2222223322113322220000000122---22222111357864
Q gi|254780920|r  212 FLYGDGQNVRDWLYVEDHVRALYLVLKK---GRIGERYNIGGNNE  253 (358)
Q Consensus       212 ~i~g~g~~~Rdfi~v~D~a~~i~~~~~~---~~~~~~fNigs~~~  253 (358)
                      .         -+-..+|++.++..++..   ...|..+.+.+|-+
T Consensus       232 g---------R~g~peeia~~v~FL~Sd~as~iTG~~i~VDGG~t  267 (277)
T PRK06940        232 G---------RIGTPDDIAAAAEFLMGPEGSFITGADLLVDGGVT  267 (277)
T ss_pred             C---------CCCCHHHHHHHHHHHHCCHHCCCCCCEEEECCCCC
T ss_conf             9---------98789999999999958443694484389585710


No 238
>KOG1208 consensus
Probab=99.02  E-value=1.1e-09  Score=78.61  Aligned_cols=183  Identities=19%  Similarity=0.191  Sum_probs=119.1

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCC--HHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC-----CC
Q ss_conf             48997678827799999999868987999947887658--567776203797499976388999999998622-----78
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGN--LNSLKEISQSNLFSFLQVDICDRECIRSALKEF-----QP   74 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~--~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~   74 (358)
                      .++||||+.=||..++++|..+ |..|+...|-...+.  ...+..-.....+.++++|+.+.+++.++-+.+     ..
T Consensus        37 ~~vVTGansGIG~eta~~La~~-Ga~Vv~~~R~~~~~~~~~~~i~~~~~~~~i~~~~lDLssl~SV~~fa~~~~~~~~~l  115 (314)
T KOG1208          37 VALVTGATSGIGFETARELALR-GAHVVLACRNEERGEEAKEQIQKGKANQKIRVIQLDLSSLKSVRKFAEEFKKKEGPL  115 (314)
T ss_pred             EEEEECCCCCHHHHHHHHHHHC-CCEEEEEECCHHHHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHHHHHCCCCC
T ss_conf             7999589884379999999957-998999847778899999999710877636999879999999999999998517876


Q ss_pred             CEEEEECCCCCCCCC--CCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCC--CCCCCCCC
Q ss_conf             717851234332222--22222222222222202478886512322112478427863055431122222--22222222
Q gi|254780920|r   75 DAIVNFAAESHVDRS--ILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDK--GLFSEDMP  150 (358)
Q Consensus        75 d~ViHlAa~~~~~~~--~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~--~~~~E~~~  150 (358)
                      |+.|+-|+...++..  .+.-+..+.+|..|...+.+......  .   .....|+|+.||..- +....  ..-.|...
T Consensus       116 dvLInNAGV~~~~~~~t~DG~E~~~~tN~lg~flLt~lLlp~l--k---~s~~~RIV~vsS~~~-~~~~~~~~l~~~~~~  189 (314)
T KOG1208         116 DVLINNAGVMAPPFSLTKDGLELTFATNYLGHFLLTELLLPLL--K---RSAPSRIVNVSSILG-GGKIDLKDLSGEKAK  189 (314)
T ss_pred             CEEEECCCCCCCCCCCCCCCHHHEEECCCHHHHHHHHHHHHHH--H---HCCCCCEEEEECCCC-CCCCCHHHCCCHHHC
T ss_conf             5898655223676545654411300023299999999999998--5---378976799806534-676653323623313


Q ss_pred             -CCCCCCCCCCCCCCEEEECCCCCCC--CCCCCCCCCCCCCCCC
Q ss_conf             -2222222333221000000123332--2222222222223332
Q gi|254780920|r  151 -YNPSSPYSATKASSDYLVLAWGHTY--GIPVLLSNCSNNYGPY  191 (358)
Q Consensus       151 -~~p~s~Yg~sK~~~E~~~~~~~~~~--~l~~~ilR~~~vyGp~  191 (358)
                       +...-.|+.||++.......++++.  |+.+..+.|+.|..+.
T Consensus       190 ~~~~~~~Y~~SKla~~l~~~eL~k~l~~~V~~~~~hPG~v~t~~  233 (314)
T KOG1208         190 LYSSDAAYALSKLANVLLANELAKRLKKGVTTYSVHPGVVKTTG  233 (314)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCC
T ss_conf             55506788886998999999999885549669986786121544


No 239
>KOG1210 consensus
Probab=98.95  E-value=2.5e-09  Score=76.26  Aligned_cols=208  Identities=22%  Similarity=0.271  Sum_probs=126.7

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHH----HHHHHHCCCCEEEEECCCCCHHHHHHHHHHC-----
Q ss_conf             4899767882779999999986898799994788765856----7776203797499976388999999998622-----
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLN----SLKEISQSNLFSFLQVDICDRECIRSALKEF-----   72 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~----~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~-----   72 (358)
                      +|+||||+-=||..|+..+.. .|++|...-+..  ....    .+....+...+.|..+|+.|++.+.++++..     
T Consensus        35 hi~itggS~glgl~la~e~~~-~ga~Vti~ar~~--~kl~~a~~~l~l~~~~~~v~~~S~d~~~Y~~v~~~~~~l~~~~~  111 (331)
T KOG1210          35 HILITGGSSGLGLALALECKR-EGADVTITARSG--KKLLEAKAELELLTQVEDVSYKSVDVIDYDSVSKVIEELRDLEG  111 (331)
T ss_pred             EEEEECCCCHHHHHHHHHHHH-CCCCEEEEECCH--HHHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCC
T ss_conf             699816841566899999997-037429994648--78999874311444353036753553028999988763233048


Q ss_pred             CCCEEEEECCCCCCCCCCCC----CCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCC-CCCCCCCCCCCCCC
Q ss_conf             78717851234332222222----22222222222202478886512322112478427863055-43112222222222
Q gi|254780920|r   73 QPDAIVNFAAESHVDRSILG----ADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQIST-DEVYGSLDKGLFSE  147 (358)
Q Consensus        73 ~~d~ViHlAa~~~~~~~~~~----p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS-~~vYg~~~~~~~~E  147 (358)
                      -||.+||||+...+....+.    -...+++|.+||.|+..++...   .....+.. +|+.+|| .+.+|         
T Consensus       112 ~~d~l~~cAG~~v~g~f~~~s~~~v~~~m~vNylgt~~v~~~~~~~---mk~~~~~g-~I~~vsS~~a~~~---------  178 (331)
T KOG1210         112 PIDNLFCCAGVAVPGLFEDLSPEVVEKLMDVNYLGTVNVAKAAARA---MKKREHLG-RIILVSSQLAMLG---------  178 (331)
T ss_pred             CCCEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH---HHCCCCCC-EEEEEHHHHHHCC---------
T ss_conf             9502787067655420013999999998875534467999999998---63225684-7998433254167---------


Q ss_pred             CCCCCCCCCCCCCCCCCEEEECCCCC---CCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222222223332210000001233---3222222222222233322-2222222222222222222222222332211
Q gi|254780920|r  148 DMPYNPSSPYSATKASSDYLVLAWGH---TYGIPVLLSNCSNNYGPYH-FPEKLIPLAITRMIEGSHVFLYGDGQNVRDW  223 (358)
Q Consensus       148 ~~~~~p~s~Yg~sK~~~E~~~~~~~~---~~~l~~~ilR~~~vyGp~~-~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdf  223 (358)
                         ...-+.|+.+|.+.--+.....+   .+++.++..-|++.--|+- ..+...|.. .++..       | |..   -
T Consensus       179 ---i~GysaYs~sK~alrgLa~~l~qE~i~~~v~Vt~~~P~~~~tpGfE~En~tkP~~-t~ii~-------g-~ss---~  243 (331)
T KOG1210         179 ---IYGYSAYSPSKFALRGLAEALRQELIKYGVHVTLYYPPDTLTPGFERENKTKPEE-TKIIE-------G-GSS---V  243 (331)
T ss_pred             ---CCCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEEECCCCCCCCCCCCCCCCCCHH-EEEEC-------C-CCC---C
T ss_conf             ---5664135607899999999999987652669999728987897643102367421-03100-------7-888---7


Q ss_pred             CCCCCCCCCEEECCCCC
Q ss_conf             33222200000001222
Q gi|254780920|r  224 LYVEDHVRALYLVLKKG  240 (358)
Q Consensus       224 i~v~D~a~~i~~~~~~~  240 (358)
                      +--+++|.++..-+.++
T Consensus       244 ~~~e~~a~~~~~~~~rg  260 (331)
T KOG1210         244 IKCEEMAKAIVKGMKRG  260 (331)
T ss_pred             CCHHHHHHHHHHHHHHC
T ss_conf             68899999998677606


No 240
>PRK08303 short chain dehydrogenase; Provisional
Probab=98.94  E-value=1.7e-09  Score=77.28  Aligned_cols=173  Identities=14%  Similarity=0.070  Sum_probs=105.7

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCC-----CHHHHH----HHH-CCCCEEEEECCCCCHHHHHHHHHHC
Q ss_conf             899767882779999999986898799994788765-----856777----620-3797499976388999999998622
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAG-----NLNSLK----EIS-QSNLFSFLQVDICDRECIRSALKEF   72 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~-----~~~~~~----~~~-~~~~v~~i~~Di~d~~~l~~~~~~~   72 (358)
                      +|||||+.=||+.++..|.++ |.+|++.++.....     ..+.++    .+. ...+...+++|++|++.++.+++..
T Consensus        11 AlVTGasrGIGraiA~~LA~~-GA~V~i~~r~~~~~~~~~~~~e~l~e~a~~i~~~Gg~~~~v~~Dvsd~~~v~~~v~~~   89 (305)
T PRK08303         11 ALVAGATRGAGRGIAVELGAA-GATVYVTGRSTRARRSEYDRPETIEETAELVTAAGGRGIAVQVDHLVPEQVRALVERI   89 (305)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCCHHCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHH
T ss_conf             999088758999999999987-9989998276110000012067999999999975990899975689999999999999


Q ss_pred             -----CCCEEEEECCCCCCCCC-----CCCC----CCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCC-CC
Q ss_conf             -----78717851234332222-----2222----222222222220247888651232211247842786305543-11
Q gi|254780920|r   73 -----QPDAIVNFAAESHVDRS-----ILGA----DEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDE-VY  137 (358)
Q Consensus        73 -----~~d~ViHlAa~~~~~~~-----~~~p----~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~-vY  137 (358)
                           ++|+++|-|+.......     ++.+    ...+++|+.+....-.++..     ...+.+.-++|.+||+. .+
T Consensus        90 ~~~~G~lDILVNNa~~~~~~~~~~~~~~~~~~e~~~~~~~vn~~~~~~~~~~a~p-----~m~~~~~G~IVnisS~~~~~  164 (305)
T PRK08303         90 DREQGRLDILVNDIWGGEKLFEWGKPVWEHSLDKGLRMLRLAVDTHLITSHHALP-----LLIRRPGGLVVEVTDGTAEY  164 (305)
T ss_pred             HHHCCCCCEEEECCCCCCCCCCCCCHHHHCCHHHHHHHHHHHHHHHHHHHHHHHH-----HHHHCCCCEEEEECCHHHCC
T ss_conf             9952962089855866654344680276617999999999998999999999999-----99877995899988555522


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCC
Q ss_conf             2222222222222222222233322100000012333---2222222222222333
Q gi|254780920|r  138 GSLDKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGP  190 (358)
Q Consensus       138 g~~~~~~~~E~~~~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp  190 (358)
                      +..         .+.....|+.||.+.+.+.+..+.+   +|+.+..+-|+.|-=|
T Consensus       165 ~~~---------~~~~~~~Y~asKaAv~~ltr~lA~Ela~~GIrVNaV~PG~i~T~  211 (305)
T PRK08303        165 NAT---------HYRLSVFYDLAKTAVLRLAFSLAHELAPHGATAVALTPGWLRSE  211 (305)
T ss_pred             CCC---------CCCCCHHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCH
T ss_conf             778---------87751989999999999999999997341919999963887755


No 241
>PRK08862 short chain dehydrogenase; Provisional
Probab=98.94  E-value=1.5e-09  Score=77.75  Aligned_cols=167  Identities=14%  Similarity=0.122  Sum_probs=102.6

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHH----C-C-CC
Q ss_conf             89976788277999999998689879999478876585677762-0379749997638899999999862----2-7-87
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEI-SQSNLFSFLQVDICDRECIRSALKE----F-Q-PD   75 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~-~~~~~v~~i~~Di~d~~~l~~~~~~----~-~-~d   75 (358)
                      ||||||++=||+.++++|.+. |.+|+..|+...... ...+.+ .....+..+.+|++|.+.+++++..    + + +|
T Consensus         8 ~lITGas~GIG~aiA~~~A~~-Ga~Vii~~r~~~~l~-~~~~~i~~~g~~~~~~~~d~~~~~~v~~~~~~i~~~~g~~iD   85 (227)
T PRK08862          8 ILITSAGSVLGRTISCHFARL-GATLILCDQDQSALN-DTYEQCSALTDNVYSYQLKDFSQESIRHLFDAIEQQFNRAPD   85 (227)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHHHH-HHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             999798879999999999987-999999969999999-999999975897489995166199999999999999589974


Q ss_pred             EEEEECCCCCCCCC-CCCC----CCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             17851234332222-2222----222222222220247888651232211247842786305543112222222222222
Q gi|254780920|r   76 AIVNFAAESHVDRS-ILGA----DEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMP  150 (358)
Q Consensus        76 ~ViHlAa~~~~~~~-~~~p----~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~  150 (358)
                      ++++.|+....+.. ...+    ...+.+|..+...+...+.....    .....-++|.+||...+             
T Consensus        86 vLVNNa~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~m~----~~~~~G~IINi~S~~~~-------------  148 (227)
T PRK08862         86 VLVNNWTSSPLPSLFDEQPSESFIQQLTSLASTLFTYGQVAAERMR----KRKKKGVIVNVISHDDH-------------  148 (227)
T ss_pred             EEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH----HCCCCEEEEEEEEECCC-------------
T ss_conf             9985664577886334588999999999865699999999999999----66998799999768766-------------


Q ss_pred             CCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCC
Q ss_conf             222222233322100000012333---222222222222233
Q gi|254780920|r  151 YNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYG  189 (358)
Q Consensus       151 ~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyG  189 (358)
                       .+...|+.||.+.+.+.+.++++   +|+++-.+-|+.+-=
T Consensus       149 -~~~~~y~asKaav~~lTkslA~Ela~~gIRVNaVaPG~i~T  189 (227)
T PRK08862        149 -QDLTGVESSTALVSGFTHSWAKELTPFNIRVGGVVPSIFNA  189 (227)
T ss_pred             -CCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCEECC
T ss_conf             -88278999999999999999999767498999994380887


No 242
>KOG0725 consensus
Probab=98.93  E-value=1e-08  Score=72.57  Aligned_cols=174  Identities=20%  Similarity=0.136  Sum_probs=115.6

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHH---HHHHCCCCEEEEECCCCCHHHHHHHHH----H--C
Q ss_conf             489976788277999999998689879999478876585677---762037974999763889999999986----2--2
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSL---KEISQSNLFSFLQVDICDRECIRSALK----E--F   72 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~---~~~~~~~~v~~i~~Di~d~~~l~~~~~----~--~   72 (358)
                      .+|||||+-=||..+|.+|.+ .|.+|+..++..........   .......++..+.+|+++.+..++++.    +  .
T Consensus        10 valVTG~s~GIG~aia~~la~-~Ga~v~i~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~Dv~~~~~~~~l~~~~~~~~~G   88 (270)
T KOG0725          10 VALVTGGSSGIGKAIALLLAK-AGAKVVITGRSEERLEETAQELGGLGYTGGKVLAIVCDVSKEVDVEKLVEFAVEKFFG   88 (270)
T ss_pred             EEEEECCCCCHHHHHHHHHHH-CCCEEEEEECCHHHHHHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHHHHHHHCC
T ss_conf             899979998158999999998-7998999845456667789998743677761489975557678899999999998478


Q ss_pred             CCCEEEEECCCCCCC-----CCCCCCCCCCCCCCCC-CCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCC
Q ss_conf             787178512343322-----2222222222222222-2024788865123221124784278630554311222222222
Q gi|254780920|r   73 QPDAIVNFAAESHVD-----RSILGADEFITTNIIG-TFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFS  146 (358)
Q Consensus        73 ~~d~ViHlAa~~~~~-----~~~~~p~~~~~~Nv~g-t~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~  146 (358)
                      ++|+.++-|+.....     .+.+..+..+++|+.| +..+..+++...     .+.+.-.++++||..-+...      
T Consensus        89 kidiLvnnag~~~~~~~~~~~s~e~~d~~~~~Nl~G~~~~~~~~a~~~~-----~~~~gg~I~~~ss~~~~~~~------  157 (270)
T KOG0725          89 KIDILVNNAGALGLTGSILDLSEEVFDKIMATNLRGSAFCLKQAARPML-----KKSKGGSIVNISSVAGVGPG------  157 (270)
T ss_pred             CCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHCCCHHHHHHHHHHHHHH-----HHCCCCEEEEECCCCCCCCC------
T ss_conf             8877987266467887442199999988886403127899999999999-----85389469996664455667------


Q ss_pred             CCCCCCCCCCCCCCCCCCEEEECCCCC---CCCCCCCCCCCCCCCCCC
Q ss_conf             222222222223332210000001233---322222222222223332
Q gi|254780920|r  147 EDMPYNPSSPYSATKASSDYLVLAWGH---TYGIPVLLSNCSNNYGPY  191 (358)
Q Consensus       147 E~~~~~p~s~Yg~sK~~~E~~~~~~~~---~~~l~~~ilR~~~vyGp~  191 (358)
                         +..| ..|+.+|.+.+++.+..+.   ++|+++-++-|+.+..+-
T Consensus       158 ---~~~~-~~Y~~sK~al~~ltr~lA~El~~~gIRvN~v~PG~i~T~~  201 (270)
T KOG0725         158 ---PGSG-VAYGVSKAALLQLTRSLAKELAKHGIRVNSVSPGLVKTSL  201 (270)
T ss_pred             ---CCCC-CCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCH
T ss_conf             ---7765-2001149999998999999998639368883468670440


No 243
>KOG4169 consensus
Probab=98.91  E-value=8.7e-09  Score=73.01  Aligned_cols=216  Identities=19%  Similarity=0.175  Sum_probs=130.8

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEEC-CCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC-----CCC
Q ss_conf             48997678827799999999868987999947-887658567776203797499976388999999998622-----787
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDK-LTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEF-----QPD   75 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~-~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d   75 (358)
                      ++++|||.|=||..++.+|+++ |..+.++|- .....-...++.+..+..+-|+++|+++..+++++|++.     .+|
T Consensus         7 na~vtggagGIGl~~sk~Ll~k-gik~~~i~~~~En~~a~akL~ai~p~~~v~F~~~DVt~~~~~~~~f~ki~~~fg~iD   85 (261)
T KOG4169           7 NALVTGGAGGIGLATSKALLEK-GIKVLVIDDSEENPEAIAKLQAINPSVSVIFIKCDVTNRGDLEAAFDKILATFGTID   85 (261)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCHHEEEHHHHHCHHHHHHHHCCCCCCEEEEEEECCCCHHHHHHHHHHHHHHHCCEE
T ss_conf             5899637863669999999976-715406104014789999886039984399998012007889999999998709457


Q ss_pred             EEEEECCCCCCCCCCCCCCCCCCCCCC----CCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             178512343322222222222222222----2202478886512322112478427863055431122222222222222
Q gi|254780920|r   76 AIVNFAAESHVDRSILGADEFITTNII----GTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPY  151 (358)
Q Consensus        76 ~ViHlAa~~~~~~~~~~p~~~~~~Nv~----gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~  151 (358)
                      ++|+-|+...    ..|-+.++.+|+.    ||.-.|.++.+...     - ..--+|..||  |+|..+-       |.
T Consensus        86 IlINgAGi~~----dkd~e~Ti~vNLtgvin~T~~alpyMdk~~g-----G-~GGiIvNmsS--v~GL~P~-------p~  146 (261)
T KOG4169          86 ILINGAGILD----DKDWERTINVNLTGVINGTQLALPYMDKKQG-----G-KGGIIVNMSS--VAGLDPM-------PV  146 (261)
T ss_pred             EEECCCCCCC----CHHHHHHHCCCHHHHHHHHHHHHHHHHHHCC-----C-CCCEEEEECC--CCCCCCC-------CC
T ss_conf             9971664446----1207786502221200336663044554349-----9-9818997011--0266766-------42


Q ss_pred             CCCCCCCCCCCCCEEEECCC-----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCC-----
Q ss_conf             22222233322100000012-----333222222222222233322222222222222222-2222222222332-----
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAW-----GHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIE-GSHVFLYGDGQNV-----  220 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~-----~~~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~-g~~~~i~g~g~~~-----  220 (358)
                      -  ..|+.||...--..++.     ..+.|+.+..+-|+.+    .  .    .+++.+.. |.-+.+   .++.     
T Consensus       147 ~--pVY~AsKaGVvgFTRSla~~ayy~~sGV~~~avCPG~t----~--t----~l~~~~~~~~~~~e~---~~~~~~~l~  211 (261)
T KOG4169         147 F--PVYAASKAGVVGFTRSLADLAYYQRSGVRFNAVCPGFT----R--T----DLAENIDASGGYLEY---SDSIKEALE  211 (261)
T ss_pred             C--HHHHHCCCCEEEEEHHHHHHHHHHHCCEEEEEECCCCC----H--H----HHHHHHHHCCCCCCC---CHHHHHHHH
T ss_conf             0--23232001156420542245667655879999778731----4--8----999988851884401---689999999


Q ss_pred             -CCCCCCCCCCCCEEECCCCCCCCCCCCCCCCC
Q ss_conf             -21133222200000001222222211135786
Q gi|254780920|r  221 -RDWLYVEDHVRALYLVLKKGRIGERYNIGGNN  252 (358)
Q Consensus       221 -Rdfi~v~D~a~~i~~~~~~~~~~~~fNigs~~  252 (358)
                       ..-....+++..+..+++.+..|.+|-++++.
T Consensus       212 ~~~~q~~~~~a~~~v~aiE~~~NGaiw~v~~g~  244 (261)
T KOG4169         212 RAPKQSPACCAINIVNAIEYPKNGAIWKVDSGS  244 (261)
T ss_pred             HCCCCCHHHHHHHHHHHHHHCCCCCEEEEECCC
T ss_conf             755688799999999997642588589972683


No 244
>KOG1209 consensus
Probab=98.85  E-value=1e-08  Score=72.51  Aligned_cols=148  Identities=18%  Similarity=0.161  Sum_probs=102.5

Q ss_pred             EEEEECC-CCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH------CCC
Q ss_conf             4899767-882779999999986898799994788765856777620379749997638899999999862------278
Q gi|254780920|r    2 RLIVTGG-AGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKE------FQP   74 (358)
Q Consensus         2 kILItG~-tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~------~~~   74 (358)
                      +|||||. +|=||-.|++++. +.|+.|++-.|     +++...++...-++.-.+.|+++++.+..+..+      .+.
T Consensus         9 ~VlItgcs~GGIG~ala~ef~-~~G~~V~AtaR-----~~e~M~~L~~~~gl~~~kLDV~~~~~V~~v~~evr~~~~Gkl   82 (289)
T KOG1209           9 KVLITGCSSGGIGYALAKEFA-RNGYLVYATAR-----RLEPMAQLAIQFGLKPYKLDVSKPEEVVTVSGEVRANPDGKL   82 (289)
T ss_pred             EEEEEECCCCCHHHHHHHHHH-HCCEEEEEECC-----CCCHHHHHHHHHCCEEEEECCCCHHHHHHHHHHHHHCCCCCE
T ss_conf             599960577653499999998-67819999702-----246076678860970587056872778998888861899826


Q ss_pred             CEEEEECCCCCCCC----CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             71785123433222----22222222222222220247888651232211247842786305543112222222222222
Q gi|254780920|r   75 DAIVNFAAESHVDR----SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMP  150 (358)
Q Consensus        75 d~ViHlAa~~~~~~----~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~  150 (358)
                      |+.++-|+.+....    ...+-+..+++|+-|.+++-.+....      ..+.+-.+|+.+|..+|-   ..       
T Consensus        83 d~L~NNAG~~C~~Pa~d~~i~ave~~f~vNvfG~irM~~a~~h~------likaKGtIVnvgSl~~~v---pf-------  146 (289)
T KOG1209          83 DLLYNNAGQSCTFPALDATIAAVEQCFKVNVFGHIRMCRALSHF------LIKAKGTIVNVGSLAGVV---PF-------  146 (289)
T ss_pred             EEEECCCCCCCCCCCCCCCHHHHHHHHCCCEEEEEHHHHHHHHH------HHHCCCEEEEECCEEEEE---CC-------
T ss_conf             88871799876552346878999864021123434388999999------987266499744535880---24-------


Q ss_pred             CCCCCCCCCCCCCCEEEECCCC
Q ss_conf             2222222333221000000123
Q gi|254780920|r  151 YNPSSPYSATKASSDYLVLAWG  172 (358)
Q Consensus       151 ~~p~s~Yg~sK~~~E~~~~~~~  172 (358)
                       --.+.|.+||++...+....+
T Consensus       147 -pf~~iYsAsKAAihay~~tLr  167 (289)
T KOG1209         147 -PFGSIYSASKAAIHAYARTLR  167 (289)
T ss_pred             -CHHHHHHHHHHHHHHHHHHCE
T ss_conf             -315666677999998632007


No 245
>KOG4288 consensus
Probab=98.84  E-value=4.1e-10  Score=81.10  Aligned_cols=221  Identities=18%  Similarity=0.209  Sum_probs=115.3

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEE
Q ss_conf             94899767882779999999986898799994788765856777620379749997638899999999862278717851
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNF   80 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~ViHl   80 (358)
                      ||+.+.||.||+|..+|..+... +++|..+-+...++..+.++...+ -.+++.-.+..|+.....++++- .++|.-+
T Consensus         3 ~k~~vfgg~gflg~~ic~~a~~s-gy~vvsvsrsgas~~snkid~~~d-ve~e~tlvlggnpfsgs~vlk~A-~~vv~sv   79 (283)
T KOG4288           3 PKLIVFGGNGFLGKRICQEAVTS-GYQVVSVSRSGASPHSNKIDDKQD-VEVEWTLVLGGNPFSGSEVLKNA-TNVVHSV   79 (283)
T ss_pred             CCCEEECCCCCCHHHHHHHHHHC-CCEEEEECCCCCCCCCCCCCCHHH-HHHHHHHHHCCCCCCHHHHHHHH-HHHCEEE
T ss_conf             64502346653235665999745-836997136667876777861545-35777765427985057999998-7526135


Q ss_pred             CCCCCC-----CCCC-------------CCCCCC-------------------CCCCCCCCCHHHHHHHHHCCCCCCCCC
Q ss_conf             234332-----2222-------------222222-------------------222222220247888651232211247
Q gi|254780920|r   81 AAESHV-----DRSI-------------LGADEF-------------------ITTNIIGTFILLEETRLWWSCLSQDKK  123 (358)
Q Consensus        81 Aa~~~~-----~~~~-------------~~p~~~-------------------~~~Nv~gt~nil~~~~~~~~~~~~~~~  123 (358)
                      ...+-.     -.++             .+|...                   .-.-+.||.|+ ++      ..++.+.
T Consensus        80 gilsen~~k~~l~sw~~~vswh~gnsfssn~~k~~l~g~t~v~e~~ggfgn~~~m~~ing~ani-~a------~kaa~~~  152 (283)
T KOG4288          80 GILSENENKQTLSSWPTYVSWHRGNSFSSNPNKLKLSGPTFVYEMMGGFGNIILMDRINGTANI-NA------VKAAAKA  152 (283)
T ss_pred             EEEECCCCCCHHHCCCCCCCHHHCCCCCCCCCHHHHCCCCCCHHHHCCCCCHHHHHHHCCHHHH-HH------HHHHHHC
T ss_conf             6762156700433787663121113012685522205773108886375416799986137668-88------9999974


Q ss_pred             CCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----
Q ss_conf             8427863055431122222222222222222222333221000000123332222222222222333222222222----
Q gi|254780920|r  124 DQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIP----  199 (358)
Q Consensus       124 ~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~s~Yg~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~~~~~i~----  199 (358)
                      ++++|+|+|-.. ||.+         ++-|+ -|=.+|+++|.-+.   +.++++-+++||+.+||.+....-.+|    
T Consensus       153 gv~~fvyISa~d-~~~~---------~~i~r-GY~~gKR~AE~Ell---~~~~~rgiilRPGFiyg~R~v~g~~~pL~~v  218 (283)
T KOG4288         153 GVPRFVYISAHD-FGLP---------PLIPR-GYIEGKREAEAELL---KKFRFRGIILRPGFIYGTRNVGGIKSPLHTV  218 (283)
T ss_pred             CCCEEEEEEHHH-CCCC---------CCCCH-HHHCCCHHHHHHHH---HHCCCCCEEECCCEEECCCCCCCCCCCHHHH
T ss_conf             996399987543-2798---------86622-13043168899999---7427886264353021455467602408763


Q ss_pred             -CCCCCCCCCC-----CCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCC
Q ss_conf             -2222222222-----22222222332211332222000000012222222111
Q gi|254780920|r  200 -LAITRMIEGS-----HVFLYGDGQNVRDWLYVEDHVRALYLVLKKGRIGERYN  247 (358)
Q Consensus       200 -~~i~~~~~g~-----~~~i~g~g~~~Rdfi~v~D~a~~i~~~~~~~~~~~~fN  247 (358)
                       ..+.++.+.-     ++.+.  |.-.++-+.++++|.+.+.+++.+.-.+++-
T Consensus       219 g~pl~~~~~~a~k~~~kLp~l--g~l~~ppvnve~VA~aal~ai~dp~f~Gvv~  270 (283)
T KOG4288         219 GEPLEMVLKFALKPLNKLPLL--GPLLAPPVNVESVALAALKAIEDPDFKGVVT  270 (283)
T ss_pred             HHHHHHHHHHHHCHHHCCCCC--CCCCCCCCCHHHHHHHHHHHCCCCCCCCEEE
T ss_conf             426999987402312207555--6424798678999999997424877576055


No 246
>KOG1611 consensus
Probab=98.80  E-value=2.3e-08  Score=70.44  Aligned_cols=175  Identities=18%  Similarity=0.161  Sum_probs=111.2

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHH-HHCCCCEEEEECCCCCHHHHHHHHHHC-------CC
Q ss_conf             8997678827799999999868987999947887658567776-203797499976388999999998622-------78
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKE-ISQSNLFSFLQVDICDRECIRSALKEF-------QP   74 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~-~~~~~~v~~i~~Di~d~~~l~~~~~~~-------~~   74 (358)
                      |+||||+-=||--|+++|++..+.+++.-.++.+......+.. ...++|+..++.|+++.+.++++.++.       ..
T Consensus         6 v~ItGaNRGIGlgLVk~llk~~~i~~iiat~r~~e~a~~~l~~k~~~d~rvHii~Ldvt~deS~~~~~~~V~~iVg~~Gl   85 (249)
T KOG1611           6 VFITGANRGIGLGLVKELLKDKGIEVIIATARDPEKAATELALKSKSDSRVHIIQLDVTCDESIDNFVQEVEKIVGSDGL   85 (249)
T ss_pred             EEEECCCCCHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCCC
T ss_conf             89962676210778899835788479998447967765787876325885279987336577799999998751466870


Q ss_pred             CEEEEECCCCCCCCCCCC-----CCCCCCCCCCCCCHHHHHHHHHCCCCCCCC--------CCCEEEEECCCCCCCCCCC
Q ss_conf             717851234332222222-----222222222222024788865123221124--------7842786305543112222
Q gi|254780920|r   75 DAIVNFAAESHVDRSILG-----ADEFITTNIIGTFILLEETRLWWSCLSQDK--------KDQFRFLQISTDEVYGSLD  141 (358)
Q Consensus        75 d~ViHlAa~~~~~~~~~~-----p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~--------~~~~~~v~~SS~~vYg~~~  141 (358)
                      +..++.|+..........     -.+.+++|+.|...+.++.  +...+....        ...-.+|++||..-  .  
T Consensus        86 nlLinNaGi~~~y~~~~~~~r~~~~~~~~tN~v~~il~~Q~~--lPLLkkaas~~~gd~~s~~raaIinisS~~~--s--  159 (249)
T KOG1611          86 NLLINNAGIALSYNTVLKPSRAVLLEQYETNAVGPILLTQAF--LPLLKKAASKVSGDGLSVSRAAIINISSSAG--S--  159 (249)
T ss_pred             EEEEECCCEEEECCCCCCCCHHHHHHHHHHCCHHHHHHHHHH--HHHHHHHHHCCCCCCCCCCCEEEEEEECCCC--C--
T ss_conf             588854600132345668858999987501340399999999--9999987522467765643135898521113--4--


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCEEEECCCC---CCCCCCCCCCCCCCC
Q ss_conf             2222222222222222333221000000123---332222222222222
Q gi|254780920|r  142 KGLFSEDMPYNPSSPYSATKASSDYLVLAWG---HTYGIPVLLSNCSNN  187 (358)
Q Consensus       142 ~~~~~E~~~~~p~s~Yg~sK~~~E~~~~~~~---~~~~l~~~ilR~~~v  187 (358)
                          .......+...|+.||.|.-...+..+   +...+-++.+.|++|
T Consensus       160 ----~~~~~~~~~~AYrmSKaAlN~f~ksls~dL~~~~ilv~sihPGwV  204 (249)
T KOG1611         160 ----IGGFRPGGLSAYRMSKAALNMFAKSLSVDLKDDHILVVSIHPGWV  204 (249)
T ss_pred             ----CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCEE
T ss_conf             ----578777634566755999999998864650478689999468707


No 247
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase; InterPro: IPR011294   This entry represents a subfamily of the short chain dehydrogenases. Characterised members so far as 3-hydroxybutyrate dehydrogenases and are found in species that accumulate ester polymers called polyhydroxyalkanoic acids (PHAs) under certain conditions. Several members of the family are from species not known to accumulate PHAs, including Oceanobacillus iheyensis and Bacillus subtilis. However, polymer formation is not required for there be a role for 3-hydroxybutyrate dehydrogenase; it may be members of this family have the same function in those species.; GO: 0003858 3-hydroxybutyrate dehydrogenase activity.
Probab=98.80  E-value=3.7e-08  Score=69.15  Aligned_cols=228  Identities=21%  Similarity=0.248  Sum_probs=145.0

Q ss_pred             CE-EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHH--HCCCCEEEEECCCCCHHHHHHHHHH----C-
Q ss_conf             94-89976788277999999998689879999478876585677762--0379749997638899999999862----2-
Q gi|254780920|r    1 MR-LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEI--SQSNLFSFLQVDICDRECIRSALKE----F-   72 (358)
Q Consensus         1 Mk-ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~--~~~~~v~~i~~Di~d~~~l~~~~~~----~-   72 (358)
                      +| +||||+++=||..+++.|... |++|+..|..............  ...-++.++..|+++.+++++.++.    + 
T Consensus         1 ~ktalVTGaaSGIG~~iA~~LA~a-Ga~v~~~d~~~~~~~~~~~~~~~~~~G~~v~~~~~D~T~~~e~~~~~~~~~~~fG   79 (258)
T TIGR01963         1 GKTALVTGAASGIGLAIAKALAAA-GANVVVNDLGEADEGAEAAAKVATDAGGSVIYLVADVTKEEEIADMIQAVAAEFG   79 (258)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHHC-CCEEEEECCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHC
T ss_conf             948999658716789999999872-9889984678878999999999996188357751478888999999999999856


Q ss_pred             CCCEEEEECCCCCCCCCC----CCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCE-EEEECCCCCCCCCCCCCCCCC
Q ss_conf             787178512343322222----222222222222220247888651232211247842-786305543112222222222
Q gi|254780920|r   73 QPDAIVNFAAESHVDRSI----LGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQF-RFLQISTDEVYGSLDKGLFSE  147 (358)
Q Consensus        73 ~~d~ViHlAa~~~~~~~~----~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~-~~v~~SS~~vYg~~~~~~~~E  147 (358)
                      .+|+-++-|+.-+|..=+    ++.+..+.+|+.+-.....++     +=...+.+== |||+++|..  |.-..     
T Consensus        80 ~~DiLVNNAG~QhVaPiEeFP~~~w~~iiav~LtsaF~t~raA-----lP~Mk~~gwGGRIiNIAS~H--GLvAS-----  147 (258)
T TIGR01963        80 GLDILVNNAGIQHVAPIEEFPPEKWDRIIAVMLTSAFHTIRAA-----LPHMKKQGWGGRIINIASVH--GLVAS-----  147 (258)
T ss_pred             CCCEEEECCCEEECCCCCCCCHHHHHHHHHHCCCHHHHHHHHC-----CCCCCCCCCCCEEEEEEEEC--CCCCC-----
T ss_conf             8874884464014176547786678737302168889999750-----64321378553799710100--00035-----


Q ss_pred             CCCCCCCCCCCCCCCCCEEEECCCC---CCCCCCCCCCCCCCCCCC---CCCCCC----CCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222222333221000000123---332222222222222333---222222----222222222222222222222
Q gi|254780920|r  148 DMPYNPSSPYSATKASSDYLVLAWG---HTYGIPVLLSNCSNNYGP---YHFPEK----LIPLAITRMIEGSHVFLYGDG  217 (358)
Q Consensus       148 ~~~~~p~s~Yg~sK~~~E~~~~~~~---~~~~l~~~ilR~~~vyGp---~~~~~~----~i~~~i~~~~~g~~~~i~g~g  217 (358)
                        |+  .|.|-.+|-...=+.|-.+   -++|+..=.+=|+.|-=|   .|.++.    =||.  .+.+  +++.+  .+
T Consensus       148 --p~--KSAYVAAKHG~~GLTKv~ALE~A~~giT~NaiCPGYV~TPLV~~Qi~DqAk~rGi~e--E~V~--~~VmL--~~  217 (258)
T TIGR01963       148 --PF--KSAYVAAKHGLIGLTKVLALEVAAHGITANAICPGYVRTPLVEKQIADQAKTRGIPE--EQVI--REVML--KK  217 (258)
T ss_pred             --CC--HHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCCH--HHHH--HHHCC--CC
T ss_conf             --32--134567743021211555542047887586672875675546765899986518899--8888--98607--88


Q ss_pred             CCCCCCCCCCCCCCCEE-ECCCCC--CCCCCCCCCCC
Q ss_conf             33221133222200000-001222--22221113578
Q gi|254780920|r  218 QNVRDWLYVEDHVRALY-LVLKKG--RIGERYNIGGN  251 (358)
Q Consensus       218 ~~~Rdfi~v~D~a~~i~-~~~~~~--~~~~~fNigs~  251 (358)
                      ...|.|+-+||+++..+ ++-+..  ..|..+.+-+|
T Consensus       218 ~P~k~F~~~~e~A~~a~fLaS~~A~~~TG~~~~~DGG  254 (258)
T TIGR01963       218 QPTKRFVTVDEVAETALFLASDAAAGITGQAIVLDGG  254 (258)
T ss_pred             CCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEEECCC
T ss_conf             8984113799999999984173442366207886484


No 248
>KOG1201 consensus
Probab=98.79  E-value=2.3e-08  Score=70.38  Aligned_cols=204  Identities=17%  Similarity=0.164  Sum_probs=121.2

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH----C-CCCE
Q ss_conf             4899767882779999999986898799994788765856777620379749997638899999999862----2-7871
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKE----F-QPDA   76 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~----~-~~d~   76 (358)
                      .||||||.+=+|+.++.+++++ +..++..|. ...+..+..+.....-.+..+.+|+++.+++.+.-+.    + .+|+
T Consensus        40 ~vLITGgg~GlGr~ialefa~r-g~~~vl~Di-n~~~~~etv~~~~~~g~~~~y~cdis~~eei~~~a~~Vk~e~G~V~I  117 (300)
T KOG1201          40 IVLITGGGSGLGRLIALEFAKR-GAKLVLWDI-NKQGNEETVKEIRKIGEAKAYTCDISDREEIYRLAKKVKKEVGDVDI  117 (300)
T ss_pred             EEEEECCCCHHHHHHHHHHHHH-CCEEEEEEC-CCCCHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCEE
T ss_conf             8999689860789999999970-784899955-65123999999984485258995589889999999999986199549


Q ss_pred             EEEECCCCCCCCCC----CCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCC-CCCCCCCCCCCCCCC
Q ss_conf             78512343322222----2222222222222202478886512322112478427863055431-122222222222222
Q gi|254780920|r   77 IVNFAAESHVDRSI----LGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEV-YGSLDKGLFSEDMPY  151 (358)
Q Consensus        77 ViHlAa~~~~~~~~----~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~v-Yg~~~~~~~~E~~~~  151 (358)
                      +++-||......-.    +.-...+++|+.|......+--     =...+.+.-.+|-++|++- .|            +
T Consensus       118 LVNNAGI~~~~~ll~~~d~ei~k~~~vN~~~~f~t~kaFL-----P~M~~~~~GHIV~IaS~aG~~g------------~  180 (300)
T KOG1201         118 LVNNAGIVTGKKLLDCSDEEIQKTFDVNTIAHFWTTKAFL-----PKMLENNNGHIVTIASVAGLFG------------P  180 (300)
T ss_pred             EEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHH-----HHHHHCCCCEEEEEHHHHCCCC------------C
T ss_conf             9836642448875679989999999876689999999873-----8887457963998355331357------------7


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCC------CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222233322100000012333------222222222222233322222222222222222222222222233221133
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGHT------YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLY  225 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~~------~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~  225 (358)
                      ....+|..||.++.-.-+.+..+      .|++.+.+=|+      ...+++    +..   ..|.      ....+.+.
T Consensus       181 ~gl~~YcaSK~a~vGfhesL~~EL~~~~~~~IktTlv~P~------~i~Tgm----f~~---~~~~------~~l~P~L~  241 (300)
T KOG1201         181 AGLADYCASKFAAVGFHESLSMELRALGKDGIKTTLVCPY------FINTGM----FDG---ATPF------PTLAPLLE  241 (300)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEE------ECCCCC----CCC---CCCC------CCCCCCCC
T ss_conf             6532356518999999999999998538987269998432------213554----478---9888------64368779


Q ss_pred             CCCCCCCEEECCCCCCCC
Q ss_conf             222200000001222222
Q gi|254780920|r  226 VEDHVRALYLVLKKGRIG  243 (358)
Q Consensus       226 v~D~a~~i~~~~~~~~~~  243 (358)
                      .+-+|+.+..++..++..
T Consensus       242 p~~va~~Iv~ai~~n~~~  259 (300)
T KOG1201         242 PEYVAKRIVEAILTNQAG  259 (300)
T ss_pred             HHHHHHHHHHHHHCCCCC
T ss_conf             799999999999819750


No 249
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase; InterPro: IPR013454    Rhamnose is a methyl-pentose sugar which is found as a constituent of pectin within the cell walls of dicotyledonous plants and has also been found in the mucilage of a number of legume plants . RhaD from Rhizobium leguminosarum bv. trifolii is encoded by a gene occurring in a rhamnose utilisation cluster, and is necessary for growth on this compound . This protein is predicted to be a bifunctional NAD-dependent aldolase/dehydrogenase..
Probab=98.78  E-value=2e-08  Score=70.81  Aligned_cols=233  Identities=20%  Similarity=0.185  Sum_probs=144.6

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHH-----HHHHCCCCEE------------EEECCCCCHHHH
Q ss_conf             89976788277999999998689879999478876585677-----7620379749------------997638899999
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSL-----KEISQSNLFS------------FLQVDICDRECI   65 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~-----~~~~~~~~v~------------~i~~Di~d~~~l   65 (358)
                      ++||||.|=||+.++++|.++ |..|++.|.-..  +....     +.+- ....-            =++.|||+.+.+
T Consensus       427 a~VtGGasGIG~~~A~rL~~e-GAhvV~aD~d~~--~a~~va~~~~~~fG-~d~a~AGsdisaCGPaiGl~~DvT~e~~v  502 (709)
T TIGR02632       427 AFVTGGASGIGRETARRLVDE-GAHVVLADLDAE--AAEAVAAEIVDKFG-ADKAVAGSDISACGPAIGLKLDVTDEEAV  502 (709)
T ss_pred             EEEECCCCCHHHHHHHHHHHC-CCEEEEECCCHH--HHHHHHHHHHHHCC-CCCEECCCCHHCCCCCEEEEEEECCHHHH
T ss_conf             889738865268999999736-977999623657--89999999863138-88121143200046710027631758999


Q ss_pred             HHHHHH-----CCCCEEEEECCCCC-CC---CC-CCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCC-C
Q ss_conf             999862-----27871785123433-22---22-22222222222222202478886512322112478427863055-4
Q gi|254780920|r   66 RSALKE-----FQPDAIVNFAAESH-VD---RS-ILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQIST-D  134 (358)
Q Consensus        66 ~~~~~~-----~~~d~ViHlAa~~~-~~---~~-~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS-~  134 (358)
                      ...|++     ...|.|+.-|+.+. .+   .. .++-...+++++.|..-|-+.|-....   .. .-.-.+||+.| -
T Consensus       503 ~~~f~~v~~~yGGvD~vv~nAGi~~S~p~~~t~r~~~W~l~~di~atG~FLVareA~r~~~---~Q-~lGG~~VfiaSkN  578 (709)
T TIGR02632       503 KAAFAEVALAYGGVDIVVNNAGIAVSSPLEETERLEEWDLNLDILATGYFLVAREAARLMR---KQ-GLGGNIVFIASKN  578 (709)
T ss_pred             HHHHHHHHHHHCCEEEEEECCCHHCCCCCHHHHHHHHHHHCCEEEEECCHHHHHHHHHHHH---HC-CCCCCEEEECCEE
T ss_conf             9999999997498478765253010577023221554320120101200358889999997---31-7985567761100


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCC---CCCCCCCCCCCCCCC-CCCCCCCC-CCCCC-CCCCC--
Q ss_conf             311222222222222222222223332210000001233---322222222222223-33222222-22222-22222--
Q gi|254780920|r  135 EVYGSLDKGLFSEDMPYNPSSPYSATKASSDYLVLAWGH---TYGIPVLLSNCSNNY-GPYHFPEK-LIPLA-ITRMI--  206 (358)
Q Consensus       135 ~vYg~~~~~~~~E~~~~~p~s~Yg~sK~~~E~~~~~~~~---~~~l~~~ilR~~~vy-Gp~~~~~~-~i~~~-i~~~~--  206 (358)
                      +||-.+.            .+.|..||++.-++++..+-   .+|+++=-|.|-.|. |.+-++.. ..... .+.+-  
T Consensus       579 av~A~kn------------~~AY~aaKA~~~Hl~R~LA~Ela~~GiRVNtV~PdaVl~GS~if~~~W~~~raA~ygi~ft  646 (709)
T TIGR02632       579 AVVAGKN------------ASAYSAAKAAEAHLARCLAAELAELGIRVNTVNPDAVLRGSGIFDGEWREERAAAYGIPFT  646 (709)
T ss_pred             EEEECCC------------CCHHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCHHCCCCCCCCHHHHHHHHHHHCCCCC
T ss_conf             0111788------------4055589999998999999814788646401065001105521533678888877077434


Q ss_pred             CCCCCCCC----CCCCCCCCC----CCCCCCCCCEEECCCC---CCCCCCCCCCCCCCCC
Q ss_conf             22222222----222332211----3322220000000122---2222211135786420
Q gi|254780920|r  207 EGSHVFLY----GDGQNVRDW----LYVEDHVRALYLVLKK---GRIGERYNIGGNNERK  255 (358)
Q Consensus       207 ~g~~~~i~----g~g~~~Rdf----i~v~D~a~~i~~~~~~---~~~~~~fNigs~~~~s  255 (358)
                      ..+|..+.    +.-...|+.    |+-+|+|+|++++.-.   ...|.+.++-.|..-+
T Consensus       647 adePtdvl~d~L~~fY~~RslLk~~v~p~d~AeAvf~L~S~~~~~tTG~~i~VDaG~~~A  706 (709)
T TIGR02632       647 ADEPTDVLADKLEEFYAKRSLLKREVLPADIAEAVFFLASDKLEKTTGLIITVDAGVAAA  706 (709)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCCCCCCCEECCCCCCCCC
T ss_conf             687235788889889875432377668088999999973451010278664037775222


No 250
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane]
Probab=98.69  E-value=7e-08  Score=67.45  Aligned_cols=166  Identities=22%  Similarity=0.271  Sum_probs=107.6

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHH-HCCCCEEEEECCCCCHHHHHHH----HHHC-CCCE
Q ss_conf             89976788277999999998689879999478876585677762-0379749997638899999999----8622-7871
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEI-SQSNLFSFLQVDICDRECIRSA----LKEF-QPDA   76 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~-~~~~~v~~i~~Di~d~~~l~~~----~~~~-~~d~   76 (358)
                      ||||||+-=||..|++++++ .|.+|+..-|     +..++.+. ...+.+.-..+|+.|.+..+.+    .+++ +.++
T Consensus         8 iLITGG~sGIGl~lak~f~e-lgN~VIi~gR-----~e~~L~e~~~~~p~~~t~v~Dv~d~~~~~~lvewLkk~~P~lNv   81 (245)
T COG3967           8 ILITGGASGIGLALAKRFLE-LGNTVIICGR-----NEERLAEAKAENPEIHTEVCDVADRDSRRELVEWLKKEYPNLNV   81 (245)
T ss_pred             EEEECCCCHHHHHHHHHHHH-HCCEEEEECC-----CHHHHHHHHHCCCCHHEEEECCCCHHHHHHHHHHHHHHCCCHHE
T ss_conf             99937964365999999998-3897999657-----49999999860941315651320356699999999862986113


Q ss_pred             EEEECCCC------CCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             78512343------322222222222222222220247888651232211247842786305543112222222222222
Q gi|254780920|r   77 IVNFAAES------HVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMP  150 (358)
Q Consensus        77 ViHlAa~~------~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~  150 (358)
                      ++++|+.-      +.+.+.++....+.+|..+...|..+.-..     ..+...-.+|..||+-.+-....        
T Consensus        82 liNNAGIqr~~dlt~~e~~~~~~~~eI~~Nl~API~Lt~~~lph-----l~~q~~a~IInVSSGLafvPm~~--------  148 (245)
T COG3967          82 LINNAGIQRNEDLTGAEDLLDDAEQEIATNLLAPIRLTALLLPH-----LLRQPEATIINVSSGLAFVPMAS--------  148 (245)
T ss_pred             EEECCCCCCHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHCCCCEEEEECCCCCCCCCCC--------
T ss_conf             43030003201115873125678888887510279999999999-----97197736998325534576545--------


Q ss_pred             CCCCCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCC
Q ss_conf             222222233322100000012333---2222222222222333
Q gi|254780920|r  151 YNPSSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGP  190 (358)
Q Consensus       151 ~~p~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp  190 (358)
                       .|  .|-.+|++.+.+..+.++|   .++.++-+-|+-|--+
T Consensus       149 -~P--vYcaTKAaiHsyt~aLR~Qlk~t~veVIE~~PP~V~t~  188 (245)
T COG3967         149 -TP--VYCATKAAIHSYTLALREQLKDTSVEVIELAPPLVDTT  188 (245)
T ss_pred             -CC--CCHHHHHHHHHHHHHHHHHHHHCCEEEEEECCCCEECC
T ss_conf             -55--20243889999899999986436568999528703237


No 251
>PRK06720 hypothetical protein; Provisional
Probab=98.69  E-value=2.1e-07  Score=64.58  Aligned_cols=128  Identities=20%  Similarity=0.180  Sum_probs=77.4

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHH-CCCCEEEEECCCCCHHHHHHHHHH----C-CCCE
Q ss_conf             899767882779999999986898799994788765856777620-379749997638899999999862----2-7871
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEIS-QSNLFSFLQVDICDRECIRSALKE----F-QPDA   76 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~-~~~~v~~i~~Di~d~~~l~~~~~~----~-~~d~   76 (358)
                      ++||||++=||+.++..|.++ |.+|+..|+..... ....+.+. ....+.++.+|+++.++++++++.    + ++|+
T Consensus        19 alITGa~~GIG~a~A~~la~~-Ga~Vvi~d~~~~~~-~~~~~~i~~~g~~a~~~~~Dvs~~~~v~~~i~~~~~~~g~iDi   96 (169)
T PRK06720         19 AIVTGGGIGIGRNTALLLAKQ-GAKVIVTDIDQESG-QATVEEITNLGGEALFVSYDMEKQGDWQRVISITLNAFSRIDM   96 (169)
T ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEECCCHHHH-HHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCE
T ss_conf             999897548999999999986-99899952763659-9999999974995378975889999999999999997598998


Q ss_pred             EEEECCCCCCCCCCCCCC----CCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCC-CCCCC
Q ss_conf             785123433222222222----2222222222024788865123221124784278630554-31122
Q gi|254780920|r   77 IVNFAAESHVDRSILGAD----EFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTD-EVYGS  139 (358)
Q Consensus        77 ViHlAa~~~~~~~~~~p~----~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~-~vYg~  139 (358)
                      ++|.|+..........+.    ..+..|  +.   .-.++...  ....+.+.-++|..||. ...|.
T Consensus        97 LvNNAGI~~~~~~~~~~~e~~~~v~~vN--~v---~~~~k~~~--~~m~kq~~G~IIN~aSi~Gl~G~  157 (169)
T PRK06720         97 LFQNAGLYKIDSIFSRQQENDSNVLCIN--DV---WIEIKQLT--SSFMKQQEEVVLSDLPIFGIIGT  157 (169)
T ss_pred             EEECCCCCCCCCCCCCCHHHHHHHHHHH--HH---HHHHHHHH--HHHHHCCCCEEEEECCCCCCCCC
T ss_conf             9989421788760017989999999887--59---99999999--99997599789998871512678


No 252
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism]
Probab=98.56  E-value=5.5e-07  Score=62.01  Aligned_cols=76  Identities=26%  Similarity=0.418  Sum_probs=61.0

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHC--CCCEEEEECCCCCHHHHHHHHHHCCCCEEE
Q ss_conf             948997678827799999999868987999947887658567776203--797499976388999999998622787178
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQ--SNLFSFLQVDICDRECIRSALKEFQPDAIV   78 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~--~~~v~~i~~Di~d~~~l~~~~~~~~~d~Vi   78 (358)
                      |||||.|+ |+||+.++..|+++...+|++.||.     ..+...+..  ..+++..+.|+.|.+.+.+++++.  |.||
T Consensus         2 ~~ilviGa-G~Vg~~va~~la~~~d~~V~iAdRs-----~~~~~~i~~~~~~~v~~~~vD~~d~~al~~li~~~--d~VI   73 (389)
T COG1748           2 MKILVIGA-GGVGSVVAHKLAQNGDGEVTIADRS-----KEKCARIAELIGGKVEALQVDAADVDALVALIKDF--DLVI   73 (389)
T ss_pred             CCEEEECC-CHHHHHHHHHHHHCCCCEEEEEECC-----HHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHCC--CEEE
T ss_conf             72899898-6667999999985789629998488-----88999987533466316994256758899987257--7899


Q ss_pred             EECCCC
Q ss_conf             512343
Q gi|254780920|r   79 NFAAES   84 (358)
Q Consensus        79 HlAa~~   84 (358)
                      ++|-..
T Consensus        74 n~~p~~   79 (389)
T COG1748          74 NAAPPF   79 (389)
T ss_pred             EECCCH
T ss_conf             928705


No 253
>TIGR02415 23BDH acetoin reductases; InterPro: IPR014007   One member of this family, as characterised in Klebsiella terrigena , is able to interconvert acetoin + NADH with meso-2,3-butanediol + NAD(+). It is also capable of irreversible reduction of diacetyl with NADH to acetoin. There has been a reuctance to classify the enzyme as either 1.1.1.4 from EC, which is (R,R)-butanediol dehydrogenase, or 1.1.1.5 from EC, which is acetoin dehydrogenase without a specified stereochemistry . Another member of this family, from Corynebacterium glutamicum (Brevibacterium flavum), is called L-2,3-butanediol dehydrogenase .    This enzyme is a homotetramer in the family of short chain dehydrogenases (IPR002198 from INTERPRO). .
Probab=98.55  E-value=1.1e-07  Score=66.21  Aligned_cols=165  Identities=22%  Similarity=0.236  Sum_probs=111.6

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECC-CCCCCHHHHHHHHC-CCCEEEEECCCCCHHHHHHHHHH----C-CCC
Q ss_conf             89976788277999999998689879999478-87658567776203-79749997638899999999862----2-787
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKL-TYAGNLNSLKEISQ-SNLFSFLQVDICDRECIRSALKE----F-QPD   75 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~-~~~~~~~~~~~~~~-~~~v~~i~~Di~d~~~l~~~~~~----~-~~d   75 (358)
                      -|||||.+=||..++.+|.++ |++|.+.|.- ....-.+-.+.+.+ .-+.-+++.|+++++.++++++.    + ..|
T Consensus         3 AlvTGgAqGIG~gIa~RLa~D-GF~vav~D~n~Qe~~A~~t~~~i~~~G~~Ava~~~DV~~k~~~~~~i~~A~~~fG~fd   81 (258)
T TIGR02415         3 ALVTGGAQGIGKGIAERLAKD-GFNVAVADLNNQEETAKETAKEINQKGGKAVAYKLDVSDKSQVFEAIDQAVEKFGGFD   81 (258)
T ss_pred             EEEECCCCCHHHHHHHHHHHC-CCEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCE
T ss_conf             678568543238999999834-6137872566636899999999986697379986473456789999999999708932


Q ss_pred             EEEEECCCCCCC--C--CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCC-CCCCCCCCCCCCCCC
Q ss_conf             178512343322--2--22222222222222220247888651232211247842786305543-112222222222222
Q gi|254780920|r   76 AIVNFAAESHVD--R--SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDE-VYGSLDKGLFSEDMP  150 (358)
Q Consensus        76 ~ViHlAa~~~~~--~--~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~-vYg~~~~~~~~E~~~  150 (358)
                      +.++-|+...+.  .  ..+.-...|.+||-||+==++||-....   -..++.=|||.+.|.+ +-|.+          
T Consensus        82 V~VNNAGva~~~pi~~iteE~l~k~y~vNV~GvlfGIQAA~~~Fk---k~~~~tGkIINAaSiAg~~G~p----------  148 (258)
T TIGR02415        82 VMVNNAGVAPVTPILEITEEELEKLYNVNVKGVLFGIQAAARQFK---KQGHGTGKIINAASIAGVEGNP----------  148 (258)
T ss_pred             EEEECCCCCCCCCCCCCCCHHHHHHHCCHHHHHHHHHHHHHHHHH---HCCCCCCCHHHHHHHHHHHCCH----------
T ss_conf             786524100027745467003423430101456678899998778---7168987115776575540441----------


Q ss_pred             CCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCC
Q ss_conf             222222233322100000012333222222222
Q gi|254780920|r  151 YNPSSPYSATKASSDYLVLAWGHTYGIPVLLSN  183 (358)
Q Consensus       151 ~~p~s~Yg~sK~~~E~~~~~~~~~~~l~~~ilR  183 (358)
                        -.+.|+.||-+..=|.+.-+++---+.+-|.
T Consensus       149 --~ls~YsstKFAVRgLTQtAA~eLA~~GITVN  179 (258)
T TIGR02415       149 --VLSAYSSTKFAVRGLTQTAAQELAPKGITVN  179 (258)
T ss_pred             --HHHHHHHHHHHHHHHHHHHHHHHHHCCCEEC
T ss_conf             --4677776788887657999999752487374


No 254
>PRK12367 short chain dehydrogenase; Provisional
Probab=98.55  E-value=4.2e-07  Score=62.70  Aligned_cols=144  Identities=17%  Similarity=0.200  Sum_probs=88.5

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEEC
Q ss_conf             48997678827799999999868987999947887658567776203797499976388999999998622787178512
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNFA   81 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~ViHlA   81 (358)
                      +|.||||+|=+|+.|+++|.+ .|+.|+++.-   +... . .........+++...+.+.+.|++.+++  .|+.|--.
T Consensus        19 tIgITGAsGaLG~AL~k~f~~-~GakVIalTh---~~~~-~-~~~~~~~p~~wi~W~cG~E~~L~~~Lkk--iDILILNH   90 (250)
T PRK12367         19 RIGITGASGALGKALTKLFRA-KGAKVIGLTH---SKIN-N-SEISDESPNEWVSWECGKESSLDKTLAK--IDVLILNH   90 (250)
T ss_pred             EEEEECCCCHHHHHHHHHHHH-CCCEEEEEEC---CCCC-C-CCCCCCCCCEEEEEECCCHHHHHHHHHH--CCEEEECC
T ss_conf             799967873899999999998-8998999836---8888-7-5455678952898434998999999875--88999838


Q ss_pred             CC-CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCC-CCCCCCCCCC
Q ss_conf             34-332222222222222222222024788865123221124784278630554311222222222222-2222222233
Q gi|254780920|r   82 AE-SHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDM-PYNPSSPYSA  159 (358)
Q Consensus        82 a~-~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~-~~~p~s~Yg~  159 (358)
                      +. ++.++...+-...+++|..+...++|..-...  ... ....++=|..-|++.          |-. .+.|  .|-.
T Consensus        91 GIn~~~~~~~~~i~~s~EINalS~~RllelF~~~~--~~~-~~~~~kEiWvNTSEA----------Ei~PA~sP--~YEi  155 (250)
T PRK12367         91 GINPGGRQNSNDINKALEINALSSWRLLQLFEDIA--LNN-NSQIPKEIWVNTSEA----------EIQPALSP--VYEI  155 (250)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH--HCC-CCCCCCEEEEECCHH----------HCCCCCCC--HHHH
T ss_conf             77745565978999999877787999999999997--366-555783588615166----------41543380--3787


Q ss_pred             CCCCCEEEE
Q ss_conf             322100000
Q gi|254780920|r  160 TKASSDYLV  168 (358)
Q Consensus       160 sK~~~E~~~  168 (358)
                      ||.+.-+++
T Consensus       156 SKrliGqLV  164 (250)
T PRK12367        156 SKRLIGQLV  164 (250)
T ss_pred             HHHHHCCEE
T ss_conf             898740311


No 255
>KOG1610 consensus
Probab=98.54  E-value=2.7e-07  Score=63.92  Aligned_cols=163  Identities=20%  Similarity=0.241  Sum_probs=110.7

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH-------CCCC
Q ss_conf             899767882779999999986898799994788765856777620379749997638899999999862-------2787
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKE-------FQPD   75 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~-------~~~d   75 (358)
                      |||||.--=.|..|+++|. +.|+.|++-= +...+. ..+.....+++..-++.|+++++.++++.+-       -.-=
T Consensus        32 VlITGCDSGfG~~LA~~l~-~~Gf~V~Agc-lt~~ga-e~L~~~~~s~rl~t~~LDVT~~esi~~a~~~V~~~l~~~gLw  108 (322)
T KOG1610          32 VLITGCDSGFGRLLAKKLD-KKGFRVFAGC-LTEEGA-ESLRGETKSPRLRTLQLDVTKPESVKEAAQWVKKHLGEDGLW  108 (322)
T ss_pred             EEEECCCCHHHHHHHHHHH-HCCCEEEEEE-ECCCHH-HHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCCCE
T ss_conf             9983477177799999998-6588788872-067058-987632338740247532588789999999999864665513


Q ss_pred             EEEEECCCCC---CCC--CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             1785123433---222--22222222222222220247888651232211247842786305543112222222222222
Q gi|254780920|r   76 AIVNFAAESH---VDR--SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMP  150 (358)
Q Consensus        76 ~ViHlAa~~~---~~~--~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~  150 (358)
                      .|+|.|+.+.   +.+  ..++-...+++|..||+.+-.+..-      ..+...-|+|+.||..  |..         +
T Consensus       109 glVNNAGi~~~~g~~ewl~~~d~~~~l~vNllG~irvT~~~lp------Llr~arGRvV~v~S~~--Gr~---------~  171 (322)
T KOG1610         109 GLVNNAGISGFLGPDEWLTVEDYRKVLNVNLLGTIRVTKAFLP------LLRRARGRVVNVSSVL--GRV---------A  171 (322)
T ss_pred             EEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH------HHHHCCCEEEEECCCC--CCC---------C
T ss_conf             5773366455668511152999999886530548999998887------7776057089950445--676---------6


Q ss_pred             CCCCCCCCCCCCCCEEEECCCC---CCCCCCCCCCCCC
Q ss_conf             2222222333221000000123---3322222222222
Q gi|254780920|r  151 YNPSSPYSATKASSDYLVLAWG---HTYGIPVLLSNCS  185 (358)
Q Consensus       151 ~~p~s~Yg~sK~~~E~~~~~~~---~~~~l~~~ilR~~  185 (358)
                      .--..+|..||.+.|......+   +.+|+++.++-|+
T Consensus       172 ~p~~g~Y~~SK~aVeaf~D~lR~El~~fGV~VsiiePG  209 (322)
T KOG1610         172 LPALGPYCVSKFAVEAFSDSLRRELRPFGVKVSIIEPG  209 (322)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHCCCEEEEECCC
T ss_conf             76566520329999999999998877528679996467


No 256
>KOG1200 consensus
Probab=98.45  E-value=1.2e-06  Score=60.00  Aligned_cols=222  Identities=17%  Similarity=0.205  Sum_probs=128.9

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             8997678827799999999868987999947887658567776203797499976388999999998622-----78717
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEF-----QPDAI   77 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d~V   77 (358)
                      .+||||+-=||+.++..|. +.|+.|.+.|..+. .-....+++..+..-.-..+|+.+..+++..+++.     .|+++
T Consensus        17 ~~vtGg~sGIGrAia~~la-~~Garv~v~dl~~~-~A~ata~~L~g~~~h~aF~~DVS~a~~v~~~l~e~~k~~g~psvl   94 (256)
T KOG1200          17 AAVTGGSSGIGRAIAQLLA-KKGARVAVADLDSA-AAEATAGDLGGYGDHSAFSCDVSKAHDVQNTLEEMEKSLGTPSVL   94 (256)
T ss_pred             EEEECCCCHHHHHHHHHHH-HCCCEEEEEECCHH-HHHHHHHHCCCCCCCCEEEECCCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             4873487507799999997-46967997503224-479998626887765235304675788999999999842997289


Q ss_pred             EEECCCCC----CCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             85123433----22222222222222222220247888651232211247842786305543112222222222222222
Q gi|254780920|r   78 VNFAAESH----VDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNP  153 (358)
Q Consensus        78 iHlAa~~~----~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p  153 (358)
                      ++||+..-    .+...++.+..+.+|+.|++.+-+++-....   ......-++|..||..  |....  +       .
T Consensus        95 VncAGItrD~~Llrmkq~qwd~vi~vNL~gvfl~tqaa~r~~~---~~~~~~~sIiNvsSIV--GkiGN--~-------G  160 (256)
T KOG1200          95 VNCAGITRDGLLLRMKQEQWDSVIAVNLTGVFLVTQAAVRAMV---MNQQQGLSIINVSSIV--GKIGN--F-------G  160 (256)
T ss_pred             EECCCCCCCCCEEECCHHHHHHHHHHHCHHHHHHHHHHHHHHH---HHCCCCCEEEEEHHHH--CCCCC--C-------C
T ss_conf             9757646530201324888888997512136788899999999---7167984388644521--02456--5-------5


Q ss_pred             CCCCCCCCCCCEEEECCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222233322100000012333---22222222222223332222222222222222222222222223322113322220
Q gi|254780920|r  154 SSPYSATKASSDYLVLAWGHT---YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV  230 (358)
Q Consensus       154 ~s~Yg~sK~~~E~~~~~~~~~---~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~a  230 (358)
                      ++-|+.+|.-.--+.+..+++   .++++-.+-|+.+--|--  ..+-|..+.++...-|.--         +-..+|+|
T Consensus       161 QtnYAAsK~GvIgftktaArEla~knIrvN~VlPGFI~tpMT--~~mp~~v~~ki~~~iPmgr---------~G~~EevA  229 (256)
T KOG1200         161 QTNYAASKGGVIGFTKTAARELARKNIRVNVVLPGFIATPMT--EAMPPKVLDKILGMIPMGR---------LGEAEEVA  229 (256)
T ss_pred             CHHHHHHCCCEEEEEHHHHHHHHHCCCEEEEECCCCCCCHHH--HHCCHHHHHHHHCCCCCCC---------CCCHHHHH
T ss_conf             223445327555300988998865482476761431168125--4438789999975587644---------58889987


Q ss_pred             CCEEECCC---CCCCCCCCCCCCC
Q ss_conf             00000012---2222221113578
Q gi|254780920|r  231 RALYLVLK---KGRIGERYNIGGN  251 (358)
Q Consensus       231 ~~i~~~~~---~~~~~~~fNigs~  251 (358)
                      ..++.+..   ....|..+-+.+|
T Consensus       230 ~~V~fLAS~~ssYiTG~t~evtGG  253 (256)
T KOG1200         230 NLVLFLASDASSYITGTTLEVTGG  253 (256)
T ss_pred             HHHHHHHCCCCCCCCCEEEEEECC
T ss_conf             899988154423321516998346


No 257
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated
Probab=98.40  E-value=1.9e-06  Score=58.66  Aligned_cols=146  Identities=18%  Similarity=0.175  Sum_probs=88.1

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEEC
Q ss_conf             48997678827799999999868987999947887658567776203797499976388999999998622787178512
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNFA   81 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~ViHlA   81 (358)
                      +|-||||+|-+|+.|+++|.++ |..|+++......-   .+..-.....++.+.=++.+...+++.+++  +|+.|--.
T Consensus       182 TV~VTGASG~LG~aL~k~l~~~-GAKVIalTs~~~~i---~~~~~~~~~~~~~i~W~~G~E~~L~~~L~k--iDILILNH  255 (410)
T PRK07424        182 TVAVTGASGTLGQALLKELHQQ-GAKVIALTSNSDKI---PLEINGEDLPVKTIHWQVGQEAALAELLEK--VDILVINH  255 (410)
T ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCCCCC---CCCCCCCCCCCEEEEEECCCHHHHHHHHHH--CCEEEECC
T ss_conf             7999547737789999999977-99899993589865---534466546712786432888898888864--68998848


Q ss_pred             CC-CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEE-EEECCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             34-33222222222222222222202478886512322112478427-86305543112222222222222222222233
Q gi|254780920|r   82 AE-SHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFR-FLQISTDEVYGSLDKGLFSEDMPYNPSSPYSA  159 (358)
Q Consensus        82 a~-~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~-~v~~SS~~vYg~~~~~~~~E~~~~~p~s~Yg~  159 (358)
                      +. ....+..++-...++.|..+...+++.--..  +.......++- -|..|-++|-             +.-...|..
T Consensus       256 GIN~~g~~~~~~i~~S~EINalS~~rll~lF~~~--~~~~~~~~~kEIWvNTSEAEI~-------------PA~sP~YEi  320 (410)
T PRK07424        256 GINVHGERTPEAINKSYEVNTFSAWRLMELFLTT--VKTNQDKATKEVWVNTSEAEVS-------------PAFSPLYEL  320 (410)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH--HHCCCCCCCCEEEEECCHHHCC-------------CCCCCHHHH
T ss_conf             8785666597898876747877799999999999--6046445774389965343205-------------554828898


Q ss_pred             CCCCCEEEE
Q ss_conf             322100000
Q gi|254780920|r  160 TKASSDYLV  168 (358)
Q Consensus       160 sK~~~E~~~  168 (358)
                      ||.+.-+++
T Consensus       321 SKrliGqLV  329 (410)
T PRK07424        321 SKRALGDLV  329 (410)
T ss_pred             HHHHHHHHH
T ss_conf             999977658


No 258
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional
Probab=98.29  E-value=4.1e-07  Score=62.79  Aligned_cols=224  Identities=13%  Similarity=0.101  Sum_probs=111.7

Q ss_pred             EEEECC--CCHHHHHHHHHHHHHCCCEEEEEECCCC------C---CCHHHHHHHHCC-----CCE----------EEEE
Q ss_conf             899767--8827799999999868987999947887------6---585677762037-----974----------9997
Q gi|254780920|r    3 LIVTGG--AGFIGSALCRYLVNDLKIQVLVIDKLTY------A---GNLNSLKEISQS-----NLF----------SFLQ   56 (358)
Q Consensus         3 ILItG~--tGfIGs~l~~~Ll~~~~~~V~~~d~~~~------~---~~~~~~~~~~~~-----~~v----------~~i~   56 (358)
                      .||||+  +-=||..+++.|.+. |.+|+.-++...      .   +.....+...+.     ..+          +-+.
T Consensus        11 AlVTGaGgs~GIG~aiA~~lA~~-GA~Vvi~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~   89 (298)
T PRK06300         11 AFIAGIGDDQGYGWGIAKMLAEA-GATIIVGTWVPIYKIFSQSWELGKFNESRKLSNGELLTIAKIYPMDASFDKPEDVP   89 (298)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHC-CCEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHCEEEEECCCCCCHHHHH
T ss_conf             99908799862999999999982-99999923753024555688765568888750563000034653003457432305


Q ss_pred             CCCCCHH------------HHHHHHHHC-CCCEEEEECCCCC-CCCCC-----CCCCCCCCCCCCCCCHHHHHHHHHCCC
Q ss_conf             6388999------------999998622-7871785123433-22222-----222222222222220247888651232
Q gi|254780920|r   57 VDICDRE------------CIRSALKEF-QPDAIVNFAAESH-VDRSI-----LGADEFITTNIIGTFILLEETRLWWSC  117 (358)
Q Consensus        57 ~Di~d~~------------~l~~~~~~~-~~d~ViHlAa~~~-~~~~~-----~~p~~~~~~Nv~gt~nil~~~~~~~~~  117 (358)
                      .|+.+.+            .++.+.+++ ++|+++|-|+... .....     ++....+++|+.++..+.......   
T Consensus        90 ~di~~~~~~~~l~~~~v~~~v~~~~~~fG~iDiLVnna~~~~~~~~~~~e~~~~~~~~~~~~n~~~~~~~~~~~~p~---  166 (298)
T PRK06300         90 EDIAENKRYKGISGYTISEVVEQVKKDFGHIDILVHSLANSPEISKPLLETSRKGYLAALSTSSYSFVSLLSHFGPI---  166 (298)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH---
T ss_conf             77765665410015799999999998779977899899888756778455899999999989849999999999999---


Q ss_pred             CCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCC----CCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2112478427863055431122222222222222222222333221000000123----332222222222222333222
Q gi|254780920|r  118 LSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSATKASSDYLVLAWG----HTYGIPVLLSNCSNNYGPYHF  193 (358)
Q Consensus       118 ~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~s~Yg~sK~~~E~~~~~~~----~~~~l~~~ilR~~~vyGp~~~  193 (358)
                         ...+ -++|.+||.+.-.     +     .+.....|+.||.+.+.+.+..+    .+||+++=.+.|+.+..+...
T Consensus       167 ---m~~~-G~ii~i~s~~~~~-----~-----~p~~~~~ysasKaal~~lTr~lA~E~g~~ygIRVNaI~PG~i~T~~~~  232 (298)
T PRK06300        167 ---MNAG-GSTISLTYLASMR-----A-----VPGYGGGMSAAKAALESDTKTLAWEAGRRWGIRVNTISAGPLASRAGK  232 (298)
T ss_pred             ---HHCC-CCEEEEEEEECCC-----C-----CCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCHHH
T ss_conf             ---7638-9447754300134-----4-----677403679999999865999999857011808999854864471232


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCC---CCCCCCCCCCCCCCC
Q ss_conf             222222222222222222222222332211332222000000012---222222111357864
Q gi|254780920|r  194 PEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK---KGRIGERYNIGGNNE  253 (358)
Q Consensus       194 ~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~D~a~~i~~~~~---~~~~~~~fNigs~~~  253 (358)
                      .-.....+.......-|+         +-+...+|++.++..+..   ....|+++.+-+|-.
T Consensus       233 ~~~~~e~~~~~~~~~~Pl---------~R~g~peeiA~~v~FLaSd~as~ITG~~i~VDGG~s  286 (298)
T PRK06300        233 AIGFIERMVDYYQDWAPL---------PEPMEAEQVGAVAAFLVSPLASAITGETLYVDHGAN  286 (298)
T ss_pred             CCCCCHHHHHHHHHCCCC---------CCCCCHHHHHHHHHHHHCCHHCCCCCCEEEECCCCC
T ss_conf             146629999999857998---------999899999999999808400695788787895963


No 259
>pfam03435 Saccharop_dh Saccharopine dehydrogenase. This family comprised of three structural domains that can not be separated in the linear sequence. In some organisms this enzyme is found as a bifunctional polypeptide with lysine ketoglutarate reductase. The saccharopine dehydrogenase can also function as a saccharopine reductase.
Probab=98.28  E-value=5.1e-06  Score=56.10  Aligned_cols=76  Identities=22%  Similarity=0.328  Sum_probs=58.1

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCC-EEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEEC
Q ss_conf             899767882779999999986898-7999947887658567776203797499976388999999998622787178512
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKI-QVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNFA   81 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~-~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~ViHlA   81 (358)
                      |||.|+ |++|+.++..|.++... +|++.|+...  +...+.......+++.++.|+.|.+.+.+++++.  |.|++++
T Consensus         1 IlvlGa-G~vG~~~~~~L~~~~~~~~i~vad~~~~--~~~~~~~~~~~~~~~~~~~d~~~~~~l~~~~~~~--diVv~~~   75 (384)
T pfam03435         1 VLIIGA-GGVGQGVAPLLARHGDVDEITVADRSLE--KAQALAAPKLGLRFIAIAVDADNYEALAALLKEG--DLVINLA   75 (384)
T ss_pred             CEEECC-CHHHHHHHHHHHHCCCCCEEEEEECCHH--HHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHCC--CEEEECC
T ss_conf             989897-7879999999972899886999989889--9898775236985389995778999999987128--9999998


Q ss_pred             CC
Q ss_conf             34
Q gi|254780920|r   82 AE   83 (358)
Q Consensus        82 a~   83 (358)
                      ..
T Consensus        76 p~   77 (384)
T pfam03435        76 PP   77 (384)
T ss_pred             CH
T ss_conf             43


No 260
>KOG4039 consensus
Probab=98.26  E-value=6.5e-06  Score=55.43  Aligned_cols=154  Identities=16%  Similarity=0.193  Sum_probs=89.3

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCC-CEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC-CCCEEE
Q ss_conf             9489976788277999999998689-87999947887658567776203797499976388999999998622-787178
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLK-IQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEF-QPDAIV   78 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~-~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~-~~d~Vi   78 (358)
                      |..+|.||||..|+-|++++++..- -.|+++-|+..       ..-..++.+.-+..|..   .+++...+. .||+-|
T Consensus        19 ~s~fvlGAtG~~G~~llk~~~E~~~FSKV~~i~RR~~-------~d~at~k~v~q~~vDf~---Kl~~~a~~~qg~dV~F   88 (238)
T KOG4039          19 MSGFVLGATGLCGGGLLKHAQEAPQFSKVYAILRREL-------PDPATDKVVAQVEVDFS---KLSQLATNEQGPDVLF   88 (238)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCEEEEEEEECCC-------CCCCCCCEEEEEEECHH---HHHHHHHHHCCCCEEE
T ss_conf             2247885355313899999885656206999973157-------98421364546783268---8888776502885689


Q ss_pred             EECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             51234332222222222222222222024788865123221124784278630554311222222222222222222223
Q gi|254780920|r   79 NFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYS  158 (358)
Q Consensus        79 HlAa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~s~Yg  158 (358)
                      -+-+.+-. .  .-.+.++++.-.   .+|.++.      .+...+|+.|+..||...  +           +..+-.|-
T Consensus        89 caLgTTRg-k--aGadgfykvDhD---yvl~~A~------~AKe~Gck~fvLvSS~GA--d-----------~sSrFlY~  143 (238)
T KOG4039          89 CALGTTRG-K--AGADGFYKVDHD---YVLQLAQ------AAKEKGCKTFVLVSSAGA--D-----------PSSRFLYM  143 (238)
T ss_pred             EEECCCCC-C--CCCCCEEEECHH---HHHHHHH------HHHHCCCEEEEEEECCCC--C-----------CCCCEEEE
T ss_conf             96113555-5--566753761538---8888999------988589708999742678--8-----------64342024


Q ss_pred             CCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             3322100000012333222222222222233322
Q gi|254780920|r  159 ATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYH  192 (358)
Q Consensus       159 ~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~  192 (358)
                      ..|-..|.-+....-   =.++|+||+.+.|.+.
T Consensus       144 k~KGEvE~~v~eL~F---~~~~i~RPG~ll~~R~  174 (238)
T KOG4039         144 KMKGEVERDVIELDF---KHIIILRPGPLLGERT  174 (238)
T ss_pred             ECCCHHHHHHHHCCC---CEEEEECCCCEECCCC
T ss_conf             103446666664155---0799943753313466


No 261
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed
Probab=98.25  E-value=7.5e-06  Score=55.04  Aligned_cols=72  Identities=22%  Similarity=0.349  Sum_probs=56.5

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEE
Q ss_conf             94899767882779999999986898799994788765856777620379749997638899999999862278717851
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNF   80 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~ViHl   80 (358)
                      |||+|.|| |-+|++|++.|..+ +|+|+.+|+     +...++.+...-.+..+.||-++++.|+++=- .+.|.++-+
T Consensus         1 M~IiI~Ga-G~vG~~La~~Ls~e-~~dV~vID~-----d~~~~~~~~~~lDv~~i~Gd~~~~~~L~~Agi-~~ad~~IAv   72 (455)
T PRK09496          1 MKIIILGA-GQVGGTLAERLVGE-NNDVTVIDT-----DEERLRRLQDRLDVRTVVGNGSHPDVLREAGA-EDADMLIAV   72 (455)
T ss_pred             CEEEEECC-CHHHHHHHHHHHHC-CCCEEEEEC-----CHHHHHHHHHHCCEEEEEECCCCHHHHHHCCC-CCCCEEEEE
T ss_conf             97999998-88999999999868-997999989-----99999998862586899966899999996599-869999995


No 262
>KOG1014 consensus
Probab=98.18  E-value=2.8e-06  Score=57.68  Aligned_cols=169  Identities=22%  Similarity=0.226  Sum_probs=101.4

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHH-HHHHCC--CCEEEEECCCCCHH----HHHHHHHHCCCC
Q ss_conf             89976788277999999998689879999478876585677-762037--97499976388999----999998622787
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSL-KEISQS--NLFSFLQVDICDRE----CIRSALKEFQPD   75 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~-~~~~~~--~~v~~i~~Di~d~~----~l~~~~~~~~~d   75 (358)
                      ..|||||.=||+..+++|.+ .|.+|+.+-|..  ..++.. +++...  -.+.++..|.++.+    .+.+.+.+..+.
T Consensus        52 AVVTGaTDGIGKayA~eLAk-rG~nvvLIsRt~--~KL~~v~kEI~~~~~vev~~i~~Dft~~~~~ye~i~~~l~~~~Vg  128 (312)
T KOG1014          52 AVVTGATDGIGKAYARELAK-RGFNVVLISRTQ--EKLEAVAKEIEEKYKVEVRIIAIDFTKGDEVYEKLLEKLAGLDVG  128 (312)
T ss_pred             EEEECCCCCCHHHHHHHHHH-CCCEEEEEECCH--HHHHHHHHHHHHHHCCEEEEEEEECCCCCHHHHHHHHHHCCCCEE
T ss_conf             99977888522999999997-598799996888--999999999988758079999986489815689999886278648


Q ss_pred             EEEEECCCCC-CCCCCCC-CC----CCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             1785123433-2222222-22----2222222222024788865123221124784278630554311222222222222
Q gi|254780920|r   76 AIVNFAAESH-VDRSILG-AD----EFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDM  149 (358)
Q Consensus        76 ~ViHlAa~~~-~~~~~~~-p~----~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~  149 (358)
                      +.++.++.+. .+.+..+ |.    ..+.+|+.++..+.+..     .-.....+.-.+|.+||.+-.     .      
T Consensus       129 ILVNNvG~~~~~P~~f~~~~~~~~~~ii~vN~~~~~~~t~~i-----lp~M~~r~~G~IvnigS~ag~-----~------  192 (312)
T KOG1014         129 ILVNNVGMSYDYPESFLKYPEGELQNIINVNILSVTLLTQLI-----LPGMVERKKGIIVNIGSFAGL-----I------  192 (312)
T ss_pred             EEEECCCCCCCCCHHHHHCCHHHHHHEEEEECCHHHHHHHHH-----HHHHHCCCCCEEEEECCCCCC-----C------
T ss_conf             999655316788377873855645314677432689999885-----055533788669982263355-----6------


Q ss_pred             CCCCCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCCCC
Q ss_conf             22222222333221000000123332---222222222222333
Q gi|254780920|r  150 PYNPSSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNYGP  190 (358)
Q Consensus       150 ~~~p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vyGp  190 (358)
                      |..-.+.|+.||..-+.+.....++|   |+.+..+-|.-|-++
T Consensus       193 p~p~~s~ysasK~~v~~~S~~L~~Ey~~~gI~Vq~v~p~~VaTk  236 (312)
T KOG1014         193 PTPLLSVYSASKAFVDFFSRCLQKEYESKGIFVQSVIPYLVATK  236 (312)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEHHHEECC
T ss_conf             67157887787888888779999998766769999503551234


No 263
>KOG1207 consensus
Probab=98.17  E-value=5.3e-06  Score=55.98  Aligned_cols=204  Identities=20%  Similarity=0.242  Sum_probs=127.6

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHH-H-CCCCEEEEECCCCCHHHHHHHHHHC-CCCEEE
Q ss_conf             489976788277999999998689879999478876585677762-0-3797499976388999999998622-787178
Q gi|254780920|r    2 RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEI-S-QSNLFSFLQVDICDRECIRSALKEF-QPDAIV   78 (358)
Q Consensus         2 kILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~-~-~~~~v~~i~~Di~d~~~l~~~~~~~-~~d~Vi   78 (358)
                      .||+||+.--||+.+|..|. ..|.+|+++.|     +..++..+ . .+..++-+.+|+.+.+.+.+++... -.|..+
T Consensus         9 ~vlvTgagaGIG~~~v~~La-~aGA~ViAvaR-----~~a~L~sLV~e~p~~I~Pi~~Dls~wea~~~~l~~v~pidgLV   82 (245)
T KOG1207           9 IVLVTGAGAGIGKEIVLSLA-KAGAQVIAVAR-----NEANLLSLVKETPSLIIPIVGDLSAWEALFKLLVPVFPIDGLV   82 (245)
T ss_pred             EEEEECCCCCCCHHHHHHHH-HCCCEEEEEEC-----CHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHCCCCCHHHHH
T ss_conf             99960566641499999998-66887999956-----9889999985297642455751338999997614657513430


Q ss_pred             EECCCCCCC----CCCCCCCCCCCCCCCCCCHHHHHH-HHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             512343322----222222222222222220247888-651232211247842786305543112222222222222222
Q gi|254780920|r   79 NFAAESHVD----RSILGADEFITTNIIGTFILLEET-RLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNP  153 (358)
Q Consensus        79 HlAa~~~~~----~~~~~p~~~~~~Nv~gt~nil~~~-~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p  153 (358)
                      +-|+.....    ...++.+..+++|+.+..++-+.. |.+   .  .+...-.+|..||-+     ...|+      ..
T Consensus        83 NNAgvA~~~pf~eiT~q~fDr~F~VNvravi~v~Q~var~l---v--~R~~~GaIVNvSSqa-----s~R~~------~n  146 (245)
T KOG1207          83 NNAGVATNHPFGEITQQSFDRTFAVNVRAVILVAQLVARNL---V--DRQIKGAIVNVSSQA-----SIRPL------DN  146 (245)
T ss_pred             CCCHHHHCCHHHHHHHHHHCCEEEEEEEEEEEHHHHHHHHH---H--HCCCCCEEEEECCHH-----CCCCC------CC
T ss_conf             35014431637888687630004542122210899988766---6--405886089740211-----03666------88


Q ss_pred             CCCCCCCCCCCEEEECCCCCCC---CCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222333221000000123332---2222222222223---332222222222222222222222222223322113322
Q gi|254780920|r  154 SSPYSATKASSDYLVLAWGHTY---GIPVLLSNCSNNY---GPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVE  227 (358)
Q Consensus       154 ~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~~~vy---Gp~~~~~~~i~~~i~~~~~g~~~~i~g~g~~~Rdfi~v~  227 (358)
                      .+.|..+|.+.+.+.+..+-+.   .+++-.+.|..|.   |-..+.+   |.--..++..-|         ..-|.-|+
T Consensus       147 HtvYcatKaALDmlTk~lAlELGp~kIRVNsVNPTVVmT~MG~dnWSD---P~K~k~mL~riP---------l~rFaEV~  214 (245)
T KOG1207         147 HTVYCATKAALDMLTKCLALELGPQKIRVNSVNPTVVMTDMGRDNWSD---PDKKKKMLDRIP---------LKRFAEVD  214 (245)
T ss_pred             CEEEEECHHHHHHHHHHHHHHHCCCEEEEECCCCEEEEECCCCCCCCC---CHHCCCHHHHCC---------HHHHHHHH
T ss_conf             347751387899999998875186415740558718881146444689---101053554376---------55555799


Q ss_pred             CCCCCEEECCCC
Q ss_conf             220000000122
Q gi|254780920|r  228 DHVRALYLVLKK  239 (358)
Q Consensus       228 D~a~~i~~~~~~  239 (358)
                      +++.|++.++..
T Consensus       215 eVVnA~lfLLSd  226 (245)
T KOG1207         215 EVVNAVLFLLSD  226 (245)
T ss_pred             HHHHHHEEEEEC
T ss_conf             997563256525


No 264
>KOG1478 consensus
Probab=98.17  E-value=6.3e-06  Score=55.50  Aligned_cols=177  Identities=23%  Similarity=0.303  Sum_probs=102.9

Q ss_pred             CE--EEEECCCCHHHHHHHHHHHHHCCCEE---EEEE--CCCCCCC-HHHHHHHHC--CCCEEEEECCCCCHHHHHHHHH
Q ss_conf             94--89976788277999999998689879---9994--7887658-567776203--7974999763889999999986
Q gi|254780920|r    1 MR--LIVTGGAGFIGSALCRYLVNDLKIQV---LVID--KLTYAGN-LNSLKEISQ--SNLFSFLQVDICDRECIRSALK   70 (358)
Q Consensus         1 Mk--ILItG~tGfIGs~l~~~Ll~~~~~~V---~~~d--~~~~~~~-~~~~~~~~~--~~~v~~i~~Di~d~~~l~~~~~   70 (358)
                      ||  +||||++--+|-.+|.+|++.-+.+|   +++.  +++.... -..++++..  .-.++++..|++|..++.++.+
T Consensus         2 ~RKvalITGanSglGl~i~~RLl~~~De~~~ltl~ltcR~~~kae~vc~~lk~f~p~~~i~~~yvlvD~sNm~Sv~~A~~   81 (341)
T KOG1478           2 MRKVALITGANSGLGLAICKRLLAEDDENVRLTLCLTCRNMSKAEAVCAALKAFHPKSTIEVTYVLVDVSNMQSVFRASK   81 (341)
T ss_pred             CCEEEEEECCCCCCCHHHHHHHHHCCCCCEEEEEEEEECCHHHHHHHHHHHHHHCCCCEEEEEEEEEEHHHHHHHHHHHH
T ss_conf             72389994488864399999997515776169999971772679999999997488761379999985065899999999


Q ss_pred             HC-----CCCEEEEECCC-CCCC------------------------------CCCCCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             22-----78717851234-3322------------------------------222222222222222220247888651
Q gi|254780920|r   71 EF-----QPDAIVNFAAE-SHVD------------------------------RSILGADEFITTNIIGTFILLEETRLW  114 (358)
Q Consensus        71 ~~-----~~d~ViHlAa~-~~~~------------------------------~~~~~p~~~~~~Nv~gt~nil~~~~~~  114 (358)
                      +.     +.|+|+--||. +.++                              .+.++--+.+++||-|-..++...--.
T Consensus        82 di~~rf~~ld~iylNAg~~~~~gi~w~~avf~~fsnpv~amt~pt~~~~t~G~is~D~lg~iFetnVFGhfyli~~l~pl  161 (341)
T KOG1478          82 DIKQRFQRLDYIYLNAGIMPNPGINWKAAVFGLFSNPVIAMTSPTEGLLTQGKISADGLGEIFETNVFGHFYLIRELEPL  161 (341)
T ss_pred             HHHHHHHHCCEEEECCCCCCCCCCCHHHHHHHHHHCHHHHHCCCHHHHHHCCEECCCCHHHHHHHCCCCHHHHHHHHHHH
T ss_conf             99988653358997156578876359999999860236775281066552451335536667520444110248655367


Q ss_pred             CCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCC---CCCCCCCCC
Q ss_conf             2322112478427863055431122222222222222222222333221000000123332---222222222
Q gi|254780920|r  115 WSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTY---GIPVLLSNC  184 (358)
Q Consensus       115 ~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~~~~p~s~Yg~sK~~~E~~~~~~~~~~---~l~~~ilR~  184 (358)
                           .+.....++|.+||...  .....-+.+-+..+..-||..||++.+.+--+..+..   |+..-++-|
T Consensus       162 -----l~~~~~~~lvwtSS~~a--~kk~lsleD~q~~kg~~pY~sSKrl~DlLh~A~~~~~~~~g~~qyvv~p  227 (341)
T KOG1478         162 -----LCHSDNPQLVWTSSRMA--RKKNLSLEDFQHSKGKEPYSSSKRLTDLLHVALNRNFKPLGINQYVVQP  227 (341)
T ss_pred             -----HHCCCCCEEEEEEECCC--CCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCCCCHHHHCCCC
T ss_conf             -----64379973899720114--6656887887643378974211789999999986144511234520467


No 265
>pfam08643 DUF1776 Fungal family of unknown function (DUF1776). This is a fungal family of unknown function. One of the proteins in this family has been localized to the mitochondria.
Probab=98.16  E-value=3.4e-06  Score=57.14  Aligned_cols=167  Identities=12%  Similarity=0.086  Sum_probs=102.5

Q ss_pred             EEEEC-CCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCC-----CC-
Q ss_conf             89976-788277999999998689879999478876585677762037974999763889999999986227-----87-
Q gi|254780920|r    3 LIVTG-GAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQ-----PD-   75 (358)
Q Consensus         3 ILItG-~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~-----~d-   75 (358)
                      |||+| .+-=||+.++..| .+.|+.|++.-+..  .....++. ...++++.+..|+++++.+..+++.+.     +. 
T Consensus         6 Vli~Gs~~~pi~R~iA~dL-~rrGf~Vfa~~r~~--~~~~~l~~-~~~~~i~~L~lDvt~~~si~~a~~~~~~~l~~~~~   81 (296)
T pfam08643         6 VLVAGSPTEPLTRSIALDL-ERRGFIVFVTVTSA--EEYKTVES-EQREDIRPLWLDDTAPSSAEASLSEFLQLLETPHA   81 (296)
T ss_pred             EEEECCCCCCHHHHHHHHH-HHCCCEEEEEECCH--HHHHHHHH-HCCCCCCEEEEECCCHHHHHHHHHHHHHHHCCCCC
T ss_conf             9996699974589999999-96897899995777--88999986-24478852774078826799999999998067665


Q ss_pred             -------------EEEEECCCC---CCCC--CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCC-
Q ss_conf             -------------178512343---3222--222222222222222202478886512322112478427863055431-
Q gi|254780920|r   76 -------------AIVNFAAES---HVDR--SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEV-  136 (358)
Q Consensus        76 -------------~ViHlAa~~---~~~~--~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~v-  136 (358)
                                   .|+..++..   ++-+  ..+.-...+++|+.|...+..+.-=+   +.....+.+.+++.+|..- 
T Consensus        82 ~~~g~~~~~l~L~gvi~~p~l~~p~Gpie~i~~~~~~~~~~~N~~g~i~~tq~~LPl---lr~~~~~~~iIv~~~Si~g~  158 (296)
T pfam08643        82 PFPGAKPHVLRLRGVILVPSLSYPSGPIETIPPSSWASELNTRLLNPILTLQGLLPL---LTSRSQKSKLIVFNPSISSS  158 (296)
T ss_pred             CCCCCCCCCCEEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH---HHHCCCCCCEEEEECCCCCC
T ss_conf             557887552223247852676678785100899999999999949999999998888---87346897289996763114


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCC---CCCCCCCCCCCCCCC
Q ss_conf             1222222222222222222223332210000001233---322222222222223
Q gi|254780920|r  137 YGSLDKGLFSEDMPYNPSSPYSATKASSDYLVLAWGH---TYGIPVLLSNCSNNY  188 (358)
Q Consensus       137 Yg~~~~~~~~E~~~~~p~s~Yg~sK~~~E~~~~~~~~---~~~l~~~ilR~~~vy  188 (358)
                      .+    .|+        .++|..+|.+.|.+....++   .+|++++.++|+++-
T Consensus       159 ~~----~P~--------~~~y~ask~ale~~s~~LR~El~~~gI~V~~i~pG~i~  201 (296)
T pfam08643       159 LN----PPY--------HAPEALVSSALSTFFTILTRELRPHNIDVTQIKLGNLD  201 (296)
T ss_pred             CC----CCC--------CCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCC
T ss_conf             56----875--------35999999999999999998743159659999445304


No 266
>KOG1199 consensus
Probab=98.12  E-value=2.9e-05  Score=51.50  Aligned_cols=156  Identities=23%  Similarity=0.267  Sum_probs=98.6

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             8997678827799999999868987999947887658567776203797499976388999999998622-----78717
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEF-----QPDAI   77 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~-----~~d~V   77 (358)
                      -|||||.--+|...++.|.++ |.+|..+|...+.+.- -.++  ...++-|...|++..+++..++...     +.|..
T Consensus        12 alvtggasglg~ataerlakq-gasv~lldlp~skg~~-vake--lg~~~vf~padvtsekdv~aala~ak~kfgrld~~   87 (260)
T KOG1199          12 ALVTGGASGLGKATAERLAKQ-GASVALLDLPQSKGAD-VAKE--LGGKVVFTPADVTSEKDVRAALAKAKAKFGRLDAL   87 (260)
T ss_pred             EEEECCCCCCCHHHHHHHHHC-CCEEEEEECCCCCCHH-HHHH--HCCCEEEECCCCCCHHHHHHHHHHHHHHCCCEEEE
T ss_conf             786167552027789999846-8607987277654467-9998--48936982166674788999999877660550026


Q ss_pred             EEECCCCCCCC----------CCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCC--CCCCCCCCCCCC
Q ss_conf             85123433222----------222222222222222202478886512322112478427863055--431122222222
Q gi|254780920|r   78 VNFAAESHVDR----------SILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQIST--DEVYGSLDKGLF  145 (358)
Q Consensus        78 iHlAa~~~~~~----------~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS--~~vYg~~~~~~~  145 (358)
                      ++||+....-.          ..++....+++|++||.|++....-.... .....+..|=|.+-|  .+.|..      
T Consensus        88 vncagia~a~ktyn~~k~~~h~ledfqrvidvn~~gtfnvirl~aglmg~-nepdq~gqrgviintasvaafdg------  160 (260)
T KOG1199          88 VNCAGIAYAFKTYNVQKKKHHDLEDFQRVIDVNVLGTFNVIRLGAGLMGE-NEPDQNGQRGVIINTASVAAFDG------  160 (260)
T ss_pred             EECCCEEEEEEEEEECCCCCCCHHHHHHEEEEEEEEEEEEEEEHHHHHCC-CCCCCCCCCEEEEEECEEEEECC------
T ss_conf             53232025443443134654528986550432001255442320244247-88887884137982000012357------


Q ss_pred             CCCCCCCCCCCCCCCCCCCEEEECCCCCC
Q ss_conf             22222222222233322100000012333
Q gi|254780920|r  146 SEDMPYNPSSPYSATKASSDYLVLAWGHT  174 (358)
Q Consensus       146 ~E~~~~~p~s~Yg~sK~~~E~~~~~~~~~  174 (358)
                           ......|+.||.+.--+..-.++.
T Consensus       161 -----q~gqaaysaskgaivgmtlpiard  184 (260)
T KOG1199         161 -----QTGQAAYSASKGAIVGMTLPIARD  184 (260)
T ss_pred             -----CCCHHHHHCCCCCEEEEECHHHHH
T ss_conf             -----432555411467367544112232


No 267
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. Members of this subfamily are localized to the glycosome and mitochondria. MDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Probab=97.87  E-value=3.6e-05  Score=50.90  Aligned_cols=182  Identities=18%  Similarity=0.120  Sum_probs=90.0

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCC-CEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEE
Q ss_conf             9489976788277999999998689-879999478876585677762037974999763889999999986227871785
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLK-IQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVN   79 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~-~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~ViH   79 (358)
                      |||-|.||+|.+|++++..|..+.- .++..+|.....+.-..+.++.....+.-+.++    ..+.+.+++  .|+|+=
T Consensus         1 mKV~IIGA~G~VG~~~A~~l~~~~~~~elvLiDi~~~~g~a~DL~h~~~~~~v~~~~~~----~~~~~~l~d--aDiVVi   74 (310)
T cd01337           1 VKVAVLGAAGGIGQPLSLLLKLNPLVSELALYDIVNTPGVAADLSHINTPAKVTGYLGP----EELKKALKG--ADVVVI   74 (310)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHCCCCCCCEEEEECC----CCHHHHHCC--CCEEEE
T ss_conf             98999999981899999999729997769998277426675532165656851257088----746677479--999998


Q ss_pred             ECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEE-EEECCC-CCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             123433222222222222222222202478886512322112478427-863055-431122222222222222222222
Q gi|254780920|r   80 FAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFR-FLQIST-DEVYGSLDKGLFSEDMPYNPSSPY  157 (358)
Q Consensus        80 lAa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~-~v~~SS-~~vYg~~~~~~~~E~~~~~p~s~Y  157 (358)
                      .|+.+.-+  -+.-.+.++.|..-...+.+....+         .... ++.+|- ..+.=.....-+.....+.|.-..
T Consensus        75 tAG~~rkp--G~tR~dLl~~N~~I~k~i~~~i~~~---------~p~aiiivvtNPvD~lt~i~~~~~k~~~~~p~~rVi  143 (310)
T cd01337          75 PAGVPRKP--GMTRDDLFNINAGIVRDLATAVAKA---------CPKALILIISNPVNSTVPIAAEVLKKAGVYDPKRLF  143 (310)
T ss_pred             CCCCCCCC--CCCHHHHHHHHHHHHHHHHHHHHHC---------CCCEEEEEEECCHHHHHHHHHHHHHHHCCCCCCCEE
T ss_conf             78988997--9898999874078899999999820---------998499997083477999999999981799812078


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             33322100000012333222222222222233322222222222
Q gi|254780920|r  158 SATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLA  201 (358)
Q Consensus       158 g~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~~~~~i~~~  201 (358)
                      |.+-+-.-.+-...++..+++...++ ..|.|+|. .+.++|.|
T Consensus       144 G~T~LDsaR~r~~la~~l~v~~~~V~-a~ViGeH~-g~s~vPl~  185 (310)
T cd01337         144 GVTTLDVVRANTFVAELLGLDPAKVN-VPVIGGHS-GVTILPLL  185 (310)
T ss_pred             EEEEHHHHHHHHHHHHHHCCCHHHCE-EEEECCCC-CCCEEEEE
T ss_conf             76508889999999999597877706-67987569-87578750


No 268
>cd00704 MDH Malate dehydrogenase. Malate dehydrogenase (MDH) is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. MDHs belong to the NAD-dependent, lactate dehydrogenase (LDH)-like, 2-hydroxycarboxylate dehydrogenase family, which also includes the GH4 family of glycoside hydrolases. They are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Probab=97.79  E-value=2.1e-05  Score=52.31  Aligned_cols=196  Identities=14%  Similarity=0.082  Sum_probs=94.8

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHC--C----CEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCC
Q ss_conf             948997678827799999999868--9----8799994788765856777620379749997638899999999862278
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDL--K----IQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQP   74 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~--~----~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~   74 (358)
                      |||.||||+|+||++++..|.+..  |    ..+.-+|....-.......--..+-...+. ..+.-.....+.+++  .
T Consensus         1 ~KV~IiGA~G~IG~~la~~l~~~~l~g~~~~i~l~L~Di~~~~~~~~G~~mdl~~~a~~~~-~~v~~~~~~~~~~~~--a   77 (323)
T cd00704           1 LHVLITGAAGQIGYNLLFLIASGELFGDDQPVILHLLDIPPAMKALEGVVMELQDCAFPLL-KGVVITTDPEEAFKD--V   77 (323)
T ss_pred             CEEEEECCCCHHHHHHHHHHHCCCCCCCCCEEEEEEECCCCCCCCCHHHHHHHHHCCCCCC-CCEEECCCHHHHHCC--C
T ss_conf             9899989997899999999972863699860089997588865553148786653466555-874842885898379--9


Q ss_pred             CEEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCC---CCCCCCCCCCCCCCCCC
Q ss_conf             717851234332222222222222222222024788865123221124784278630554---31122222222222222
Q gi|254780920|r   75 DAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTD---EVYGSLDKGLFSEDMPY  151 (358)
Q Consensus        75 d~ViHlAa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~---~vYg~~~~~~~~E~~~~  151 (358)
                      |+|+=.|+.+--+  -+.-.+.++.|+.....+.+....+.       ....+++.+|--   .+|     ...+...-+
T Consensus        78 DvViitaG~prkp--G~tR~DLl~~N~~I~k~~~~~i~~~a-------~p~~~vivvsNPvD~~~~-----v~~k~sg~~  143 (323)
T cd00704          78 DVAILVGAFPRKP--GMERADLLRKNAKIFKEQGEALNKVA-------KPTVKVLVVGNPANTNAL-----IALKNAPNL  143 (323)
T ss_pred             CEEEECCCCCCCC--CCCHHHHHHHHHHHHHHHHHHHHHHC-------CCCCEEEEECCCCHHHHH-----HHHHHCCCC
T ss_conf             8899827878899--98279999874899999999998517-------998389995786468999-----999976999


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222223332210000001233322222222222223332222222222222222222222222
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYG  215 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i~g  215 (358)
                      .++..-+.+-+-.-++-...+++.+++...++-..|.|.++  +..+|.+=+.-..|.|+..+.
T Consensus       144 ~~~~i~~~t~LDsaR~r~~la~~l~v~~~~V~~~iI~GeHG--ds~vp~~s~a~V~G~p~~~~~  205 (323)
T cd00704         144 PPKNFTALTRLDHNRAKAQVARKLGVRVSDVKNVIIWGNHS--NTQVPDLSNAVVYGPGGTEWV  205 (323)
T ss_pred             CCCEEEEEEEHHHHHHHHHHHHHHCCCHHHCEEEEEEECCC--CCEEECCCCCEECCCCHHHHH
T ss_conf             82479996527999999999999783978927879998786--867863010889877067863


No 269
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. Members of this subfamily are bacterial MDHs, and plant MDHs localized to the choloroplasts. MDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Probab=97.77  E-value=1.3e-05  Score=53.61  Aligned_cols=190  Identities=15%  Similarity=0.128  Sum_probs=89.7

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHH--CC----CEEEEEECCCCCCCHHHHH-HHHC--CCCEEEEECCCCCHHHHHHHHHH
Q ss_conf             94899767882779999999986--89----8799994788765856777-6203--79749997638899999999862
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVND--LK----IQVLVIDKLTYAGNLNSLK-EISQ--SNLFSFLQVDICDRECIRSALKE   71 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~--~~----~~V~~~d~~~~~~~~~~~~-~~~~--~~~v~~i~~Di~d~~~l~~~~~~   71 (358)
                      |||.||||+|+||++|+..|.+.  .|    ..+..+|....-....... ++.+  .+...-+.+    .......+++
T Consensus         3 ~KV~IiGAaG~IG~~la~~la~g~l~g~~~~v~l~L~Di~~~~~~l~G~amDl~~~a~~~~~~v~~----~~~~~~a~~~   78 (322)
T cd01338           3 VRVAVTGAAGQIGYSLLFRIASGEMFGPDQPVILQLLELPQALKALEGVAMELEDCAFPLLAEIVI----TDDPNVAFKD   78 (322)
T ss_pred             EEEEEECCCCHHHHHHHHHHHHCHHCCCCCEEEEEEECCCCCCCCCCEEEEEHHHCCCCCCCCEEE----ECCHHHHHCC
T ss_conf             099998999689999999997111307997269999757575666765774453267654587797----4887898378


Q ss_pred             CCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCC---CCCCCCCCCCCCCC
Q ss_conf             278717851234332222222222222222222024788865123221124784278630554---31122222222222
Q gi|254780920|r   72 FQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTD---EVYGSLDKGLFSED  148 (358)
Q Consensus        72 ~~~d~ViHlAa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~---~vYg~~~~~~~~E~  148 (358)
                        .|+|+=.|+.+--+  -+.-.+.++.|..-...+-++...+      +..+ .+++.+|.-   .+|=     .+...
T Consensus        79 --aDvVvitaG~prkP--G~tR~DLl~~Na~I~~~~~~~i~~~------a~p~-~~vivvsNPvd~~~~v-----~~k~~  142 (322)
T cd01338          79 --ADWALLVGAKPRGP--GMERADLLKANGKIFTAQGKALNDV------ASRD-VKVLVVGNPCNTNALI-----AMKNA  142 (322)
T ss_pred             --CCEEEEECCCCCCC--CCCHHHHHHHHHHHHHHHHHHHHHH------CCCC-CEEEEECCHHHHHHHH-----HHHHC
T ss_conf             --87899936878998--9818999998689999999999975------7988-3899957818889999-----99976


Q ss_pred             CCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222223332210000001233322222222222223332222222222222222222222
Q gi|254780920|r  149 MPYNPSSPYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVF  212 (358)
Q Consensus       149 ~~~~p~s~Yg~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~  212 (358)
                      .-+.|+..-|.+-+-.-.+-...++..+++...++-..|.|.++  +..+|.+-..-..|.|+.
T Consensus       143 ~~~~~~~i~~~t~LDs~R~r~~la~~l~v~~~~V~~~vv~G~HG--ds~vp~~s~a~V~G~pl~  204 (322)
T cd01338         143 PDIPPDNFTAMTRLDHNRAKSQLAKKAGVPVTDVKNMVIWGNHS--PTQYPDFTNATIGGKPAA  204 (322)
T ss_pred             CCCCHHHEEEEEHHHHHHHHHHHHHHHCCCHHHCEEEEEEECCC--CCEEECCCCCEECCEEHH
T ss_conf             89974609996349999999999998497967754558970588--827742125659889989


No 270
>PRK05442 malate dehydrogenase; Provisional
Probab=97.51  E-value=4.5e-05  Score=50.30  Aligned_cols=192  Identities=14%  Similarity=0.105  Sum_probs=87.9

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHH------CCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCC
Q ss_conf             94899767882779999999986------898799994788765856777620379749997638899999999862278
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVND------LKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQP   74 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~------~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~   74 (358)
                      |||.||||+|+||++|+..|.+.      ....+.-+|....-.......--..+-.+.++ .++.-.....++|++  .
T Consensus         5 ~kV~I~GAaG~ig~~l~~~la~g~l~g~~~~v~l~L~Di~~~~~~l~G~ameL~d~a~p~l-~~v~~~~~~~~a~~~--a   81 (325)
T PRK05442          5 VRVAVTGAAGQIGYSLLFRIASGDMLGKDQPVILQLLEIPQAQKALKGVVMELEDCAFPLL-AGVVITDDPKVAFKD--A   81 (325)
T ss_pred             EEEEEECCCCHHHHHHHHHHHCHHHCCCCCCEEEEEECCCCCCCCCCEEEEEHHCCCCCCC-CCEEEECCHHHHHCC--C
T ss_conf             2999988886888999999866132089984699996577766655667734211675444-876850887898379--9


Q ss_pred             CEEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCC---CCCCCCCCCCCCCCCCC
Q ss_conf             717851234332222222222222222222024788865123221124784278630554---31122222222222222
Q gi|254780920|r   75 DAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTD---EVYGSLDKGLFSEDMPY  151 (358)
Q Consensus        75 d~ViHlAa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~---~vYg~~~~~~~~E~~~~  151 (358)
                      |+|+=.|+.+--+  -+.-.+.++.|......+.++...+      +..++ +++.+|--   .+|=     ......-+
T Consensus        82 Dvviitag~prkP--GmtR~DLl~~Na~I~~~~~~~i~~~------a~~~~-~vlVv~NPvd~~~~v-----~~k~a~~~  147 (325)
T PRK05442         82 DVALLVGARPRGP--GMERKDLLKANGEIFTAQGKALNEV------AARDV-KVLVVGNPANTNALI-----AMKNAPDL  147 (325)
T ss_pred             CEEEECCCCCCCC--CCCHHHHHHHHHHHHHHHHHHHHHH------CCCCE-EEEEECCCHHHHHHH-----HHHHCCCC
T ss_conf             8899807867999--9748999976088999999999865------79871-899957815879999-----99977999


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222333221000000123332222222222222333222222222222222222222
Q gi|254780920|r  152 NPSSPYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHV  211 (358)
Q Consensus       152 ~p~s~Yg~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~  211 (358)
                      .|...-|.+.+-.-++-...+++.+++..-++-..|.|.++  +..+|.+-..-..|.|+
T Consensus       148 p~~~i~~~t~LD~~R~~~~lA~~l~v~~~~V~~~iIwG~Hg--dt~~p~~s~a~V~G~p~  205 (325)
T PRK05442        148 PAKNFTAMLRLDHNRALSQLAAKAGVPVADIKKLVVWGNHS--PTQYPDFRHATIDGKPA  205 (325)
T ss_pred             CHHHEEEEEHHHHHHHHHHHHHHHCCCHHHCEEEEEEECCC--CCEEECHHHCEECCEEC
T ss_conf             87998974289999999999999792978936669997688--86774657848998982


No 271
>PRK05086 malate dehydrogenase; Provisional
Probab=97.45  E-value=0.001  Score=42.00  Aligned_cols=179  Identities=17%  Similarity=0.080  Sum_probs=85.8

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHC--CCEEEEEECCCCC-CCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEE
Q ss_conf             948997678827799999999868--9879999478876-5856777620379749997638899999999862278717
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDL--KIQVLVIDKLTYA-GNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAI   77 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~--~~~V~~~d~~~~~-~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~d~V   77 (358)
                      |||-|+||+|.+|++++..|..+.  ..++..+|..... +.--.+.+....-.+.-+.++  |   ..+.+++  .|+|
T Consensus         1 mKV~IiGA~G~VG~s~A~~l~~~~~~~~el~L~Di~~~~~G~alDL~h~~~~~~~~~~~~~--~---~~~~l~~--adiV   73 (312)
T PRK05086          1 MKVAVLGAAGGIGQALALLLKTQLPAGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSGE--D---PTPALEG--ADVV   73 (312)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCHHHHHHCCCCCCCCCEEECC--C---HHHHHCC--CCEE
T ss_conf             9899998998699999999982898777499975888861056565478754665346169--8---6787179--9999


Q ss_pred             EEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEE-EEECCC-CCC--CCCCCCCCCCCCCCCCC
Q ss_conf             85123433222222222222222222202478886512322112478427-863055-431--12222222222222222
Q gi|254780920|r   78 VNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFR-FLQIST-DEV--YGSLDKGLFSEDMPYNP  153 (358)
Q Consensus        78 iHlAa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~-~v~~SS-~~v--Yg~~~~~~~~E~~~~~p  153 (358)
                      +=.|+.+--+  -+.-.+.++.|..-...+.+....+         .... ++.+|- ..+  |=.  ..-+....-+.|
T Consensus        74 vitAG~~rkp--G~tR~dLl~~Na~I~~~i~~~I~~~---------~p~aiiivvsNPvD~mt~ia--~~~~k~~g~~~~  140 (312)
T PRK05086         74 LISAGVARKP--GMDRSDLFNVNAGIVKNLVEKVAKT---------CPKACIGIITNPVNTTVAIA--AEVLKKAGVYDK  140 (312)
T ss_pred             EECCCCCCCC--CCCHHHHHHHHHHHHHHHHHHHHHC---------CCCCEEEEECCCHHHHHHHH--HHHHHHCCCCCC
T ss_conf             9878989985--8988999998789999999988720---------89718999548327789999--999998389980


Q ss_pred             CCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222233322100000012333222222222222233322222222222
Q gi|254780920|r  154 SSPYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLA  201 (358)
Q Consensus       154 ~s~Yg~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~~~~~i~~~  201 (358)
                      .-.-|.+=+-.-.+-...++..+++...+. ..|.|.|+. +.++|.|
T Consensus       141 ~rv~G~t~LDsaR~r~~la~~l~v~~~~V~-~~ViGeHg~-~t~vPl~  186 (312)
T PRK05086        141 NKLFGVTTLDVIRSETFVAELKGKNPGEVE-VPVIGGHSG-VTILPLL  186 (312)
T ss_pred             CCEEEEEHHHHHHHHHHHHHHHCCCHHHCE-EEEECCCCC-CCEEEEE
T ss_conf             113333128899999999998594866747-769723588-7278630


No 272
>PRK08309 short chain dehydrogenase; Provisional
Probab=97.43  E-value=0.00066  Score=43.18  Aligned_cols=67  Identities=24%  Similarity=0.467  Sum_probs=48.3

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHH-HHHCCCCEEEEECCCCCHHHHHHHHHH
Q ss_conf             94899767882779999999986898799994788765856777-620379749997638899999999862
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLK-EISQSNLFSFLQVDICDRECIRSALKE   71 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~-~~~~~~~v~~i~~Di~d~~~l~~~~~~   71 (358)
                      |..||.||||++. .++..|..+ |++|.++-|...  ...+.. .-..+..+.++..|-.|.+.+..++.+
T Consensus         1 mhaLVIGGTGML~-~vs~~L~~q-g~~VsiiaR~~~--kl~~~~~~~~~p~~i~~l~~DY~d~~~l~~~l~~   68 (182)
T PRK08309          1 MHALVIGGTGMLK-RVSLWLCEE-GFHVSIIARDEV--KLENVKRESGTPESITCLPLDYHDDDAVKLAIKR   68 (182)
T ss_pred             CCEEEECCCHHHH-HHHHHHHHC-CCEEEEEECCHH--HHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHH
T ss_conf             9169972417559-999999737-999999944878--8653686237986325787464886999999999


No 273
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity. The LDH-like MDH proteins have a lactate dehyhydrogenase-like (LDH-like) structure and malate dehydrogenase (MDH) enzymatic activity. This subgroup is composed of some archaeal LDH-like MDHs that prefer NADP(H) rather than NAD(H) as a cofactor. One member, MJ0490 from Methanococcus jannaschii, has been observed to form dimers and tetramers during crystalization, although it is believed to exist primarilly as a tetramer in solution. In addition to its MDH activity, MJ0490 also possesses fructose-1,6-bisphosphate-activated LDH activity. Members of this subgroup have a higher sequence similarity to LDHs than to other MDHs. LDH catalyzes the last step of glycolysis in which pyruvate is converted to L-lactate. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carbox
Probab=97.36  E-value=0.00031  Score=45.20  Aligned_cols=186  Identities=11%  Similarity=0.114  Sum_probs=87.4

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHC-CCEEEEEECCCCC----CCHHHHHHH--HCCCCEEEEECCCCCHHHHHHHHHHCC
Q ss_conf             948997678827799999999868-9879999478876----585677762--037974999763889999999986227
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDL-KIQVLVIDKLTYA----GNLNSLKEI--SQSNLFSFLQVDICDRECIRSALKEFQ   73 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~-~~~V~~~d~~~~~----~~~~~~~~~--~~~~~v~~i~~Di~d~~~l~~~~~~~~   73 (358)
                      |||-|+||+|.||++++..|+.+. -.++..+|.....    +....+.+.  ..........+  .|++.    +++  
T Consensus         1 mKV~IiGAaG~VG~~~a~~l~~~~~~~el~LiD~~~~~~~a~g~a~Dl~~~~~~~~~~~~i~~~--~d~~~----~~d--   72 (309)
T cd05294           1 MKVSIIGASGRVGSATALLLAKEDVVKEINLISRPKSLEKLKGLRLDIYDALAAAGIDAEIKIS--SDLSD----VAG--   72 (309)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCEEEHHHHCCCCCCCCCCEEEEC--CCHHH----HCC--
T ss_conf             9899999997699999999983799875999605564342311235545034336887679827--98899----689--


Q ss_pred             CCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCC---CCCCCC
Q ss_conf             87178512343322222222222222222220247888651232211247842786305543112222222---222222
Q gi|254780920|r   74 PDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGL---FSEDMP  150 (358)
Q Consensus        74 ~d~ViHlAa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~---~~E~~~  150 (358)
                      .|+|+=.|+.+..+  -.+-.+.+..|+.-...+......+        .....++.+|-      |-+..   ......
T Consensus        73 aDivVitAG~~rk~--g~tR~dLl~~Na~I~~~i~~~i~~~--------~p~~ivivvtN------PvDv~t~~~~k~sg  136 (309)
T cd05294          73 SDIVIITAGVPRKE--GMSRLDLAKKNAKIVKKYAKQIAEF--------APDTKILVVTN------PVDVMTYKALKESG  136 (309)
T ss_pred             CCEEEECCCCCCCC--CCCHHHHHHHHHHHHHHHHHHHHCC--------CCCEEEEECCC------CHHHHHHHHHHHCC
T ss_conf             99999878988995--9987899998999999999876426--------99849997689------65779999999669


Q ss_pred             CCCCCCCCCC-CCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222333-22100000012333222222222222233322222222222222222222222
Q gi|254780920|r  151 YNPSSPYSAT-KASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFL  213 (358)
Q Consensus       151 ~~p~s~Yg~s-K~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~~~~~i~~~i~~~~~g~~~~i  213 (358)
                      +.|.-..|.. -+-.-.+-...++..+++...++- .|.|.|+  +..+|.|=..-..|.|+.-
T Consensus       137 ~p~~rviG~gt~LDs~R~r~~la~~l~v~~~~V~~-~ViGeHG--ds~vp~~S~~~v~G~pl~~  197 (309)
T cd05294         137 FDKNRVFGLGTHLDSLRFKVAIAKHFNVHISEVHT-RIIGEHG--DSMVPLISSTSIGGIPIKR  197 (309)
T ss_pred             CCHHCEEEECCHHHHHHHHHHHHHHHCCCHHHCEE-EEEECCC--CCEEEEEEECEECCEEHHH
T ss_conf             88203887121387789999999996949667244-6884589--9555420204699899788


No 274
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. Members of this subfamily are eukaryotic MDHs localized to the cytoplasm and cytosol. MDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Probab=97.30  E-value=0.0005  Score=43.89  Aligned_cols=184  Identities=15%  Similarity=0.139  Sum_probs=86.9

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHH--CC----CEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCC
Q ss_conf             94899767882779999999986--89----8799994788765856777620379749997638899999999862278
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVND--LK----IQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQP   74 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~--~~----~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~~~~~   74 (358)
                      |||.||||+|+||.+|+..|.+.  .|    ..+..+|..........+.--..+-.+.. -.++.-....+++|++  .
T Consensus         3 ~kV~VtGAaG~Ig~~l~~~la~g~~~g~~~~i~L~L~Di~~~~~~l~Gv~mel~d~a~p~-l~~i~~~~~~~~a~~~--a   79 (325)
T cd01336           3 IRVLVTGAAGQIAYSLLPMIAKGDVFGPDQPVILHLLDIPPALKALEGVVMELQDCAFPL-LKSVVATTDPEEAFKD--V   79 (325)
T ss_pred             EEEEEECCCHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCCCCCEEEEEHHHCCCCC-CCCEEECCCHHHHHCC--C
T ss_conf             199998887188999999997588568997059999667786776552674574378645-5873522887898368--8


Q ss_pred             CEEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCC-CCCC
Q ss_conf             717851234332222222222222222222024788865123221124784278630554311222222222222-2222
Q gi|254780920|r   75 DAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDM-PYNP  153 (358)
Q Consensus        75 d~ViHlAa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~~v~~SS~~vYg~~~~~~~~E~~-~~~p  153 (358)
                      |+||=+|+.+--+  -..-.+.++.|......+-++...+      +..+ .+++.+|.- +  +....-..+.. -+.+
T Consensus        80 Dvvii~ag~prkp--GmtR~DLl~~Na~I~k~~~~~I~~~------a~p~-~~viVv~NP-v--n~~~~i~~~~a~~~p~  147 (325)
T cd01336          80 DVAILVGAMPRKE--GMERKDLLKANVKIFKEQGEALDKY------AKKN-VKVLVVGNP-A--NTNALILLKYAPSIPK  147 (325)
T ss_pred             CEEEEECCCCCCC--CCCHHHHHHHHHHHHHHHHHHHHHH------CCCC-EEEEEECCC-H--HHHHHHHHHHCCCCCH
T ss_conf             7899948877999--9827999998999999999999986------1458-199992793-5--8899999997799966


Q ss_pred             CCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222233322100000012333222222222222233322222222222
Q gi|254780920|r  154 SSPYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLA  201 (358)
Q Consensus       154 ~s~Yg~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~~~~~i~~~  201 (358)
                      +...|.+-+-.-......+++.+++..-++-..|.|.++  +..+|.+
T Consensus       148 ~~i~~~t~LD~~R~~~~lA~kl~v~~~~V~~~iIwG~Hg--~t~vP~~  193 (325)
T cd01336         148 ENFTALTRLDHNRAKSQIALKLGVPVSDVKNVIIWGNHS--STQYPDV  193 (325)
T ss_pred             HHEEEEEHHHHHHHHHHHHHHHCCCHHHEEEEEEEECCC--CCEEECC
T ss_conf             849984289999999999998598967846679998798--9678630


No 275
>PRK12767 carbamoyl phosphate synthase-like protein; Provisional
Probab=97.21  E-value=0.0023  Score=39.89  Aligned_cols=70  Identities=23%  Similarity=0.283  Sum_probs=45.7

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHH-CCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEEC-CCCCH---HHHHHHHHHCCCC
Q ss_conf             94899767882779999999986-8987999947887658567776203797499976-38899---9999998622787
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVND-LKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQV-DICDR---ECIRSALKEFQPD   75 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~-~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~-Di~d~---~~l~~~~~~~~~d   75 (358)
                      |||||||+.|  |.++++.|.+. .+..|++.|.-..+.....      -+  +++.. ...|+   +.+.++.++.++|
T Consensus         2 ~nILvt~~G~--~~~ii~~lk~~~~~~~Vi~~D~~~~a~~~~~------aD--~~y~~P~~~d~~y~~~ll~i~~~~~id   71 (325)
T PRK12767          2 MNILVTSAGR--RVQLVKALKKSLLGGKVIGADISPLAPALYF------AD--KFYVVPKVTDPNYIDALLDICKKENID   71 (325)
T ss_pred             CEEEEECCCC--HHHHHHHHHHCCCCCEEEEECCCCCCCCHHH------CC--EEEECCCCCCHHHHHHHHHHHHHHCCC
T ss_conf             4899986786--8999999997699859999689989953445------48--899878889878999999999987999


Q ss_pred             EEEEE
Q ss_conf             17851
Q gi|254780920|r   76 AIVNF   80 (358)
Q Consensus        76 ~ViHl   80 (358)
                      .|+-+
T Consensus        72 ~iiP~   76 (325)
T PRK12767         72 ALIPL   76 (325)
T ss_pred             EEEEC
T ss_conf             99977


No 276
>PRK06732 phosphopantothenate--cysteine ligase; Validated
Probab=97.20  E-value=0.002  Score=40.24  Aligned_cols=76  Identities=18%  Similarity=0.348  Sum_probs=50.3

Q ss_pred             CEEEEECC----------------CCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHH
Q ss_conf             94899767----------------88277999999998689879999478876585677762037974999763889999
Q gi|254780920|r    1 MRLIVTGG----------------AGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDREC   64 (358)
Q Consensus         1 MkILItG~----------------tGfIGs~l~~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~   64 (358)
                      ||||||+|                ||--|..|++++.. .|++|+.+-...   ...  +  ...++++.+.  +...++
T Consensus         1 ~kvLITaG~T~E~ID~VR~IsN~SSGk~G~aiA~~~~~-~Ga~Vtli~g~~---~~~--p--~~~~~~~~i~--v~ta~e   70 (228)
T PRK06732          1 MKILITSGGTTEPIDAVRGITNHSTGQLGKIIAETFLQ-AGHEVTLVTTKT---AVK--P--EPHPNLSIIE--IENVDD   70 (228)
T ss_pred             CEEEEECCCCCCCCCCCCEECCCCHHHHHHHHHHHHHH-CCCEEEEEECCC---CCC--C--CCCCCEEEEE--ECCHHH
T ss_conf             98999578876676884476767814999999999997-899899995677---568--8--9889858999--458999


Q ss_pred             HHHHHHHC--CCCEEEEECCCCCC
Q ss_conf             99998622--78717851234332
Q gi|254780920|r   65 IRSALKEF--QPDAIVNFAAESHV   86 (358)
Q Consensus        65 l~~~~~~~--~~d~ViHlAa~~~~   86 (358)
                      +.+.+.+.  +.|++||.||.+..
T Consensus        71 m~~~~~~~~~~~D~~I~aAAVsDy   94 (228)
T PRK06732         71 LLATLKPLVPHHDVLIHSMAVSDY   94 (228)
T ss_pred             HHHHHHHHCCCCCEEEEEEEECCC
T ss_conf             999999747899999993181015


No 277
>KOG1204 consensus
Probab=97.20  E-value=6.5e-05  Score=49.30  Aligned_cols=164  Identities=15%  Similarity=0.160  Sum_probs=92.3

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEE--EEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHH-----HCCCC
Q ss_conf             89976788277999999998689879--999478876585677762037974999763889999999986-----22787
Q gi|254780920|r    3 LIVTGGAGFIGSALCRYLVNDLKIQV--LVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALK-----EFQPD   75 (358)
Q Consensus         3 ILItG~tGfIGs~l~~~Ll~~~~~~V--~~~d~~~~~~~~~~~~~~~~~~~v~~i~~Di~d~~~l~~~~~-----~~~~d   75 (358)
                      ||+||++-=||.-++..++.+ +.+.  ++. +..... ...+.-..- ...-...+|+++...+..+++     ..+-|
T Consensus         9 illTGaSrgiG~~~v~~i~ae-d~e~~r~g~-~r~~a~-~~~L~v~~g-d~~v~~~g~~~e~~~l~al~e~~r~k~gkr~   84 (253)
T KOG1204           9 ILLTGASRGIGTGSVATILAE-DDEALRYGV-ARLLAE-LEGLKVAYG-DDFVHVVGDITEEQLLGALREAPRKKGGKRD   84 (253)
T ss_pred             EEEECCCCCCCHHHHHHHHHC-CHHHHHHHH-HCCCCC-CCCEEEEEC-CCCCEECHHHHHHHHHHHHHHHHHHCCCCEE
T ss_conf             999257777558789999962-427888866-303566-666588716-8731220278888999999850453477156


Q ss_pred             EEEEECCCCCCC-CCC------CCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCC--CEEEEECCCCCCCCCCCCCCCC
Q ss_conf             178512343322-222------2222222222222202478886512322112478--4278630554311222222222
Q gi|254780920|r   76 AIVNFAAESHVD-RSI------LGADEFITTNIIGTFILLEETRLWWSCLSQDKKD--QFRFLQISTDEVYGSLDKGLFS  146 (358)
Q Consensus        76 ~ViHlAa~~~~~-~~~------~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~--~~~~v~~SS~~vYg~~~~~~~~  146 (358)
                      .|||-|+-.++- .-.      ..-..+++.|+.+...+-..+.      ...+..  .+-+|+.||.+.-     .   
T Consensus        85 iiI~NAG~lgdvsk~~~~~~D~~qw~ky~~~NlfS~VsL~~~~l------~~lk~~p~~~~vVnvSS~aav-----~---  150 (253)
T KOG1204          85 IIIHNAGSLGDVSKGAVDLGDSDQWKKYWDLNLFSMVSLVQWAL------PKLKKSPVNGNVVNVSSLAAV-----R---  150 (253)
T ss_pred             EEEECCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHH------HHHCCCCCCCEEEEECCHHHH-----C---
T ss_conf             77735887543554137855579999998865345876689998------871078866707995044552-----6---


Q ss_pred             CCCCCCCCCCCCCCCCCCEEEECCCC-CCC-CCCCCCCCCCCC
Q ss_conf             22222222222333221000000123-332-222222222222
Q gi|254780920|r  147 EDMPYNPSSPYSATKASSDYLVLAWG-HTY-GIPVLLSNCSNN  187 (358)
Q Consensus       147 E~~~~~p~s~Yg~sK~~~E~~~~~~~-~~~-~l~~~ilR~~~v  187 (358)
                         |+.....|+.+|++-+++.+..+ +++ ++.+..++|+.|
T Consensus       151 ---p~~~wa~yc~~KaAr~m~f~~lA~EEp~~v~vl~~aPGvv  190 (253)
T KOG1204         151 ---PFSSWAAYCSSKAARNMYFMVLASEEPFDVRVLNYAPGVV  190 (253)
T ss_pred             ---CCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCC
T ss_conf             ---4408888632699999999998504756636997158750


No 278
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases. L-lactate dehydrogenases (LDH) are tetrameric enzymes catalyzing the last step of glycolysis in which pyruvate is converted to L-lactate. This subgroup is composed predominantly of bacterial LDHs and a few fungal LDHs. Bacterial LDHs may be non-allosteric or may be activated by an allosteric effector such as fructose-1,6-bisphosphate. LDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Probab=97.17  E-value=0.0011  Score=41.78  Aligned_cols=184  Identities=14%  Similarity=0.121  Sum_probs=91.3

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHC-CCEEEEEECCCC--CCCHHHHHHHHC-CCCEEEEECCCCCHHHHHHHHHHCCCCE
Q ss_conf             948997678827799999999868-987999947887--658567776203-7974999763889999999986227871
Q gi|254780920|r    1 MRLIVTGGAGFIGSALCRYLVNDL-KIQVLVIDKLTY--AGNLNSLKEISQ-SNLFSFLQVDICDRECIRSALKEFQPDA   76 (358)
Q Consensus         1 MkILItG~tGfIGs~l~~~Ll~~~-~~~V~~~d~~~~--~~~~~~~~~~~~-~~~v~~i~~Di~d~~~l~~~~~~~~~d~   76 (358)
                      |||-|.|+ |.||+.++..|+.+. ..++..+|....  .+.-..+.+... ........+|   ++.+    ++  .|+
T Consensus         1 mKI~IIGa-G~VG~~~A~~l~~~~l~~el~L~Di~~~~a~g~a~DL~~a~~~~~~~~i~~~~---~~~l----~d--aDv   70 (308)
T cd05292           1 MKVAIVGA-GFVGSTTAYALLLRGLASEIVLVDINKAKAEGEAMDLAHGTPFVKPVRIYAGD---YADC----KG--ADV   70 (308)
T ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEECC---HHHH----CC--CCE
T ss_conf             97999994-88899999999867998879999188984512568766241036881684099---9997----79--999


Q ss_pred             EEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEE-EEECCC-CCCCCCCCCCCCCCCCCCCCC
Q ss_conf             785123433222222222222222222202478886512322112478427-863055-431122222222222222222
Q gi|254780920|r   77 IVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFR-FLQIST-DEVYGSLDKGLFSEDMPYNPS  154 (358)
Q Consensus        77 ViHlAa~~~~~~~~~~p~~~~~~Nv~gt~nil~~~~~~~~~~~~~~~~~~~-~v~~SS-~~vYg~~~~~~~~E~~~~~p~  154 (358)
                      |+-.|+.+.-  .-++-.+.++.|..-...+....+.+         .... ++.+|- ..+-   ..... ...-+.|.
T Consensus        71 VVitaG~~rk--~g~tR~dll~~Na~I~~~i~~~i~~~---------~p~~ivivvsNPvDv~---t~~~~-k~sg~p~~  135 (308)
T cd05292          71 VVITAGANQK--PGETRLDLLKRNVAIFKEIIPQILKY---------APDAILLVVTNPVDVL---TYVAY-KLSGLPPN  135 (308)
T ss_pred             EEECCCCCCC--CCCCHHHHHHHHHHHHHHHHHHHHHH---------CCCCE