BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780920|ref|YP_003065333.1| dTDP-glucose 4,6-dehydratase
[Candidatus Liberibacter asiaticus str. psy62]
         (358 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780920|ref|YP_003065333.1| dTDP-glucose 4,6-dehydratase [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040597|gb|ACT57393.1| dTDP-glucose 4,6-dehydratase [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 358

 Score =  740 bits (1911), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/358 (100%), Positives = 358/358 (100%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC
Sbjct: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ
Sbjct: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           DKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL
Sbjct: 121 DKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG
Sbjct: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSSK 300
           RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSSK
Sbjct: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSSK 300

Query: 301 IKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKELKPDNDYSKWKNLNEMSCNRK 358
           IKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKELKPDNDYSKWKNLNEMSCNRK
Sbjct: 301 IKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKELKPDNDYSKWKNLNEMSCNRK 358


>gi|315122654|ref|YP_004063143.1| dTDP-glucose 4,6-dehydratase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313496056|gb|ADR52655.1| dTDP-glucose 4,6-dehydratase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 348

 Score =  590 bits (1520), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 283/342 (82%), Positives = 309/342 (90%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR+IVTGGAGFIGSALCRYL+NDLKIQVLVIDKLTYAGNL+SLK+ISQS+LFSFLQ DIC
Sbjct: 1   MRIIVTGGAGFIGSALCRYLINDLKIQVLVIDKLTYAGNLDSLKQISQSDLFSFLQADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DRE IR ALKEFQPDAI+N AAESHVDRSI+G+DEFI TNI+GTF+LLEETRLWWSCL  
Sbjct: 61  DRESIRLALKEFQPDAIMNLAAESHVDRSIMGSDEFIATNIMGTFVLLEETRLWWSCLPG 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
            KKD FRFLQ+STDEVYGSLD+GLFSED PY PSSPYSATKASSDYL LAW  TYGIP+L
Sbjct: 121 YKKDHFRFLQVSTDEVYGSLDEGLFSEDNPYCPSSPYSATKASSDYLALAWQCTYGIPIL 180

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           LSNCSNNYGPY FPEKLIPLAITRMI+GSHVFLYGDG+NVRDWLYVEDHVRALYLVL KG
Sbjct: 181 LSNCSNNYGPYQFPEKLIPLAITRMIKGSHVFLYGDGKNVRDWLYVEDHVRALYLVLTKG 240

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSSK 300
           RIGERYNIGGNNER+NIDIVF+I  LLD L PK Y H++L+ F +DR GHDRRYAID SK
Sbjct: 241 RIGERYNIGGNNERENIDIVFQICHLLDVLHPKPYPHSDLVLFTKDRLGHDRRYAIDFSK 300

Query: 301 IKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKELKPDN 342
           IK E+GW+PQEN +SGL+KTV WYLDN+WWW PLYKEL   N
Sbjct: 301 IKKELGWYPQENKDSGLDKTVHWYLDNSWWWHPLYKELNLSN 342


>gi|315499262|ref|YP_004088066.1| dtdp-glucose 4,6-dehydratase [Asticcacaulis excentricus CB 48]
 gi|315417274|gb|ADU13915.1| dTDP-glucose 4,6-dehydratase [Asticcacaulis excentricus CB 48]
          Length = 352

 Score =  453 bits (1165), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 207/335 (61%), Positives = 263/335 (78%), Gaps = 1/335 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSAL RYLV+++  +VL +DKLTYAGNL SL+ I+ +N +SF+Q DIC
Sbjct: 1   MRILVTGGAGFIGSALVRYLVSEVGAEVLNLDKLTYAGNLASLEPIAGANNYSFVQADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
            RE + +A+  F+PD I++ AAESHVDRSI GA EF+ TN+IGTF +LE  R +W+ LS 
Sbjct: 61  AREAVVAAINGFKPDHIMHLAAESHVDRSITGAGEFVQTNVIGTFTMLEAARHYWNGLSG 120

Query: 121 DKKDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           D K  FRFL +STDEVYGSL + GLF E  PY+PSSPYSA+KA+SD+L  AW  TYG+PV
Sbjct: 121 DDKANFRFLHVSTDEVYGSLGETGLFEEVTPYDPSSPYSASKAASDHLAKAWHRTYGLPV 180

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           ++SNCSNNYGP+HFPEKLIPL I   +EG  + +YGDG N+RDWLYVEDH RAL+L+  K
Sbjct: 181 IVSNCSNNYGPFHFPEKLIPLNILNALEGKALTVYGDGSNIRDWLYVEDHARALHLIASK 240

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSS 299
           GR+GE YN+GG NERKNID+V  I  L+D + P+   H  LI F+ DRPGHD RYAID++
Sbjct: 241 GRLGETYNVGGRNERKNIDVVHRICALMDEMHPQGAPHDRLITFVTDRPGHDHRYAIDAT 300

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           K+++E+GW  +EN ++G+ KTV WYLDN  WWRPL
Sbjct: 301 KLETELGWKARENFDTGIEKTVRWYLDNEQWWRPL 335


>gi|154247481|ref|YP_001418439.1| dTDP-glucose 4,6-dehydratase [Xanthobacter autotrophicus Py2]
 gi|154161566|gb|ABS68782.1| dTDP-glucose 4,6-dehydratase [Xanthobacter autotrophicus Py2]
          Length = 355

 Score =  447 bits (1151), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 205/339 (60%), Positives = 265/339 (78%), Gaps = 1/339 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSAL RYLV+++  +VL +DKLTYAGNL SLK I  +  + FLQ DI 
Sbjct: 1   MRILVTGGAGFIGSALVRYLVSEVGAEVLNVDKLTYAGNLASLKVIENAPNYRFLQADIT 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +  AL  F+PD I++ AAESHVDRSI GA EF+ TN++GTF LLE  R +WS L  
Sbjct: 61  DRAAMSEALASFKPDRIMHLAAESHVDRSITGAGEFVHTNVVGTFTLLEAARHYWSELPA 120

Query: 121 DKKDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            +K+ FRFL +STDEVYGSL + GLF E  PY+PSSPYSA+KA+SD+LV+AW  TYG+PV
Sbjct: 121 AEKEAFRFLHVSTDEVYGSLGEDGLFEEVTPYDPSSPYSASKAASDHLVVAWHRTYGLPV 180

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           ++SNCSNNYGPYHFPEKLIPL I   +EG  + +YG+G N+RDWLYVEDH RAL+L+   
Sbjct: 181 VVSNCSNNYGPYHFPEKLIPLTILNALEGRTLPVYGNGANIRDWLYVEDHARALHLIASN 240

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSS 299
           GR+GE+YN+GG NER+NI++V  I  L+D L PK+ SH +LI F+ DRPGHD RYAID++
Sbjct: 241 GRLGEKYNVGGRNERRNIEVVRRICDLMDELAPKATSHHDLITFVTDRPGHDARYAIDAT 300

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKEL 338
           K+++E+GW  +E  ++G+  TV WYLDN WWW+PL +++
Sbjct: 301 KLETELGWKARETFDTGIANTVKWYLDNAWWWQPLREKV 339


>gi|159186243|ref|NP_356045.2| dTDP-D-glucose-4,6-dehydratase [Agrobacterium tumefaciens str. C58]
 gi|159141377|gb|AAK88830.2| dTDP-D-glucose-4,6-dehydratase [Agrobacterium tumefaciens str. C58]
          Length = 351

 Score =  442 bits (1136), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 205/335 (61%), Positives = 257/335 (76%), Gaps = 1/335 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSAL RYLV+++   VL +DKLTYAGNL SLK I  +    FLQ DIC
Sbjct: 1   MRVLVTGGAGFIGSALVRYLVSEVGADVLTVDKLTYAGNLASLKPIENAPNHRFLQADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +  A   FQPD +++ AAESHVDRSI GA +FI TNI GTF +LE  R +WS L+ 
Sbjct: 61  DRAAMNDAFATFQPDYVMHLAAESHVDRSITGAADFIQTNINGTFTMLEAARQYWSSLAD 120

Query: 121 DKKDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           D K  FR L +STDEVYGSL D GLF E  PY+PSSPYSA+KA+SD+L  AW  TYG+PV
Sbjct: 121 DAKANFRMLHVSTDEVYGSLGDDGLFEETTPYDPSSPYSASKAASDHLATAWQRTYGLPV 180

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           ++SNCSNNYGP+HFPEKLIPL I   +EG  + +YG+G N+RDWLYVEDH RAL+L+++K
Sbjct: 181 VISNCSNNYGPFHFPEKLIPLIILNALEGKPLPVYGNGANIRDWLYVEDHARALWLIVQK 240

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSS 299
           G  GE+YN+GG NE+KNID+V  I  +LD L P+S  +  LI+++ DRPGHD RYAID++
Sbjct: 241 GLAGEKYNVGGRNEQKNIDVVNCICSILDELRPQSKPYANLIQYVTDRPGHDARYAIDAT 300

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           K+++E+GW  QEN  +G+ KTV WYLDN WWW+PL
Sbjct: 301 KLETELGWKAQENFATGIRKTVEWYLDNAWWWQPL 335


>gi|332715609|ref|YP_004443075.1| dTDP-D-glucose-4,6-dehydratase [Agrobacterium sp. H13-3]
 gi|325062294|gb|ADY65984.1| dTDP-D-glucose-4,6-dehydratase [Agrobacterium sp. H13-3]
          Length = 352

 Score =  440 bits (1132), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 203/335 (60%), Positives = 257/335 (76%), Gaps = 1/335 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSAL RYLV+++   VL +DKLTYAGNL SLK I  +    FLQ DIC
Sbjct: 2   MRVLVTGGAGFIGSALVRYLVSEVGADVLTVDKLTYAGNLASLKPIENAPNHRFLQADIC 61

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +  A   FQPD +++ AAESHVDRSI GA +FI TNI GTF +LE  R +W+ L++
Sbjct: 62  DRAAMNDAFATFQPDYVMHLAAESHVDRSITGAADFIQTNINGTFTMLEAARQYWNGLAE 121

Query: 121 DKKDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           D K  FR L +STDEVYGSL + GLF E  PY+PSSPYSA+KA+SD+L  AW  TYG+PV
Sbjct: 122 DAKSAFRMLHVSTDEVYGSLGEHGLFEETTPYDPSSPYSASKAASDHLATAWQRTYGLPV 181

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           ++SNCSNNYGP+HFPEKLIPL I   +EG  + +YG+G N+RDWLYVEDH RAL+L+++ 
Sbjct: 182 VISNCSNNYGPFHFPEKLIPLIILNALEGKPLPVYGNGANIRDWLYVEDHARALWLIVQT 241

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSS 299
           G  GE+YN+GG NE+KNID+V  I  +LD L P+S  + ELI+++ DRPGHD RYAID++
Sbjct: 242 GLAGEKYNVGGRNEQKNIDVVNCICSILDELRPQSKPYAELIKYVTDRPGHDARYAIDAT 301

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           K+++E+GW  QEN  +G+ KTV WYLDN WWW PL
Sbjct: 302 KLETELGWKAQENFATGIRKTVEWYLDNEWWWEPL 336


>gi|11385992|gb|AAG35060.1|AF314183_2 dTDP-glucose-4,6-dehydratase [Agrobacterium tumefaciens]
          Length = 351

 Score =  440 bits (1131), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 204/335 (60%), Positives = 256/335 (76%), Gaps = 1/335 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSAL RYLV+++   VL +DKLTYAGNL SLK I  +    FLQ DIC
Sbjct: 1   MRVLVTGGAGFIGSALVRYLVSEVGADVLTVDKLTYAGNLASLKPIENAPNHRFLQADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +  A   FQPD +++ AAESHVDRSI GA +FI TNI GTF +LE  R +WS L+ 
Sbjct: 61  DRAAMNDAFATFQPDYVMHLAAESHVDRSITGAADFIQTNINGTFTMLEAARQYWSSLAD 120

Query: 121 DKKDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           D K  FR L +STDEVYGSL D GLF E  PY+PSSPYSA+KA+SD+L  AW  TYG+P 
Sbjct: 121 DAKANFRMLHVSTDEVYGSLGDDGLFEETTPYDPSSPYSASKAASDHLATAWQRTYGLPF 180

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           ++SNCSNNYGP+HFPEKLIPL I   +EG  + +YG+G N+RDWLYVEDH RAL+L+++K
Sbjct: 181 VISNCSNNYGPFHFPEKLIPLIILNALEGKPLPVYGNGANIRDWLYVEDHARALWLIVQK 240

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSS 299
           G  GE+YN+GG NE+KNID+V  I  +LD L P+S  +  LI+++ DRPGHD RYAID++
Sbjct: 241 GLAGEKYNVGGRNEQKNIDVVNCICSILDELRPQSKPYANLIQYVTDRPGHDARYAIDAT 300

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           K+++E+GW  QEN  +G+ KTV WYLDN WWW+PL
Sbjct: 301 KLETELGWKAQENFATGIRKTVEWYLDNAWWWQPL 335


>gi|254500114|ref|ZP_05112266.1| dTDP-glucose 4,6-dehydratase [Labrenzia alexandrii DFL-11]
 gi|222441412|gb|EEE48090.1| dTDP-glucose 4,6-dehydratase [Labrenzia alexandrii DFL-11]
          Length = 350

 Score =  439 bits (1128), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 198/334 (59%), Positives = 260/334 (77%), Gaps = 1/334 (0%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R+IVTGGAGFIGSA+ R+LV ++  +VL IDKLTYAGNL+SL+E+  +    FL+ DIC 
Sbjct: 3   RVIVTGGAGFIGSAVVRHLVRNVGAEVLTIDKLTYAGNLDSLREVDNAPNHKFLKEDICA 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
              +  A+ EFQPD I++ AAESHVDRSI GA EF+ TN++GT  +LE  R +W+ L  +
Sbjct: 63  GPEMIQAVAEFQPDYIMHLAAESHVDRSITGAAEFVQTNVVGTMAMLEAARAYWNSLEGE 122

Query: 122 KKDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           KKD FRFL +STDEVYGSL D+GLF E  PY+PSSPYSA+KA+SD+L +AW  TYG+PV+
Sbjct: 123 KKDSFRFLHVSTDEVYGSLGDEGLFKETTPYDPSSPYSASKAASDHLAIAWHRTYGLPVV 182

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           LSNCSNNYGPYHFPEKLIPL I   ++G  + +YG G NVRDWLYV+DH +ALY ++ KG
Sbjct: 183 LSNCSNNYGPYHFPEKLIPLMILNALDGQPLPIYGTGMNVRDWLYVDDHAKALYTIVSKG 242

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSSK 300
           R+GE+YN+GG NER N+++V  I  +LD   PK+  H  LI ++EDRPGHD RYAID++K
Sbjct: 243 RLGEKYNVGGRNERTNLEVVKTICAILDKHSPKTAPHDRLITYVEDRPGHDARYAIDATK 302

Query: 301 IKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           +++E+GW  +EN ++G+ KT+ WYL+N+WWW PL
Sbjct: 303 LETELGWRAEENFDTGIEKTIKWYLENDWWWGPL 336


>gi|222148115|ref|YP_002549072.1| dTDP-D-glucose-46-dehydratase [Agrobacterium vitis S4]
 gi|221735103|gb|ACM36066.1| dTDP-D-glucose-46-dehydratase [Agrobacterium vitis S4]
          Length = 352

 Score =  437 bits (1125), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 197/335 (58%), Positives = 257/335 (76%), Gaps = 1/335 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSA+ R+LV +    VL +DKLTYAG L SLK +  + L+ FLQ DIC
Sbjct: 1   MRVLVTGGAGFIGSAVVRHLVLEKGYDVLNVDKLTYAGTLTSLKSVEANPLYRFLQADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D + I SA   F+PD +++ AAESHVDRSI GA +F+ TN++GTF +LE  R +W  L  
Sbjct: 61  DGQAIASAFASFKPDRVMHLAAESHVDRSITGAKDFVETNVLGTFTMLECARAYWQGLEG 120

Query: 121 DKKDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
             KD FRFL +STDEVYGSL D+GLF+E  PY+PSSPYSA+KA+SD+L  AW  TYG+PV
Sbjct: 121 ASKDGFRFLHVSTDEVYGSLGDEGLFTETTPYDPSSPYSASKAASDHLAKAWARTYGLPV 180

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           ++SNCSNNYGP+HFPEKLIPL I   +EG  + +YG+G N+RDWLYVEDH RAL ++ ++
Sbjct: 181 VVSNCSNNYGPFHFPEKLIPLMIINAMEGKPLPVYGNGANIRDWLYVEDHARALDIIAER 240

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSS 299
           G+IGE YN+GG NER+NID+V  +  L+D L P    H +LI+++ DRPGHD RYAID++
Sbjct: 241 GQIGETYNVGGRNERRNIDVVTRVCALMDELHPSGTPHEKLIQYVTDRPGHDARYAIDAT 300

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           ++++E+GW  QEN E+G+ KTV WYL+N WWW PL
Sbjct: 301 RLETELGWKAQENFETGIEKTVKWYLENRWWWEPL 335


>gi|116251391|ref|YP_767229.1| dTDP-glucose 4,6-dehydratase [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115256039|emb|CAK07120.1| putative dTDP-glucose 4,6-dehydratase [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 351

 Score =  437 bits (1125), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 201/339 (59%), Positives = 257/339 (75%), Gaps = 1/339 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSAL R+LV+++  +VL +D LTYAGNL SLK +  +  + FL+ DIC
Sbjct: 1   MRILVTGGAGFIGSALVRHLVSEIGAEVLNVDTLTYAGNLASLKSVESAPNYQFLRADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +R A   F+PD +++ AAESHVDRSI GAD+FI TNI+GTF LL+  R +W  L  
Sbjct: 61  DRARMREAFASFRPDIVMHLAAESHVDRSISGADDFIQTNIVGTFSLLDAARHYWDGLDA 120

Query: 121 DKKDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
             K  FRFL +STDEVYGSL D+GLF E  PY+PSSPYSA+KA+SD+L +AW  TYG+PV
Sbjct: 121 RYKSDFRFLHVSTDEVYGSLGDEGLFEETTPYDPSSPYSASKAASDHLAIAWHRTYGLPV 180

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           ++SNCSNNYGP+HFPEKLIPL I   +EG  + +YG+G NVRDWLYVEDH RAL+ +  +
Sbjct: 181 VVSNCSNNYGPFHFPEKLIPLMILNALEGKPLPVYGNGANVRDWLYVEDHARALFTIASR 240

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSS 299
           GR GE+YN+GG NER+NID+V  I  +LD +      H  LI  + DRPGHD RYAID+S
Sbjct: 241 GRPGEKYNVGGRNERRNIDVVHRICAILDGVYDNKEPHARLITNVTDRPGHDARYAIDAS 300

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKEL 338
           K++SE+GW  QE  E+G+ KTV WYL+N WWWRPL +++
Sbjct: 301 KLESELGWKAQETFETGIEKTVHWYLENEWWWRPLREKV 339


>gi|222148465|ref|YP_002549422.1| dTDP-glucose 4,6-dehydratase [Agrobacterium vitis S4]
 gi|221735453|gb|ACM36416.1| dTDP-glucose 4,6-dehydratase [Agrobacterium vitis S4]
          Length = 352

 Score =  436 bits (1122), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 196/335 (58%), Positives = 257/335 (76%), Gaps = 1/335 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSA+ R+LV +    VL +DKLTYAG L SLK +  + L+ FLQ DIC
Sbjct: 1   MRVLVTGGAGFIGSAVVRHLVLEKGYDVLNVDKLTYAGTLTSLKSVEANPLYRFLQADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D + I SA   F+PD +++ AAESHVDRSI GA +F+ TN++GTF +LE  R +W  L  
Sbjct: 61  DGQAIASAFASFKPDRVMHLAAESHVDRSITGAKDFVETNVLGTFTMLECARAYWQGLEG 120

Query: 121 DKKDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
             KD FRFL +STDEVYGSL D+GLF+E  PY+PSSPYSA+KA+SD+L  AW  TYG+PV
Sbjct: 121 ASKDGFRFLHVSTDEVYGSLGDEGLFTETTPYDPSSPYSASKAASDHLAKAWARTYGLPV 180

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           ++SNCSNNYGP+HFPEKLIPL I   +EG  + +YG+G N+RDWLYVEDH RAL ++ ++
Sbjct: 181 VVSNCSNNYGPFHFPEKLIPLMIINAMEGKPLPVYGNGANIRDWLYVEDHARALDIIAER 240

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSS 299
           G+IGE YN+GG NER+NI++V  +  L+D L P    H +LI+++ DRPGHD RYAID++
Sbjct: 241 GQIGETYNVGGRNERRNIEVVTRVCALMDGLHPSDTPHEKLIQYVTDRPGHDARYAIDAT 300

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           ++++E+GW  QEN E+G+ KTV WYL+N WWW PL
Sbjct: 301 RLETELGWKAQENFETGIEKTVKWYLENRWWWEPL 335


>gi|209548786|ref|YP_002280703.1| dTDP-glucose 4,6-dehydratase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209534542|gb|ACI54477.1| dTDP-glucose 4,6-dehydratase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 351

 Score =  436 bits (1122), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 200/339 (58%), Positives = 257/339 (75%), Gaps = 1/339 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSAL R+LV+++  +VL +D LTYAGNL SLK +  +  + FL+ DIC
Sbjct: 1   MRILVTGGAGFIGSALVRHLVSEIGAEVLNVDTLTYAGNLASLKSVESAPNYQFLRADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  ++ A   F+PD +++ AAESHVDRSI GA +FI TNI+GTF LL+  RL+W  L  
Sbjct: 61  DRTGMQEAFASFRPDIVMHLAAESHVDRSISGAADFIQTNIVGTFSLLDAARLYWDGLDA 120

Query: 121 DKKDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            +K  FRFL +STDEVYGSL D+GLF E  PY+PSSPYSA+KA+SD+L +AW  TYG+PV
Sbjct: 121 PRKSAFRFLHVSTDEVYGSLGDEGLFEETTPYDPSSPYSASKAASDHLAIAWHRTYGLPV 180

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           ++SNCSNNYGP+HFPEKLIPL I   +EG  + +YG+G NVRDWLYVEDH RAL+ +  +
Sbjct: 181 VVSNCSNNYGPFHFPEKLIPLMILNALEGKPLPVYGNGVNVRDWLYVEDHARALFTIASR 240

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSS 299
           GR GE+YN+GG NER+NID+V  I  +LD +      H  LI  + DRPGHD RYAID+S
Sbjct: 241 GRPGEKYNVGGCNERRNIDVVHRICAILDGVFSDKAPHARLITNVTDRPGHDARYAIDAS 300

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKEL 338
           K++SE+GW  QE  E+G+ KTV WYL+N WWWRPL + +
Sbjct: 301 KLESELGWKAQETFETGIEKTVHWYLENEWWWRPLRENI 339


>gi|110349045|gb|ABG73089.1| RfbB [Rhizobium leguminosarum bv. trifolii TA1]
          Length = 351

 Score =  436 bits (1120), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 200/335 (59%), Positives = 255/335 (76%), Gaps = 1/335 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSAL R+LV+++  +VL +D LTYAGNL SLK +  +  + FL+ DIC
Sbjct: 1   MRILVTGGAGFIGSALVRHLVSEIGAEVLNVDTLTYAGNLASLKSVESAPNYQFLRADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  ++ A   F+PD +++ AAESHVDRSILGA +FI TNI+GTF LL+  R +W  L  
Sbjct: 61  DRARMQEAFASFRPDIVMHLAAESHVDRSILGAADFIQTNIVGTFSLLDTARHYWDELDA 120

Query: 121 DKKDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            +K  FRFL +STDEVYGSL D+GLF E  PY+PSSPYSA+KA+SD+L +AW  TYG+PV
Sbjct: 121 RRKSAFRFLHVSTDEVYGSLGDEGLFEETTPYDPSSPYSASKAASDHLAIAWHRTYGLPV 180

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           ++SNCSNNYGP+HFPEKLIPL I   +EG  + +YG+G NVRDWLYVEDH RAL+ +  +
Sbjct: 181 VVSNCSNNYGPFHFPEKLIPLMILNALEGKPLPIYGNGANVRDWLYVEDHARALFTIASR 240

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSS 299
           GR GE+YN+GG NER+NID+V  I  +LD +      H  LI  + DRPGHD RYAID+S
Sbjct: 241 GRPGEKYNVGGRNERRNIDVVHRICAILDGVYSDRGPHARLITNVTDRPGHDARYAIDAS 300

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           K++SE+GW  QE  E+G+ KTV WYL+N WWWRPL
Sbjct: 301 KLESELGWKAQETFETGIEKTVHWYLENEWWWRPL 335


>gi|327188680|gb|EGE55883.1| dTDP-glucose-4,6-dehydratase protein [Rhizobium etli CNPAF512]
          Length = 351

 Score =  434 bits (1116), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 199/335 (59%), Positives = 252/335 (75%), Gaps = 1/335 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSAL R+LV+++  +VL +D LTYAGN  SLK +  ++ + FL  DIC
Sbjct: 1   MRILVTGGAGFIGSALVRHLVSEIGAEVLNVDALTYAGNRASLKSVESASNYQFLHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  ++ A   F PD +++ AAESHVDRSI GA +FI TNI+GTF LL+  R +W  L  
Sbjct: 61  DRARMQEAFASFGPDIVMHLAAESHVDRSISGAADFIQTNIVGTFSLLDAARHYWDGLDA 120

Query: 121 DKKDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            +K  FRFL +STDEVYGSL D+GLF E  PY+PSSPYSA+KA+SD+L +AW  TYG+PV
Sbjct: 121 RRKSAFRFLHVSTDEVYGSLGDQGLFEETTPYDPSSPYSASKAASDHLAIAWHRTYGLPV 180

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           ++SNCSNNYGP+HFPEKLIPL I   +EG  + +YG+G NVRDWLYVEDH RALY +  +
Sbjct: 181 VVSNCSNNYGPFHFPEKLIPLMILNALEGKPLPVYGNGANVRDWLYVEDHARALYSIASR 240

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSS 299
           GR G++YN+GG NER+NID+V  I  +LD +      H  LI  + DRPGHD RYAID+S
Sbjct: 241 GRPGDKYNVGGRNERRNIDVVHRICAILDGVYSDKAPHARLITNVTDRPGHDARYAIDAS 300

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           K++SE+GW  QE  E+G+ KTV WYLDN WWWRPL
Sbjct: 301 KLESELGWEAQETFETGIEKTVHWYLDNEWWWRPL 335


>gi|218674077|ref|ZP_03523746.1| putative dTDP-glucose 4,6-dehydratase [Rhizobium etli GR56]
          Length = 350

 Score =  434 bits (1116), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 198/335 (59%), Positives = 254/335 (75%), Gaps = 1/335 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSAL R+LV+++  +VL +D LTYAGNL SLK +  +  + FL+ DIC
Sbjct: 1   MRILVTGGAGFIGSALVRHLVSEIGAEVLNVDTLTYAGNLASLKSVESAPNYQFLRADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +R  ++ A   F+PD +++ AAESHVDRSI GA +FI TNI+GTF LL+  R +W  L  
Sbjct: 61  ERARMQEAFASFRPDIVMHLAAESHVDRSISGAADFIQTNIVGTFSLLDAARHYWDGLDA 120

Query: 121 DKKDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           D K  FRFL +STDEVYGSL D+GLF E  PY+PSSPYSA+KA+SD+L +AW  TYG+PV
Sbjct: 121 DGKSAFRFLHVSTDEVYGSLGDEGLFEETTPYDPSSPYSASKAASDHLAIAWHRTYGLPV 180

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           ++SNCSNNYGP+HFPEKLIPL I   +EG  + +YG+G NVRDWLYVEDH RAL+ +  +
Sbjct: 181 VVSNCSNNYGPFHFPEKLIPLMILNALEGKPLPVYGNGANVRDWLYVEDHARALFTIASR 240

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSS 299
           GR GE+YN+GG NER+NID+V  I  +LD +      H  LI  + DRPGHD RYAID++
Sbjct: 241 GRPGEKYNVGGRNERRNIDVVHRICAILDGVYSDKAPHARLITNVTDRPGHDARYAIDAT 300

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           K++SE+GW  QE  E+G+ KTV WYL+N WWWRPL
Sbjct: 301 KLESELGWKAQETFETGIEKTVHWYLENEWWWRPL 335


>gi|329848963|ref|ZP_08263991.1| dTDP-glucose 4,6-dehydratase [Asticcacaulis biprosthecum C19]
 gi|328844026|gb|EGF93595.1| dTDP-glucose 4,6-dehydratase [Asticcacaulis biprosthecum C19]
          Length = 350

 Score =  434 bits (1115), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 198/335 (59%), Positives = 258/335 (77%), Gaps = 1/335 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSA+ RYLV+++  +VL +DKLTYAGNL SL  +  +  + F++ DIC
Sbjct: 1   MRILVTGGAGFIGSAVVRYLVSEVGAEVLNLDKLTYAGNLESLAPVEAAANYRFVKADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR+ + SA+  F+PD I++ AAESHVDRSI GA +F+ TN++GTF LLE  R +W+ L  
Sbjct: 61  DRDAVTSAINGFKPDHIMHLAAESHVDRSITGARDFVETNVMGTFTLLEGARHYWNGLEG 120

Query: 121 DKKDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           D K +FRFL +STDEVYGSL + GLF E  PY+PSSPYSA+KA+SD+L  AW  TYG+PV
Sbjct: 121 DAKGRFRFLHVSTDEVYGSLGETGLFEETTPYDPSSPYSASKAASDHLAKAWHRTYGLPV 180

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           ++SNCSNNYGP HFPEKLIPL I   ++G  + +YGDG N+RDWLYV+DH RAL+L+  K
Sbjct: 181 VVSNCSNNYGPCHFPEKLIPLNILNALDGKPLPVYGDGSNIRDWLYVDDHARALHLICSK 240

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSS 299
           GR+GE YN+GG NER NID+V  I  L+D L PK+  H +LI ++ DRPGHD RYAID++
Sbjct: 241 GRLGETYNVGGRNERTNIDVVRRICALMDQLRPKNTPHEQLITYVTDRPGHDHRYAIDAT 300

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           K+++E+GW  QE  ++G+ KTV WYLDN  WW PL
Sbjct: 301 KLETELGWKAQETFDTGIEKTVKWYLDNEAWWGPL 335


>gi|241204007|ref|YP_002975103.1| dTDP-glucose 4,6-dehydratase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240857897|gb|ACS55564.1| dTDP-glucose 4,6-dehydratase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 351

 Score =  433 bits (1114), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 199/335 (59%), Positives = 253/335 (75%), Gaps = 1/335 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSAL R+LV+++  +VL +D LTYAGNL SLK +  +  + FL+ DIC
Sbjct: 1   MRILVTGGAGFIGSALVRHLVSEIGAEVLNVDTLTYAGNLASLKSVESAPNYQFLRADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  ++ A   F+PD +++ AAESHVDRSI GA +FI TNI+GTF LL+  R +W  L  
Sbjct: 61  DRVGMQEAFASFRPDIVMHLAAESHVDRSISGAADFIQTNIVGTFSLLDAARHYWDGLDA 120

Query: 121 DKKDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            +K  FRFL +STDEVYGSL D+GLF E  PY+PSSPYSA+KA+SD+L +AW  TYG+PV
Sbjct: 121 RRKSAFRFLHVSTDEVYGSLGDEGLFEETTPYDPSSPYSASKAASDHLAIAWHRTYGLPV 180

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           ++SNCSNNYGP+HFPEKLIPL I   +EG  + +YG+G NVRDWLYVEDH RAL+ +   
Sbjct: 181 VVSNCSNNYGPFHFPEKLIPLMILNALEGKPLPVYGNGANVRDWLYVEDHARALFTIASS 240

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSS 299
           GR GE+YN+GG NER+NID+V  I  +LD +      H  LI  + DRPGHD RYAID+S
Sbjct: 241 GRPGEKYNVGGRNERRNIDVVHRICVILDGVCSDKGPHARLITNVTDRPGHDARYAIDAS 300

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           K++SE+GW  QE  E+G+ KTV WYL+N WWWRPL
Sbjct: 301 KLESELGWKAQETFETGIEKTVHWYLENEWWWRPL 335


>gi|190891198|ref|YP_001977740.1| dTDP-glucose-4,6-dehydratase [Rhizobium etli CIAT 652]
 gi|190696477|gb|ACE90562.1| dTDP-glucose-4,6-dehydratase protein [Rhizobium etli CIAT 652]
          Length = 351

 Score =  431 bits (1108), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 199/335 (59%), Positives = 249/335 (74%), Gaps = 1/335 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSAL R+LV+++  +VL +D LTYAGN  SLK +  +  + FL  DIC
Sbjct: 1   MRILVTGGAGFIGSALVRHLVSEIGAEVLNVDALTYAGNRASLKSVESAPNYQFLHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  ++ A   F+PD +++ AAESHVDRSI GA +FI TNI+GTF LL+  R +W  L  
Sbjct: 61  DRARMQEAFASFRPDIVMHLAAESHVDRSISGAADFIQTNIVGTFSLLDAARHYWDGLDA 120

Query: 121 DKKDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
             K  FRFL +STDEVYGSL D+GLF E  PY+PSSPYSA+KA+SD+L +AW  TYG+PV
Sbjct: 121 RGKSAFRFLHVSTDEVYGSLGDQGLFEETTPYDPSSPYSASKAASDHLAIAWHRTYGLPV 180

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           ++SNCSNNYGP+HFPEKLIPL I   +EG  + +YG+G NVRDWLYVEDH RALY +   
Sbjct: 181 VVSNCSNNYGPFHFPEKLIPLMILNALEGKPLPVYGNGANVRDWLYVEDHARALYSIAST 240

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSS 299
           GR GE+YN+GG NER+ ID+V  I  +LD +      H  LI  + DRPGHD RYAID+S
Sbjct: 241 GRPGEKYNVGGRNERRTIDVVHRICAILDGVHSDKAPHARLITNVTDRPGHDARYAIDAS 300

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           K++SE+GW  QE  E+G+ KTV WYLDN WWWRPL
Sbjct: 301 KLESELGWKAQETFETGIEKTVHWYLDNEWWWRPL 335


>gi|317048791|ref|YP_004116439.1| dTDP-glucose 4,6-dehydratase [Pantoea sp. At-9b]
 gi|316950408|gb|ADU69883.1| dTDP-glucose 4,6-dehydratase [Pantoea sp. At-9b]
          Length = 359

 Score =  429 bits (1103), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 197/338 (58%), Positives = 252/338 (74%), Gaps = 8/338 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++++TGGAGFIGSA+ R+++N+   +V+ +DKLTYAGNL SL  +SQS  +SF +VDIC
Sbjct: 1   MKILITGGAGFIGSAVVRHIINNTNDEVINVDKLTYAGNLESLDAVSQSERYSFKKVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +++   EF PDA+++ AAESHVDRSI G  EF+ TN++GT+ LLE +R +WS L  
Sbjct: 61  DGAALQAVFNEFAPDAVMHLAAESHVDRSITGPAEFVQTNVVGTYALLEASRQYWSALPA 120

Query: 121 DKKDQFRFLQISTDEVYGSL--------DKGLFSEDMPYNPSSPYSATKASSDYLVLAWG 172
           DKK  FRF  ISTDEVYG L        +  LF+E  PY PSSPYS+TKA+SD+LV AWG
Sbjct: 121 DKKAAFRFHHISTDEVYGDLPHPDEMAGELPLFTETTPYAPSSPYSSTKAASDHLVRAWG 180

Query: 173 HTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRA 232
            TYG+PV+++NCSNNYGPYHFPEKLIPL I+  +EG  + +YG G  +RDWLYVEDH RA
Sbjct: 181 RTYGLPVIVTNCSNNYGPYHFPEKLIPLIISNALEGKPLPIYGKGDQIRDWLYVEDHARA 240

Query: 233 LYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDR 292
           LY V+ K   G  YNIGG+NE+KN+D+V ++  LLD L PK  ++ E I +++DRPGHDR
Sbjct: 241 LYTVVTKAATGTTYNIGGHNEKKNLDVVLKVCELLDELRPKETAYAEQIVYVQDRPGHDR 300

Query: 293 RYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           RYAID+ KIK E+GW PQE  ESGL KTV WYL N  W
Sbjct: 301 RYAIDADKIKKELGWSPQETFESGLRKTVEWYLHNQTW 338


>gi|326385994|ref|ZP_08207618.1| dTDP-D-glucose-46-dehydratase [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326209219|gb|EGD60012.1| dTDP-D-glucose-46-dehydratase [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 359

 Score =  428 bits (1101), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 197/335 (58%), Positives = 253/335 (75%), Gaps = 2/335 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           +R++VTGGAGFIGSAL RYLV +   +VL +DKLTYAGNL+SL  ++    + FL+ DIC
Sbjct: 3   LRVLVTGGAGFIGSALVRYLVLERGAEVLNVDKLTYAGNLSSLTAVADDPRYRFLRADIC 62

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +R A + F+PD +++ AAESHVDRSI GA +FI TN++GTF LLE  R +WS L  
Sbjct: 63  DASAMREAFETFRPDRVMHLAAESHVDRSITGAADFINTNVVGTFQLLEAARDYWSKLDG 122

Query: 121 DKKDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
             ++ FRFL +STDEVYGSL D GLF E  PY+PSSPYSA+KA+SD+L  AW  TYG+PV
Sbjct: 123 GAREAFRFLHVSTDEVYGSLGDTGLFHETTPYDPSSPYSASKAASDHLAKAWQRTYGLPV 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           ++SNCSNNYGPYHFPEKLIPL I   + G  + +YG G+N+RDWLYVEDH RAL L+   
Sbjct: 183 VVSNCSNNYGPYHFPEKLIPLTILNALHGRPLPVYGKGENIRDWLYVEDHARALDLIAAS 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSS 299
           G++GE YN+GG NER+NID+V  I  +LD L+     H +LI F+ DRPGHD RYAID++
Sbjct: 243 GQVGETYNVGGRNERRNIDVVTRICEILDRLV-GGRRHADLIEFVTDRPGHDARYAIDAT 301

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           ++++E+GW  QE  E+G+ KTV WY+DN WWWRPL
Sbjct: 302 RLETELGWKAQETFETGIEKTVRWYIDNAWWWRPL 336


>gi|308187471|ref|YP_003931602.1| dTDP-glucose 4,6 dehydratase [Pantoea vagans C9-1]
 gi|308057981|gb|ADO10153.1| dTDP-glucose 4,6 dehydratase [Pantoea vagans C9-1]
          Length = 359

 Score =  427 bits (1099), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 194/338 (57%), Positives = 257/338 (76%), Gaps = 8/338 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++++TGGAGFIGSA+ R+++N+   +V+ +DKLTYAGNL SLKE+S +  ++F Q+DIC
Sbjct: 1   MKILITGGAGFIGSAVVRHVINNTNDEVINVDKLTYAGNLESLKEVSSNPRYTFRQIDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D + I  AL EFQPDAI++ AAESHVDRSI G  EF+ TN++GT+ +LE  R +WS L +
Sbjct: 61  DGQAIAEALSEFQPDAIMHLAAESHVDRSITGPAEFVQTNVVGTYAMLEAARQYWSALPE 120

Query: 121 DKKDQFRFLQISTDEVYGSL--------DKGLFSEDMPYNPSSPYSATKASSDYLVLAWG 172
           ++K  FRF  ISTDEVYG L        D  LF+E+ PY PSSPYS+TKA+SD+LV AWG
Sbjct: 121 ERKAAFRFHHISTDEVYGDLPHPDEMDGDLPLFTEETPYAPSSPYSSTKAASDHLVRAWG 180

Query: 173 HTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRA 232
            TY +PV+++NCSNNYGPYHFPEKLIPL I+  +EG  + +YG G  +RDWLYVEDH RA
Sbjct: 181 RTYKLPVIVTNCSNNYGPYHFPEKLIPLIISNALEGKPLPIYGKGDQIRDWLYVEDHARA 240

Query: 233 LYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDR 292
           LY V+K    G  YNIGG+NE KNID+V ++  LLD L PK+  + + I +++DRPGHDR
Sbjct: 241 LYTVVKNAETGTTYNIGGHNEMKNIDVVLKVCELLDQLRPKATPYRDQITYVQDRPGHDR 300

Query: 293 RYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           RYAID++KI+ ++GW P+E  E+GL KTV WYL+N+ W
Sbjct: 301 RYAIDAAKIEKDLGWKPEETFETGLKKTVEWYLNNSEW 338


>gi|86357152|ref|YP_469044.1| dTDP-glucose-4,6-dehydratase protein [Rhizobium etli CFN 42]
 gi|86281254|gb|ABC90317.1| dTDP-glucose-4,6-dehydratase protein [Rhizobium etli CFN 42]
          Length = 351

 Score =  426 bits (1096), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 196/335 (58%), Positives = 249/335 (74%), Gaps = 1/335 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSAL R+LV+++  +VL +D LTYAGN  SLK +  +  + FL  DIC
Sbjct: 1   MRILVTGGAGFIGSALVRHLVSEIGAEVLNVDALTYAGNPASLKSVESAPNYQFLHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +  A   F+P+ +++ AAESHVDRSI  A +FI TNI+GTF LL+  R +W  L  
Sbjct: 61  DRARMLEAFASFRPEIVMHLAAESHVDRSISSAADFIQTNIVGTFSLLDAARYYWDGLDA 120

Query: 121 DKKDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
             K  FRFL +STDEVYGSL D+GLF E  PY+PSSPYSA+KA+SD+L +AW  TYG+PV
Sbjct: 121 RDKSSFRFLHVSTDEVYGSLGDEGLFEETTPYDPSSPYSASKAASDHLAIAWHRTYGLPV 180

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           ++SNCSNNYGP+HFPEKLIPL I   +EG  + +YG+G NVRDWLYVEDH RAL+ +  +
Sbjct: 181 VVSNCSNNYGPFHFPEKLIPLMILNALEGKPLPVYGNGANVRDWLYVEDHARALFTIASR 240

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSS 299
           GR GE+YN+GG NER+NID+V  I  +LD +      H  LI  + DRPGHD RYAID+S
Sbjct: 241 GRPGEKYNVGGRNERRNIDVVHRICAILDGVYSDKAPHARLITKVTDRPGHDARYAIDAS 300

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           K++SE+GW  QE  E+G+ KTV WYL+N WWWRPL
Sbjct: 301 KLESELGWKAQETFETGIEKTVHWYLENEWWWRPL 335


>gi|16519748|ref|NP_443868.1| dTDP-glucose 4,6-dehydratase RmlB [Sinorhizobium fredii NGR234]
 gi|2494671|sp|P55462|RFBB_RHISN RecName: Full=Probable dTDP-glucose 4,6-dehydratase
 gi|2182408|gb|AAB91680.1| dTDP-glucose 4,6-dehydratase RmlB [Sinorhizobium fredii NGR234]
          Length = 350

 Score =  426 bits (1096), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 197/335 (58%), Positives = 259/335 (77%), Gaps = 2/335 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSAL RYLV+ +  +VL +DKLTYAGNL SLK +     + FL+ DIC
Sbjct: 1   MRILVTGGAGFIGSALVRYLVS-INAEVLNVDKLTYAGNLASLKPVEGLRNYRFLRADIC 59

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  I  A + FQPD +++ AAESHVDRSI GAD+F+ TN+ GTF +LE  R +WS LSQ
Sbjct: 60  DRVAINEAFETFQPDYVIHLAAESHVDRSITGADDFVQTNVNGTFTMLETARQYWSNLSQ 119

Query: 121 DKKDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           ++K  F+ L +STDEVYGSL D+G F E  PY+PSSPYSA+KA+SD+   AW  TYG+PV
Sbjct: 120 NRKAFFKMLHVSTDEVYGSLGDRGQFEEVSPYDPSSPYSASKAASDHFATAWQRTYGLPV 179

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           ++SNCSNNYGP+HFPEKLIPL I   ++   + +YG G N+RDWLYV+DH RAL+L++++
Sbjct: 180 VISNCSNNYGPFHFPEKLIPLMILNALDRKPLPVYGTGSNIRDWLYVDDHARALWLIVRE 239

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSS 299
           GR GE+YN+GG NE +NID+V  I  LLD L P +  + +LI F++DRPGHD RYAID++
Sbjct: 240 GRPGEKYNVGGRNELRNIDVVNRICLLLDELSPNASHYGDLITFVKDRPGHDARYAIDAT 299

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           K+++E+GW  QEN ++G+ KTV WYL+N WWW+PL
Sbjct: 300 KLETELGWKAQENFDTGIRKTVEWYLENGWWWQPL 334


>gi|161617039|ref|YP_001591004.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|161366403|gb|ABX70171.1| hypothetical protein SPAB_04867 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 355

 Score =  424 bits (1090), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 197/339 (58%), Positives = 251/339 (74%), Gaps = 6/339 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R++VTGGAGFIGSA+ R+++++    V+V+DKLTYAGNL SL  ++QS+ F+F +VDICD
Sbjct: 3   RILVTGGAGFIGSAVVRHIIHETADAVVVVDKLTYAGNLMSLASVAQSDRFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +    +++QPD++++ AAESHVDRSI G   FI TNI+GT+ LLE  R +WS L  D
Sbjct: 63  RASLERVFQQYQPDSVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWSALGAD 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            K  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 AKAAFRFHHISTDEVYGDLHTADDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V+  
Sbjct: 183 LVTNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYHVVTN 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NERKN+D+V  I  LL+ L P+      ++ +LI F++DRPGHD RYA
Sbjct: 243 GAVGETYNIGGHNERKNLDVVRTICALLEELAPQKPQGVANYHDLITFVDDRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+P+
Sbjct: 303 IDASKIARELGWTPQETFESGMRKTVQWYLANEAWWKPV 341


>gi|16762208|ref|NP_457825.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|29143697|ref|NP_807039.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|213051692|ref|ZP_03344570.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213426572|ref|ZP_03359322.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213648374|ref|ZP_03378427.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|213855008|ref|ZP_03383248.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
 gi|289827390|ref|ZP_06546002.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|25292366|pir||AH0921 UDP-N-acetylglucosamine epimerase (UDP-GlcNAc-2-epimerase)
           [imported] - Salmonella enterica subsp. enterica serovar
           Typhi (strain CT18)
 gi|16504512|emb|CAD09394.1| UDP-N-acetylglucosamine epimerase (UDP-GlcNAc-2-epimerase)
           [Salmonella enterica subsp. enterica serovar Typhi]
 gi|29139332|gb|AAO70899.1| UDP-N-acetylglucosamine epimerase [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
          Length = 355

 Score =  424 bits (1089), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 197/339 (58%), Positives = 251/339 (74%), Gaps = 6/339 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R++VTGGAGFIGSA+ R+++++    V+V+DKLTYAGNL SL  ++QS+ F+F +VDICD
Sbjct: 3   RILVTGGAGFIGSAVVRHIIHETADAVVVVDKLTYAGNLMSLASVAQSDRFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +    +++QPD++++ AAESHVDRSI G   FI TNI+GT+ LLE  R +WS L  D
Sbjct: 63  RASLEQVFQQYQPDSVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWSALDAD 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            K  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 AKAAFRFHHISTDEVYGDLHTADDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V+  
Sbjct: 183 LVTNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYHVVTN 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NERKN+D+V  I  LL+ L P+      ++ +LI F++DRPGHD RYA
Sbjct: 243 GAVGETYNIGGHNERKNLDVVRTICALLEELAPQKPQGVANYHDLITFVDDRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+P+
Sbjct: 303 IDASKIARELGWTPQETFESGMRKTVQWYLANEAWWKPV 341


>gi|16767197|ref|NP_462812.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|167994617|ref|ZP_02575708.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|197264413|ref|ZP_03164487.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|6960275|gb|AAF33465.1| 89% identity with E. coli dTDP-D-glucose-4,6-dehydratase (RFFG)
           (SP:P27830); contains similarity to Pfam family PF01370
           (NAD dependent epimerase/dehydratase family),
           score=721.7, E=3.2e-213, N=1 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|16422490|gb|AAL22771.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|197242668|gb|EDY25288.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|205327551|gb|EDZ14315.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|261249050|emb|CBG26910.1| UDP-N-acetylglucosamine epimerase (UDP-GlcNAc-2-epimerase)
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. D23580]
 gi|267996203|gb|ACY91088.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|312915045|dbj|BAJ39019.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|323132274|gb|ADX19704.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|332990762|gb|AEF09745.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 355

 Score =  424 bits (1089), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 197/339 (58%), Positives = 251/339 (74%), Gaps = 6/339 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R++VTGGAGFIGSA+ R+++++    V+V+DKLTYAGNL SL  ++QS+ F+F +VDICD
Sbjct: 3   RILVTGGAGFIGSAVVRHIIHETADAVVVVDKLTYAGNLMSLASVAQSDRFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +    +++QPD++++ AAESHVDRSI G   FI TNI+GT+ LLE  R +WS L  D
Sbjct: 63  RASLERVFQQYQPDSVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWSALDAD 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            K  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 AKAAFRFHHISTDEVYGDLHTADDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V+  
Sbjct: 183 LVTNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYHVVTN 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NERKN+D+V  I  LL+ L P+      ++ +LI F++DRPGHD RYA
Sbjct: 243 GAVGETYNIGGHNERKNLDVVRTICALLEELAPQKPQGVVNYHDLITFVDDRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+P+
Sbjct: 303 IDASKIARELGWTPQETFESGMRKTVQWYLANEAWWKPV 341


>gi|204930251|ref|ZP_03221228.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|204320655|gb|EDZ05857.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
          Length = 355

 Score =  424 bits (1089), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 197/339 (58%), Positives = 251/339 (74%), Gaps = 6/339 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R++VTGGAGFIGSA+ R+++++    V+V+DKLTYAGNL SL  ++QS+ F+F +VDICD
Sbjct: 3   RILVTGGAGFIGSAVVRHIIHETADAVVVVDKLTYAGNLMSLASVTQSDRFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +    +++QPD++++ AAESHVDRSI G   FI TNI+GT+ LLE  R +WS L  D
Sbjct: 63  RASLERVFQQYQPDSVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWSALDAD 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            K  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 AKAAFRFHHISTDEVYGDLHTADDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V+  
Sbjct: 183 LVTNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYHVVTN 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NERKN+D+V  I  LL+ L P+      ++ +LI F++DRPGHD RYA
Sbjct: 243 GAVGETYNIGGHNERKNLDVVRTICALLEELAPQKPQGVANYHDLITFVDDRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+P+
Sbjct: 303 IDASKIARELGWTPQETFESGMRKTVQWYLANEAWWKPV 341


>gi|238912932|ref|ZP_04656769.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
          Length = 355

 Score =  424 bits (1089), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 197/339 (58%), Positives = 251/339 (74%), Gaps = 6/339 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R++VTGGAGFIGSA+ R+++++    V+V+DKLTYAGNL SL  ++QS+ F+F +VDICD
Sbjct: 3   RILVTGGAGFIGSAVVRHIIHETADAVVVVDKLTYAGNLMSLASVAQSDRFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +    +++QPD++++ AAESHVDRSI G   FI TNI+GT+ LLE  R +WS L  D
Sbjct: 63  RASLERVFQQYQPDSVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWSALDAD 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            K  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 AKAAFRFHHISTDEVYGDLHTADDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V+  
Sbjct: 183 LVTNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYHVVTN 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NERKN+D+V  I  LL+ L P+      ++ +LI F++DRPGHD RYA
Sbjct: 243 GAVGETYNIGGHNERKNLDVVRTICALLEELAPQKPQGVANYHDLITFVDDRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+P+
Sbjct: 303 IDASKIARELGWTPQETFESGMRKTVQWYLANETWWKPV 341


>gi|167553309|ref|ZP_02347059.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|168238378|ref|ZP_02663436.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|168244973|ref|ZP_02669905.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|168263187|ref|ZP_02685160.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|168467662|ref|ZP_02701499.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|194448537|ref|YP_002047942.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194737216|ref|YP_002116857.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197251098|ref|YP_002148851.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|198245411|ref|YP_002217859.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200387324|ref|ZP_03213936.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|207859133|ref|YP_002245784.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|194406841|gb|ACF67060.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194712718|gb|ACF91939.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|195630009|gb|EDX48669.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|197214801|gb|ACH52198.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197288730|gb|EDY28105.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|197939927|gb|ACH77260.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|199604422|gb|EDZ02967.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205322228|gb|EDZ10067.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205336230|gb|EDZ22994.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|205348235|gb|EDZ34866.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|206710936|emb|CAR35302.1| UDP-N-acetylglucosamine epimerase (UDP-GlcNAc-2-epimerase)
           [Salmonella enterica subsp. enterica serovar Enteritidis
           str. P125109]
 gi|326625645|gb|EGE31990.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
          Length = 355

 Score =  424 bits (1089), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 197/339 (58%), Positives = 251/339 (74%), Gaps = 6/339 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R++VTGGAGFIGSA+ R+++++    V+V+DKLTYAGNL SL  ++QS+ F+F +VDICD
Sbjct: 3   RILVTGGAGFIGSAVVRHIIHETADAVVVVDKLTYAGNLMSLASVAQSDRFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +    +++QPD++++ AAESHVDRSI G   FI TNI+GT+ LLE  R +WS L  D
Sbjct: 63  RASLERVFQQYQPDSVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWSALDAD 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            K  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 AKAAFRFHHISTDEVYGDLHTADDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V+  
Sbjct: 183 LVTNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYHVVTN 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NERKN+D+V  I  LL+ L P+      ++ +LI F++DRPGHD RYA
Sbjct: 243 GAVGETYNIGGHNERKNLDVVRTICALLEELAPQKPQGVANYHDLITFVDDRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+P+
Sbjct: 303 IDASKIARELGWTPQETFESGMRKTVQWYLANEAWWKPV 341


>gi|161505561|ref|YP_001572673.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|160866908|gb|ABX23531.1| hypothetical protein SARI_03731 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 355

 Score =  423 bits (1088), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 197/339 (58%), Positives = 251/339 (74%), Gaps = 6/339 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R++VTGGAGFIGSA+ R+++++    V+V+DKLTYAGNL SL  ++QS+ F+F +VDICD
Sbjct: 3   RILVTGGAGFIGSAVVRHIIHETADAVVVVDKLTYAGNLMSLAPVAQSDRFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +    +++QPD++++ AAESHVDRSI G   FI TNI+GT+ LLE  R +WS L  D
Sbjct: 63  RASLERVFQQYQPDSVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWSALDAD 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            K  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 AKAAFRFHHISTDEVYGDLHTADDFFTEATPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V+  
Sbjct: 183 LVTNCSNNYGPYHFPEKLIPLIILNALAGKALPVYGNGQQIRDWLYVEDHARALYHVVTN 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NERKN+D+V  I  LL+ L P+      ++ +LI F++DRPGHD RYA
Sbjct: 243 GAVGETYNIGGHNERKNLDVVRTICALLEELAPQKPQGVANYHDLITFVDDRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+P+
Sbjct: 303 IDASKIARELGWTPQETFESGMRKTVQWYLANEAWWKPV 341


>gi|322613006|gb|EFY09957.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322617406|gb|EFY14306.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322625602|gb|EFY22424.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322627025|gb|EFY23818.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322631259|gb|EFY28022.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322638292|gb|EFY34991.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322642772|gb|EFY39359.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322646986|gb|EFY43488.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322650374|gb|EFY46787.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322656336|gb|EFY52630.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322657561|gb|EFY53831.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322665972|gb|EFY62153.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322666711|gb|EFY62888.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322671046|gb|EFY67176.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322679247|gb|EFY75299.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322681651|gb|EFY77678.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322686022|gb|EFY82010.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323192648|gb|EFZ77876.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323197845|gb|EFZ82976.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323203734|gb|EFZ88755.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323205391|gb|EFZ90365.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323210762|gb|EFZ95638.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323215928|gb|EGA00661.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323221421|gb|EGA05839.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323227320|gb|EGA11487.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323231746|gb|EGA15857.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323236161|gb|EGA20238.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323239602|gb|EGA23650.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323244302|gb|EGA28310.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323249601|gb|EGA33513.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323250307|gb|EGA34193.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323256514|gb|EGA40245.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323259788|gb|EGA43421.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323265196|gb|EGA48694.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323268375|gb|EGA51847.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
          Length = 355

 Score =  422 bits (1085), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 196/339 (57%), Positives = 251/339 (74%), Gaps = 6/339 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R++VTGGAGFIGSA+ R+++++    V+V+DKLTYAGNL SL  ++QS+ F+F +VDICD
Sbjct: 3   RILVTGGAGFIGSAVVRHIIHETADAVVVVDKLTYAGNLMSLASVAQSDRFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +    +++QPD++++ AAESHVDRSI G   FI TNI+GT+ LLE  R +WS L  D
Sbjct: 63  RASLERVFQQYQPDSVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWSALDAD 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            K  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 AKAAFRFHHISTDEVYGDLHTADDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V+  
Sbjct: 183 LVTNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYHVVTN 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NERKN+D+V  I  LL+ L P+      ++ +LI F++DRPGHD RYA
Sbjct: 243 GAVGETYNIGGHNERKNLDVVRTICALLEELAPQKPQGVANYHDLITFVDDRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           ID+SKI  ++GW PQE  ESG+ KTV WYL N  WW+P+
Sbjct: 303 IDASKIARDLGWTPQETFESGMRKTVQWYLANEAWWKPV 341


>gi|168822976|ref|ZP_02834976.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205340720|gb|EDZ27484.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|320088338|emb|CBY98098.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
          Length = 355

 Score =  422 bits (1084), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 196/339 (57%), Positives = 251/339 (74%), Gaps = 6/339 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R++VTGGAGFIGSA+ R+++++    V+V+DKLTYAGNL SL  ++QS+ F+F +VDICD
Sbjct: 3   RILVTGGAGFIGSAVVRHIIHETADAVVVVDKLTYAGNLMSLASVTQSDRFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +    +++QP+++++ AAESHVDRSI G   FI TNI+GT+ LLE  R +WS L  D
Sbjct: 63  RASLERVFQQYQPNSVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWSALDAD 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            K  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 AKAAFRFHHISTDEVYGDLHTADDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V+  
Sbjct: 183 LVTNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYHVVTN 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NERKN+D+V  I  LL+ L P+      ++ +LI F++DRPGHD RYA
Sbjct: 243 GAVGETYNIGGHNERKNLDVVRTICALLEELAPQKPQGVANYHDLITFVDDRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+P+
Sbjct: 303 IDASKIARELGWTPQETFESGMRKTVQWYLANEAWWKPV 341


>gi|332345768|gb|AEE59102.1| dTDP-glucose 4,6-dehydratase RfbB [Escherichia coli UMNK88]
          Length = 355

 Score =  422 bits (1084), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 198/337 (58%), Positives = 247/337 (73%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N++   V+V+DKLTYAGNL SL  ++QS  F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINEMSDAVVVVDKLTYAGNLMSLAPVAQSEHFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNTLTED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V   
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKSLPVYGNGQQIRDWLYVEDHARALYCVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+D+V  I  LL+ L P        +++LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLDVVETICELLEELAPNKPHGVVHYSDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+
Sbjct: 303 IDASKIARELGWLPQETFESGMRKTVQWYLANESWWK 339


>gi|215489117|ref|YP_002331548.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O127:H6 str.
           E2348/69]
 gi|312969483|ref|ZP_07783685.1| dTDP-glucose 4,6-dehydratase [Escherichia coli 2362-75]
 gi|215267189|emb|CAS11637.1| dTDP-glucose 4,6-dehydratase RffG [Escherichia coli O127:H6 str.
           E2348/69]
 gi|312286030|gb|EFR13948.1| dTDP-glucose 4,6-dehydratase [Escherichia coli 2362-75]
          Length = 355

 Score =  421 bits (1082), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 200/337 (59%), Positives = 248/337 (73%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS  F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E+QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEYQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNVLTED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V   
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALI---PKSYSH-TELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+D+V  I  LL+ L    P S +H  +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLDVVETICELLEELAPNKPHSVAHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+
Sbjct: 303 IDASKIARELGWLPQETFESGMRKTVQWYLANEIWWK 339


>gi|218692067|ref|YP_002400279.1| dTDP-glucose 4,6-dehydratase [Escherichia coli ED1a]
 gi|218429631|emb|CAR10452.1| dTDP-glucose 4,6-dehydratase [Escherichia coli ED1a]
          Length = 355

 Score =  421 bits (1082), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 198/337 (58%), Positives = 246/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS  F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E+QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEYQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWTALTED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V   
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+D+V  I  LL+ L P        + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLDVVETICELLEELAPNKPHGVAHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+
Sbjct: 303 IDASKIARELGWLPQETFESGMRKTVQWYLANESWWK 339


>gi|331660133|ref|ZP_08361069.1| dTDP-glucose 4,6-dehydratase [Escherichia coli TA206]
 gi|315296836|gb|EFU56125.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 16-3]
 gi|324007458|gb|EGB76677.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 57-2]
 gi|331052701|gb|EGI24736.1| dTDP-glucose 4,6-dehydratase [Escherichia coli TA206]
          Length = 355

 Score =  421 bits (1082), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 198/337 (58%), Positives = 246/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS  F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E+QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEYQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWTALTED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V   
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+D+V  I  LL+ L P        + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLDVVETICELLEELAPNKPHGVAHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+
Sbjct: 303 IDASKIARELGWLPQETFESGMRKTVQWYLANEIWWK 339


>gi|331649613|ref|ZP_08350695.1| dTDP-glucose 4,6-dehydratase [Escherichia coli M605]
 gi|330908090|gb|EGH36609.1| dTDP-glucose 4,6-dehydratase [Escherichia coli AA86]
 gi|331041483|gb|EGI13631.1| dTDP-glucose 4,6-dehydratase [Escherichia coli M605]
          Length = 355

 Score =  421 bits (1082), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 198/337 (58%), Positives = 246/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS  F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E+QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEYQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWTALTED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTNDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V   
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+D+V  I  LL+ L P        + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLDVVETICELLEELAPNKPHGVAHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+
Sbjct: 303 IDASKIARELGWLPQETFESGMRKTVQWYLANESWWK 339


>gi|194438587|ref|ZP_03070675.1| dTDP-glucose 4,6-dehydratase [Escherichia coli 101-1]
 gi|253775586|ref|YP_003038417.1| dTDP-glucose 4,6-dehydratase [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|254039001|ref|ZP_04873052.1| dTDP-glucose 4,6-dehydratase [Escherichia sp. 1_1_43]
 gi|254163732|ref|YP_003046840.1| dTDP-glucose 4,6-dehydratase [Escherichia coli B str. REL606]
 gi|300930048|ref|ZP_07145478.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 187-1]
 gi|194422391|gb|EDX38390.1| dTDP-glucose 4,6-dehydratase [Escherichia coli 101-1]
 gi|226838692|gb|EEH70720.1| dTDP-glucose 4,6-dehydratase [Escherichia sp. 1_1_43]
 gi|242379321|emb|CAQ34132.1| dTDP-glucose 4,6-dehydratase 2 [Escherichia coli BL21(DE3)]
 gi|253326630|gb|ACT31232.1| dTDP-glucose 4,6-dehydratase [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|253975633|gb|ACT41304.1| dTDP-glucose 4,6-dehydratase [Escherichia coli B str. REL606]
 gi|253979789|gb|ACT45459.1| dTDP-glucose 4,6-dehydratase [Escherichia coli BL21(DE3)]
 gi|300462036|gb|EFK25529.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 187-1]
 gi|309704227|emb|CBJ03574.1| dTDP-glucose 4,6-dehydratase [Escherichia coli ETEC H10407]
 gi|323934179|gb|EGB30610.1| dTDP-glucose 4,6-dehydratase [Escherichia coli E1520]
 gi|323959045|gb|EGB54714.1| dTDP-glucose 4,6-dehydratase [Escherichia coli H489]
 gi|323969369|gb|EGB64668.1| dTDP-glucose 4,6-dehydratase [Escherichia coli TA007]
          Length = 355

 Score =  421 bits (1081), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 198/337 (58%), Positives = 246/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS  F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNALTED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V   
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKSLPVYGNGQQIRDWLYVEDHARALYCVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+D+V  I  LL+ L P        +++LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLDVVETICELLEELAPNKPHGVVHYSDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+
Sbjct: 303 IDASKIARELGWLPQETFESGMRKTVQWYLANESWWK 339


>gi|168234242|ref|ZP_02659300.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|194469035|ref|ZP_03075019.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194455399|gb|EDX44238.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|205331797|gb|EDZ18561.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
          Length = 355

 Score =  421 bits (1081), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 196/339 (57%), Positives = 250/339 (73%), Gaps = 6/339 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R++VTGGAGFIGSA+ R+++++    V+V+DKLTYAGNL SL  ++QS+ F+F +VDICD
Sbjct: 3   RILVTGGAGFIGSAVVRHIIHETADAVVVVDKLTYAGNLMSLASVAQSDRFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +    +++QPD++++ AAESHVDRSI G   FI TNI+GT+ LLE  R +WS L  D
Sbjct: 63  RASLERVFQQYQPDSVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWSALDAD 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            K  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 AKAAFRFHHISTDEVYGDLHTADDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V+  
Sbjct: 183 LVTNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYHVVTN 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NERKN+D+V  I  LL+ L P+      ++ +LI F++DRPGHD RYA
Sbjct: 243 GAVGETYNIGGHNERKNLDVVRTICALLEELAPQKPQGVANYHDLITFVDDRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           ID+SKI  E+ W PQE  ESG+ KTV WYL N  WW+P+
Sbjct: 303 IDASKIARELDWTPQETFESGMRKTVQWYLANEAWWKPV 341


>gi|194442418|ref|YP_002043159.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194401081|gb|ACF61303.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
          Length = 355

 Score =  420 bits (1080), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 195/339 (57%), Positives = 250/339 (73%), Gaps = 6/339 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R++VTGGAGFIGSA+ R+++++    V+V+DKLTYAGNL SL  ++QS+ F+F +VDICD
Sbjct: 3   RILVTGGAGFIGSAVVRHIIHETADAVVVVDKLTYAGNLMSLASVTQSDRFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +    +++ P+++++ AAESHVDRSI G   FI TNI+GT+ LLE  R +WS L  D
Sbjct: 63  RASLERVFQQYHPNSVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWSALDAD 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            K  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 AKAAFRFHHISTDEVYGDLHTADDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V+  
Sbjct: 183 LVTNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYHVVTN 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NERKN+D+V  I  LL+ L P+      ++ +LI F++DRPGHD RYA
Sbjct: 243 GAVGETYNIGGHNERKNLDVVRTICALLEELAPQKPQGVANYHDLITFVDDRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+P+
Sbjct: 303 IDASKIARELGWTPQETFESGMRKTVQWYLANEAWWKPV 341


>gi|218699367|ref|YP_002406996.1| dTDP-glucose 4,6 dehydratase [Escherichia coli IAI39]
 gi|253773027|ref|YP_003035858.1| dTDP-glucose 4,6 dehydratase [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|254162033|ref|YP_003045141.1| dTDP-glucose 4,6 dehydratase [Escherichia coli B str. REL606]
 gi|218369353|emb|CAR17111.1| dTDP-glucose 4,6 dehydratase, NAD(P)-binding [Escherichia coli
           IAI39]
 gi|224613064|dbj|BAH24283.1| dTDP-glucose 4,6-dehydratase [Escherichia coli B]
 gi|242377693|emb|CAQ32453.1| RmlB, subunit of dTDP-glucose 4,6-dehydratase [Escherichia coli
           BL21(DE3)]
 gi|253324071|gb|ACT28673.1| dTDP-glucose 4,6-dehydratase [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|253973934|gb|ACT39605.1| dTDP-glucose 4,6 dehydratase, NAD(P)-binding [Escherichia coli B
           str. REL606]
 gi|253978128|gb|ACT43798.1| dTDP-glucose 4,6 dehydratase, NAD(P)-binding [Escherichia coli
           BL21(DE3)]
 gi|281179140|dbj|BAI55470.1| dTDP-D-glucose 4,6-dehydratase [Escherichia coli SE15]
          Length = 361

 Score =  420 bits (1079), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 198/340 (58%), Positives = 245/340 (72%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL EIS S  +SF   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLAEISDSERYSFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D E +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAEAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSGLDD 120

Query: 121 DKKDQFRFLQISTDEVYGSLDK----------GLFSEDMPYNPSSPYSATKASSDYLVLA 170
           +KK  FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 EKKKNFRFHHISTDEVYGDLPHPDEVNSNETLQLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+VF I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVFTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDADKISRELGWKPQETFESGIRKTVEWYLANTNW 340


>gi|9957860|gb|AAG09534.1|AF279624_1 dTDP-D-glucose-4,6-dehydratase [Salmonella enterica]
          Length = 361

 Score =  420 bits (1079), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 196/340 (57%), Positives = 251/340 (73%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++++TGGAGFIGSA+ R+++ + +  V+ IDKLTYAGNL SL +IS+SN ++F   DIC
Sbjct: 1   MKILITGGAGFIGSAVVRHIIKNTQDTVVNIDKLTYAGNLESLSDISESNRYNFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   I    +++QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L +
Sbjct: 61  DSAEITRIFEQYQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEVARKYWSALGE 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVGNSVTLPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WRRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKSLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY+V+ +G+ GE YNIGG+NE+KN+D+VF I  LLD ++PK+ S+ E I ++ DRPGH
Sbjct: 241 RALYIVVTEGKAGETYNIGGHNEKKNLDVVFTICDLLDEIVPKANSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW P EN ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDADKISRELGWKPLENFESGIRKTVEWYLANTQW 340


>gi|331655472|ref|ZP_08356465.1| dTDP-glucose 4,6-dehydratase [Escherichia coli M718]
 gi|331046793|gb|EGI18877.1| dTDP-glucose 4,6-dehydratase [Escherichia coli M718]
          Length = 355

 Score =  420 bits (1079), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 198/337 (58%), Positives = 245/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS  F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNALTED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V   
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKSLPVYGNGQQIRDWLYVEDHARALYCVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+D+V  I  LL+ L P        + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLDVVETICELLEELAPNKPHGVAHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+
Sbjct: 303 IDASKIAHELGWLPQETFESGMRKTVQWYLANESWWK 339


>gi|49176411|ref|YP_026255.1| dTDP-glucose 4,6-dehydratase [Escherichia coli str. K-12 substr.
           MG1655]
 gi|89110229|ref|AP_004009.1| dTDP-glucose 4,6-dehydratase [Escherichia coli str. K-12 substr.
           W3110]
 gi|170083275|ref|YP_001732595.1| dTDP-D-glucose 4,6-dehydratase [Escherichia coli str. K-12 substr.
           DH10B]
 gi|188493730|ref|ZP_03001000.1| dTDP-glucose 4,6-dehydratase [Escherichia coli 53638]
 gi|238902868|ref|YP_002928664.1| dTDP-glucose 4,6-dehydratase [Escherichia coli BW2952]
 gi|256026137|ref|ZP_05440002.1| dTDP-glucose 4,6-dehydratase [Escherichia sp. 4_1_40B]
 gi|293417254|ref|ZP_06659879.1| dTDP-glucose 4,6-dehydratase [Escherichia coli B185]
 gi|293468106|ref|ZP_06664518.1| dTDP-glucose 4,6-dehydratase [Escherichia coli B088]
 gi|300947353|ref|ZP_07161550.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 116-1]
 gi|300955209|ref|ZP_07167604.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 175-1]
 gi|301029001|ref|ZP_07192158.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 196-1]
 gi|301646146|ref|ZP_07246045.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 146-1]
 gi|307140489|ref|ZP_07499845.1| dTDP-glucose 4,6-dehydratase [Escherichia coli H736]
 gi|307313635|ref|ZP_07593255.1| dTDP-glucose 4,6-dehydratase [Escherichia coli W]
 gi|331644522|ref|ZP_08345642.1| dTDP-glucose 4,6-dehydratase [Escherichia coli H736]
 gi|55977781|sp|P27830|RMLB2_ECOLI RecName: Full=dTDP-glucose 4,6-dehydratase 2
 gi|48994969|gb|AAT48213.1| dTDP-glucose 4,6-dehydratase [Escherichia coli str. K-12 substr.
           MG1655]
 gi|85676260|dbj|BAE77510.1| dTDP-glucose 4,6-dehydratase [Escherichia coli str. K12 substr.
           W3110]
 gi|169891110|gb|ACB04817.1| dTDP-D-glucose 4,6-dehydratase [Escherichia coli str. K-12 substr.
           DH10B]
 gi|188488929|gb|EDU64032.1| dTDP-glucose 4,6-dehydratase [Escherichia coli 53638]
 gi|238861015|gb|ACR63013.1| dTDP-glucose 4,6-dehydratase [Escherichia coli BW2952]
 gi|260451366|gb|ACX41788.1| dTDP-glucose 4,6-dehydratase [Escherichia coli DH1]
 gi|291321484|gb|EFE60922.1| dTDP-glucose 4,6-dehydratase [Escherichia coli B088]
 gi|291431022|gb|EFF04017.1| dTDP-glucose 4,6-dehydratase [Escherichia coli B185]
 gi|299878044|gb|EFI86255.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 196-1]
 gi|300317863|gb|EFJ67647.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 175-1]
 gi|300453039|gb|EFK16659.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 116-1]
 gi|301075615|gb|EFK90421.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 146-1]
 gi|306906616|gb|EFN37128.1| dTDP-glucose 4,6-dehydratase [Escherichia coli W]
 gi|315063084|gb|ADT77411.1| dTDP-glucose 4,6-dehydratase [Escherichia coli W]
 gi|315138367|dbj|BAJ45526.1| dTDP-glucose 4,6-dehydratase [Escherichia coli DH1]
 gi|315618513|gb|EFU99099.1| dTDP-glucose 4,6-dehydratase [Escherichia coli 3431]
 gi|323380852|gb|ADX53120.1| dTDP-glucose 4,6-dehydratase [Escherichia coli KO11]
 gi|323938927|gb|EGB35146.1| dTDP-glucose 4,6-dehydratase [Escherichia coli E482]
 gi|331036194|gb|EGI08429.1| dTDP-glucose 4,6-dehydratase [Escherichia coli H736]
          Length = 355

 Score =  419 bits (1078), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 198/337 (58%), Positives = 245/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS  F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNALTED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V   
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKSLPVYGNGQQIRDWLYVEDHARALYCVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+D+V  I  LL+ L P        + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLDVVETICELLEELAPNKPHGVAHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+
Sbjct: 303 IDASKIARELGWLPQETFESGMRKTVQWYLANESWWK 339


>gi|91213310|ref|YP_543296.1| dTDP-glucose 4,6-dehydratase [Escherichia coli UTI89]
 gi|117626048|ref|YP_859371.1| dTDP-glucose 4,6-dehydratase [Escherichia coli APEC O1]
 gi|218560854|ref|YP_002393767.1| dTDP-glucose 4,6-dehydratase [Escherichia coli S88]
 gi|237702798|ref|ZP_04533279.1| dTDP-glucose 4,6-dehydratase [Escherichia sp. 3_2_53FAA]
 gi|91074884|gb|ABE09765.1| dTDP-glucose 4,6-dehydratase [Escherichia coli UTI89]
 gi|115515172|gb|ABJ03247.1| dTDP-glucose 4,6-dehydratase [Escherichia coli APEC O1]
 gi|218367623|emb|CAR05406.1| dTDP-glucose 4,6-dehydratase [Escherichia coli S88]
 gi|226902969|gb|EEH89228.1| dTDP-glucose 4,6-dehydratase [Escherichia sp. 3_2_53FAA]
 gi|294490800|gb|ADE89556.1| dTDP-glucose 4,6-dehydratase [Escherichia coli IHE3034]
 gi|307628852|gb|ADN73156.1| dTDP-glucose 4,6-dehydratase [Escherichia coli UM146]
 gi|315284661|gb|EFU44106.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 110-3]
 gi|323949328|gb|EGB45218.1| dTDP-glucose 4,6-dehydratase [Escherichia coli H252]
 gi|323954102|gb|EGB49899.1| dTDP-glucose 4,6-dehydratase [Escherichia coli H263]
          Length = 355

 Score =  419 bits (1078), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 197/337 (58%), Positives = 245/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS  F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E+QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEYQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWTALTED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY     
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCAATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+D+V  I  LL+ L P        + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLDVVETICELLEELAPNKPHGVAHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+
Sbjct: 303 IDASKIARELGWLPQETFESGMRKTVQWYLANESWWK 339


>gi|82546143|ref|YP_410090.1| dTDP-glucose 4,6-dehydratase [Shigella boydii Sb227]
 gi|81247554|gb|ABB68262.1| dTDP-glucose 4,6-dehydratase [Shigella boydii Sb227]
 gi|320176031|gb|EFW51100.1| dTDP-glucose 4,6-dehydratase [Shigella dysenteriae CDC 74-1112]
 gi|320185450|gb|EFW60219.1| dTDP-glucose 4,6-dehydratase [Shigella flexneri CDC 796-83]
 gi|332089034|gb|EGI94145.1| dTDP-glucose 4,6-dehydratase [Shigella boydii 3594-74]
          Length = 355

 Score =  419 bits (1078), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 198/337 (58%), Positives = 246/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS+ F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSDRFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNTLTED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V   
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+D+V  I  LL+ L P        + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLDVVETICELLEELAPNKPHGVVHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+
Sbjct: 303 IDASKIARELGWLPQETFESGMRKTVQWYLANESWWK 339


>gi|9957855|gb|AAG09530.1|AF279623_1 dTDP-D-glucose-4,6-dehydratase [Salmonella enterica]
          Length = 361

 Score =  419 bits (1078), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 195/340 (57%), Positives = 250/340 (73%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++++TGGAGFIGSA+ R+++ + +  V+ IDKLTYAGNL SL +IS+SN ++F   DIC
Sbjct: 1   MKILITGGAGFIGSAVVRHIIKNTQNTVVNIDKLTYAGNLESLSDISESNRYNFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   I    +++QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L +
Sbjct: 61  DSAAITRIFEQYQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEVARKYWSALGE 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEAGNSVTLPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WRRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKSLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY+V+ +G+ GE YNIGG+NE+KN+D+VF I  LLD ++PK+ S+ E I ++ DRPGH
Sbjct: 241 RALYIVVTEGKAGETYNIGGHNEKKNLDVVFTICDLLDEIVPKATSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW P E  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDADKISRELGWKPLETFESGIRKTVEWYLANTKW 340


>gi|298290101|ref|YP_003692040.1| dTDP-glucose 4,6-dehydratase [Starkeya novella DSM 506]
 gi|296926612|gb|ADH87421.1| dTDP-glucose 4,6-dehydratase [Starkeya novella DSM 506]
          Length = 354

 Score =  419 bits (1078), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 200/337 (59%), Positives = 251/337 (74%), Gaps = 4/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
            R++VTGGAGFIGSA+ R LV   + QVL  DKLTYAGNL SL E+      SFLQ DIC
Sbjct: 6   QRVLVTGGAGFIGSAVVRRLVRQGR-QVLTYDKLTYAGNLASLAEVHNLPGHSFLQADIC 64

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D    R AL+ F+PD +++ AAESHVDRSI G  +FI TNI+GT+ LL+E   +W  L  
Sbjct: 65  DGRAFREALESFRPDLVMHLAAESHVDRSIDGPGDFIATNIVGTYTLLDEALRYWRGLDA 124

Query: 121 DKKDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
             + +FRF  ISTDEV+G+L + GLF ED PY P+SPYSA+KA+SD+LV AW HTYG+PV
Sbjct: 125 AAQKRFRFHHISTDEVFGTLGEDGLFREDTPYQPNSPYSASKAASDHLVRAWFHTYGLPV 184

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           ++SNCSNNYGPYHFPEKLIPL I   +EG+ + +YG G+NVRDWLYVEDH  AL L+  +
Sbjct: 185 VMSNCSNNYGPYHFPEKLIPLTILNALEGAPLPVYGKGENVRDWLYVEDHAAALELIATR 244

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIP--KSYSHTELIRFIEDRPGHDRRYAID 297
           GR+GE YN+GG+NER+NID+V  I  ++D ++P  K      LIRF+ DRPGHD RYAID
Sbjct: 245 GRLGESYNVGGSNERRNIDVVRTICAIMDRVVPDAKIGPRDALIRFVTDRPGHDARYAID 304

Query: 298 SSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           +SK+K+E+GW P+ + ESG+ KTV WYLDN  WW PL
Sbjct: 305 ASKLKTELGWVPEHDFESGIEKTVRWYLDNAAWWEPL 341


>gi|300939995|ref|ZP_07154622.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 21-1]
 gi|300455169|gb|EFK18662.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 21-1]
          Length = 355

 Score =  419 bits (1078), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 198/337 (58%), Positives = 245/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS  F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETSDAVIVVDKLTYAGNLMSLAPVAQSERFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARTYWNALTED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V   
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+D+V  I  LL+ L P        + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLDVVETICELLEELAPNKPHGVAHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+
Sbjct: 303 IDASKIARELGWLPQETFESGMRKTVQWYLANEIWWK 339


>gi|26250527|ref|NP_756567.1| dTDP-glucose 4,6-dehydratase [Escherichia coli CFT073]
 gi|227888628|ref|ZP_04006433.1| dTDP-glucose 4,6-dehydratase [Escherichia coli 83972]
 gi|300985799|ref|ZP_07177591.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 45-1]
 gi|301047332|ref|ZP_07194417.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 185-1]
 gi|306815174|ref|ZP_07449327.1| dTDP-glucose 4,6-dehydratase [Escherichia coli NC101]
 gi|26110957|gb|AAN83141.1|AE016769_256 dTDP-glucose 4,6-dehydratase [Escherichia coli CFT073]
 gi|222035489|emb|CAP78234.1| dTDP-glucose 4,6-dehydratase [Escherichia coli LF82]
 gi|227834467|gb|EEJ44933.1| dTDP-glucose 4,6-dehydratase [Escherichia coli 83972]
 gi|300300749|gb|EFJ57134.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 185-1]
 gi|300407950|gb|EFJ91488.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 45-1]
 gi|305851543|gb|EFM51997.1| dTDP-glucose 4,6-dehydratase [Escherichia coli NC101]
 gi|307555915|gb|ADN48690.1| dTDP-glucose 4,6-dehydratase [Escherichia coli ABU 83972]
 gi|312948344|gb|ADR29171.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O83:H1 str. NRG
           857C]
 gi|315293127|gb|EFU52479.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 153-1]
          Length = 355

 Score =  419 bits (1078), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 197/337 (58%), Positives = 246/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS  F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E+QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEYQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWTALTED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V   
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+++V  I  LL+ L P        + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLEVVETICELLEELAPNKPHGVAHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+
Sbjct: 303 IDASKIARELGWLPQETFESGMRKTVQWYLANESWWK 339


>gi|218701298|ref|YP_002408927.1| dTDP-glucose 4,6-dehydratase [Escherichia coli IAI39]
 gi|218371284|emb|CAR19118.1| dTDP-glucose 4,6-dehydratase [Escherichia coli IAI39]
          Length = 355

 Score =  419 bits (1077), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 198/337 (58%), Positives = 245/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS  F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARTYWNALTED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V   
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+D+V  I  LL+ L P        + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLDVVETICELLEELAPNKPHGVAHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+
Sbjct: 303 IDASKIARELGWLPQETFESGMRKTVQWYLANEIWWK 339


>gi|331665434|ref|ZP_08366333.1| dTDP-glucose 4,6-dehydratase [Escherichia coli TA143]
 gi|331057332|gb|EGI29321.1| dTDP-glucose 4,6-dehydratase [Escherichia coli TA143]
          Length = 355

 Score =  419 bits (1077), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 198/337 (58%), Positives = 245/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS  F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNALTED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V   
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+D+V  I  LL+ L P        + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLDVVETICELLEELAPNKPHGVAHYHDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+
Sbjct: 303 IDASKIARELGWLPQETFESGMRKTVQWYLANESWWK 339


>gi|281180838|dbj|BAI57168.1| dTDP-glucose 4,6-dehydratase [Escherichia coli SE15]
          Length = 355

 Score =  419 bits (1077), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 197/337 (58%), Positives = 245/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+D LTYAGNL SL  ++QS  F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETSDAVVVVDTLTYAGNLMSLAPVAQSERFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E+QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEYQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWTALTED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V   
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+D+V  I  LL+ L P        + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLDVVETICELLEELAPNKPHGVAHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+
Sbjct: 303 IDASKIARELGWLPQETFESGMRKTVQWYLANESWWK 339


>gi|170683610|ref|YP_001746107.1| dTDP-glucose 4,6-dehydratase [Escherichia coli SMS-3-5]
 gi|170521328|gb|ACB19506.1| dTDP-glucose 4,6-dehydratase [Escherichia coli SMS-3-5]
          Length = 355

 Score =  419 bits (1077), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 198/337 (58%), Positives = 245/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS  F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARTYWNALTED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V   
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+D+V  I  LL+ L P        + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLDVVETICELLEELAPNKPHGVAHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+
Sbjct: 303 IDASKIARELGWLPQETFESGMRKTVQWYLANESWWK 339


>gi|74314303|ref|YP_312722.1| dTDP-glucose 4,6-dehydratase [Shigella sonnei Ss046]
 gi|73857780|gb|AAZ90487.1| dTDP-glucose 4,6-dehydratase [Shigella sonnei Ss046]
 gi|323167538|gb|EFZ53244.1| dTDP-glucose 4,6-dehydratase [Shigella sonnei 53G]
 gi|323173405|gb|EFZ59034.1| dTDP-glucose 4,6-dehydratase [Escherichia coli LT-68]
          Length = 355

 Score =  419 bits (1076), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 198/337 (58%), Positives = 245/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS  F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNTLTED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V   
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+D+V  I  LL+ L P        + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLDVVETICELLEELAPNKPHGVVHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+
Sbjct: 303 IDASKIARELGWLPQETFESGMRKTVQWYLANESWWK 339


>gi|301160442|emb|CBW19971.1| UDP-N-acetylglucosamine epimerase (UDP-GlcNAc-2-epimerase)
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. SL1344]
 gi|321225447|gb|EFX50504.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
          Length = 350

 Score =  419 bits (1076), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 195/336 (58%), Positives = 248/336 (73%), Gaps = 6/336 (1%)

Query: 5   VTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDREC 64
           +TGGAGFIGSA+ R+++++    V+V+DKLTYAGNL SL  ++QS+ F+F +VDICDR  
Sbjct: 1   MTGGAGFIGSAVVRHIIHETADAVVVVDKLTYAGNLMSLASVAQSDRFAFEKVDICDRAS 60

Query: 65  IRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKD 124
           +    +++QPD++++ AAESHVDRSI G   FI TNI+GT+ LLE  R +WS L  D K 
Sbjct: 61  LERVFQQYQPDSVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWSALDADAKA 120

Query: 125 QFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLLS 182
            FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P L++
Sbjct: 121 AFRFHHISTDEVYGDLHTADDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPTLVT 180

Query: 183 NCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKGRI 242
           NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V+  G +
Sbjct: 181 NCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYHVVTNGAV 240

Query: 243 GERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYAIDS 298
           GE YNIGG+NERKN+D+V  I  LL+ L P+      ++ +LI F++DRPGHD RYAID+
Sbjct: 241 GETYNIGGHNERKNLDVVRTICALLEELAPQKPQGVVNYHDLITFVDDRPGHDLRYAIDA 300

Query: 299 SKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           SKI  E+GW PQE  ESG+ KTV WYL N  WW+P+
Sbjct: 301 SKIARELGWTPQETFESGMRKTVQWYLANEAWWKPV 336


>gi|291285204|ref|YP_003502022.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O55:H7 str. CB9615]
 gi|209753444|gb|ACI75029.1| glucose-1-phosphate thymidylyltransferase [Escherichia coli]
 gi|290765077|gb|ADD59038.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O55:H7 str. CB9615]
 gi|320660954|gb|EFX28397.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O55:H7 str. USDA
           5905]
          Length = 355

 Score =  419 bits (1076), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 198/337 (58%), Positives = 245/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS  F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNVLTED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V   
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+D+V  I  LL+ L P        + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLDVVETICELLEELAPNKPQGVVHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+
Sbjct: 303 IDASKIARELGWLPQETFESGMRKTVQWYLANESWWK 339


>gi|157155600|ref|YP_001465269.1| dTDP-glucose 4,6-dehydratase [Escherichia coli E24377A]
 gi|191166067|ref|ZP_03027902.1| dTDP-glucose 4,6-dehydratase [Escherichia coli B7A]
 gi|256021469|ref|ZP_05435334.1| dTDP-glucose 4,6-dehydratase [Shigella sp. D9]
 gi|260857805|ref|YP_003231696.1| dTDP-glucose 4,6-dehydratase RffG [Escherichia coli O26:H11 str.
           11368]
 gi|260870514|ref|YP_003236916.1| dTDP-glucose 4,6-dehydratase RffG [Escherichia coli O111:H- str.
           11128]
 gi|300818742|ref|ZP_07098949.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 107-1]
 gi|300923288|ref|ZP_07139337.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 182-1]
 gi|301325478|ref|ZP_07218961.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 78-1]
 gi|309796272|ref|ZP_07690682.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 145-7]
 gi|332282704|ref|ZP_08395117.1| dTDP-glucose 4,6-dehydratase [Shigella sp. D9]
 gi|157077630|gb|ABV17338.1| dTDP-glucose 4,6-dehydratase [Escherichia coli E24377A]
 gi|190903843|gb|EDV63557.1| dTDP-glucose 4,6-dehydratase [Escherichia coli B7A]
 gi|257756454|dbj|BAI27956.1| dTDP-glucose 4,6-dehydratase RffG [Escherichia coli O26:H11 str.
           11368]
 gi|257766870|dbj|BAI38365.1| dTDP-glucose 4,6-dehydratase RffG [Escherichia coli O111:H- str.
           11128]
 gi|300420433|gb|EFK03744.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 182-1]
 gi|300528708|gb|EFK49770.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 107-1]
 gi|300847705|gb|EFK75465.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 78-1]
 gi|308120154|gb|EFO57416.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 145-7]
 gi|323155190|gb|EFZ41374.1| dTDP-glucose 4,6-dehydratase [Escherichia coli EPECa14]
 gi|323177798|gb|EFZ63382.1| dTDP-glucose 4,6-dehydratase [Escherichia coli 1180]
 gi|324115748|gb|EGC09683.1| dTDP-glucose 4,6-dehydratase [Escherichia coli E1167]
 gi|332105056|gb|EGJ08402.1| dTDP-glucose 4,6-dehydratase [Shigella sp. D9]
          Length = 355

 Score =  419 bits (1076), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 198/337 (58%), Positives = 245/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS  F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSEHFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNTLTED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V   
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+D+V  I  LL+ L P        + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLDVVETICELLEELAPNKPHGVAHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+
Sbjct: 303 IDASKIARELGWLPQETFESGMRKTVQWYLANESWWK 339


>gi|209921262|ref|YP_002295346.1| dTDP-glucose 4,6-dehydratase [Escherichia coli SE11]
 gi|218697506|ref|YP_002405173.1| dTDP-glucose 4,6-dehydratase [Escherichia coli 55989]
 gi|300823320|ref|ZP_07103451.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 119-7]
 gi|300904040|ref|ZP_07121922.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 84-1]
 gi|301303683|ref|ZP_07209804.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 124-1]
 gi|331670633|ref|ZP_08371470.1| dTDP-glucose 4,6-dehydratase [Escherichia coli TA271]
 gi|331679897|ref|ZP_08380560.1| dTDP-glucose 4,6-dehydratase [Escherichia coli H591]
 gi|209914521|dbj|BAG79595.1| dTDP-glucose 4,6-dehydratase [Escherichia coli SE11]
 gi|218354238|emb|CAV00899.1| dTDP-glucose 4,6-dehydratase [Escherichia coli 55989]
 gi|300403992|gb|EFJ87530.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 84-1]
 gi|300524106|gb|EFK45175.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 119-7]
 gi|300840983|gb|EFK68743.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 124-1]
 gi|315254153|gb|EFU34121.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 85-1]
 gi|320198503|gb|EFW73104.1| dTDP-glucose 4,6-dehydratase [Escherichia coli EC4100B]
 gi|323182561|gb|EFZ67965.1| dTDP-glucose 4,6-dehydratase [Escherichia coli 1357]
 gi|323943809|gb|EGB39904.1| dTDP-glucose 4,6-dehydratase [Escherichia coli H120]
 gi|324016184|gb|EGB85403.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 117-3]
 gi|331062106|gb|EGI34028.1| dTDP-glucose 4,6-dehydratase [Escherichia coli TA271]
 gi|331072444|gb|EGI43776.1| dTDP-glucose 4,6-dehydratase [Escherichia coli H591]
          Length = 355

 Score =  419 bits (1076), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 198/337 (58%), Positives = 245/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS  F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNTLTED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V   
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+D+V  I  LL+ L P        + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLDVVETICELLEELAPNKPHGVAHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+
Sbjct: 303 IDASKIARELGWLPQETFESGMRKTVQWYLANESWWK 339


>gi|293413232|ref|ZP_06655894.1| dTDP-glucose 4,6-dehydratase [Escherichia coli B354]
 gi|291468180|gb|EFF10677.1| dTDP-glucose 4,6-dehydratase [Escherichia coli B354]
          Length = 355

 Score =  419 bits (1076), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 197/337 (58%), Positives = 245/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS  F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E QPD +++ AAESHVDRSI G   F+ TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFVETNIVGTYTLLEAARAYWNALTED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V   
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+D+V  I  LL+ L P        + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLDVVETICELLEELAPNKPHGVAHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+
Sbjct: 303 IDASKIARELGWLPQETFESGMRKTVQWYLANESWWK 339


>gi|157163262|ref|YP_001460580.1| dTDP-glucose 4,6-dehydratase [Escherichia coli HS]
 gi|170022185|ref|YP_001727139.1| dTDP-glucose 4,6-dehydratase [Escherichia coli ATCC 8739]
 gi|193066139|ref|ZP_03047194.1| dTDP-glucose 4,6-dehydratase [Escherichia coli E22]
 gi|193071043|ref|ZP_03051970.1| dTDP-glucose 4,6-dehydratase [Escherichia coli E110019]
 gi|194429784|ref|ZP_03062299.1| dTDP-glucose 4,6-dehydratase [Escherichia coli B171]
 gi|260846435|ref|YP_003224213.1| dTDP-glucose 4,6-dehydratase RffG [Escherichia coli O103:H2 str.
           12009]
 gi|300921506|ref|ZP_07137850.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 115-1]
 gi|312971929|ref|ZP_07786103.1| dTDP-glucose 4,6-dehydratase [Escherichia coli 1827-70]
 gi|157068942|gb|ABV08197.1| dTDP-glucose 4,6-dehydratase [Escherichia coli HS]
 gi|169757113|gb|ACA79812.1| dTDP-glucose 4,6-dehydratase [Escherichia coli ATCC 8739]
 gi|192926236|gb|EDV80875.1| dTDP-glucose 4,6-dehydratase [Escherichia coli E22]
 gi|192955630|gb|EDV86106.1| dTDP-glucose 4,6-dehydratase [Escherichia coli E110019]
 gi|194412196|gb|EDX28503.1| dTDP-glucose 4,6-dehydratase [Escherichia coli B171]
 gi|257761582|dbj|BAI33079.1| dTDP-glucose 4,6-dehydratase RffG [Escherichia coli O103:H2 str.
           12009]
 gi|300411574|gb|EFJ94884.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 115-1]
 gi|310334306|gb|EFQ00511.1| dTDP-glucose 4,6-dehydratase [Escherichia coli 1827-70]
 gi|323161148|gb|EFZ47066.1| dTDP-glucose 4,6-dehydratase [Escherichia coli E128010]
          Length = 355

 Score =  419 bits (1076), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 198/337 (58%), Positives = 245/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS  F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSEHFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNTLTED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V   
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+D+V  I  LL+ L P        + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLDVVETICELLEELAPNKPHGVVHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+
Sbjct: 303 IDASKIARELGWLPQETFESGMRKTVQWYLANESWWK 339


>gi|331675258|ref|ZP_08376009.1| dTDP-glucose 4,6-dehydratase [Escherichia coli TA280]
 gi|331067544|gb|EGI38948.1| dTDP-glucose 4,6-dehydratase [Escherichia coli TA280]
          Length = 355

 Score =  419 bits (1076), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 197/337 (58%), Positives = 245/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS  F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E QPD +++ AAESHVDRSI G   F+ TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFVETNIVGTYTLLEAARAYWNALTED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V   
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+D+V  I  LL+ L P        + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLDVVETICELLEELAPNKPHGVVHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+
Sbjct: 303 IDASKIARELGWLPQETFESGMRKTVQWYLANESWWK 339


>gi|77460279|ref|YP_349786.1| dTDP-glucose 4,6-dehydratase [Pseudomonas fluorescens Pf0-1]
 gi|77384282|gb|ABA75795.1| dTDP-glucose 4,6-dehydratase [Pseudomonas fluorescens Pf0-1]
          Length = 358

 Score =  419 bits (1076), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 199/334 (59%), Positives = 251/334 (75%), Gaps = 4/334 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++++    V+ +DKLTYAGNL SL E+SQ + ++F +VDIC
Sbjct: 1   MKILVTGGAGFIGSAVIRHIISNTTDSVVNVDKLTYAGNLESLAEVSQDSRYAFERVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR+ I   L+E QPDAI++ AAESHVDRSI G  EFI TNIIGT+ LLE  R +W+ L  
Sbjct: 61  DRDQIDRVLREHQPDAIMHLAAESHVDRSISGPSEFIQTNIIGTYTLLEAARHYWAALDD 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K  FRF  ISTDEVYG L+  + LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 QRKAAFRFHHISTDEVYGDLEGPEDLFTETTPYQPSSPYSASKASSDHLVRAWARTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            L++NCSNNYGP HFPEKLIPL I   +EG  + +YG G  VRDWLYVEDH RALY V+ 
Sbjct: 181 TLVTNCSNNYGPCHFPEKLIPLIILNALEGKPLPVYGKGNQVRDWLYVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY--SHTELIRFIEDRPGHDRRYAI 296
           +G IGE YNIGG+NE++NI++V  +  LLD L P S    H  LI +++DRPGHD+RYAI
Sbjct: 241 EGVIGETYNIGGHNEKQNIEVVNTLCALLDELRPDSAHRPHASLITYVQDRPGHDQRYAI 300

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           D+SKI+ E+GW P+E  ESG+ KTV WYL N  W
Sbjct: 301 DASKIQRELGWTPEETFESGIRKTVEWYLSNTEW 334


>gi|110807522|ref|YP_691042.1| dTDP-glucose 4,6-dehydratase [Shigella flexneri 5 str. 8401]
 gi|110617070|gb|ABF05737.1| dTDP-glucose 4,6-dehydratase [Shigella flexneri 5 str. 8401]
 gi|332750987|gb|EGJ81392.1| dTDP-glucose 4,6-dehydratase [Shigella flexneri 4343-70]
 gi|332996849|gb|EGK16469.1| dTDP-glucose 4,6-dehydratase [Shigella flexneri VA-6]
 gi|332997925|gb|EGK17532.1| dTDP-glucose 4,6-dehydratase [Shigella flexneri K-218]
 gi|332998270|gb|EGK17872.1| dTDP-glucose 4,6-dehydratase [Shigella flexneri K-272]
 gi|333013810|gb|EGK33173.1| dTDP-glucose 4,6-dehydratase [Shigella flexneri K-227]
          Length = 355

 Score =  418 bits (1075), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 199/337 (59%), Positives = 246/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS  F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNTLTED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V   
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALI---PKSYSH-TELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+D+V  I  LL+ L    P   +H  +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLDVVETICELLEELASNKPHGVAHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+
Sbjct: 303 IDASKIARELGWLPQETFESGMRKTVQWYLANESWWK 339


>gi|226290771|gb|ACO40470.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Dakar]
 gi|298353033|gb|ADI77012.1| RmlB [Salmonella enterica]
          Length = 361

 Score =  418 bits (1075), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 195/340 (57%), Positives = 250/340 (73%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++++TGGAGFIGSA+ R+++ + +  V+ IDKLTYAGNL SL +IS+SN ++F   DIC
Sbjct: 1   MKILITGGAGFIGSAVIRHIIKNTQDTVVNIDKLTYAGNLESLSDISESNRYNFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   I    +++QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L +
Sbjct: 61  DSAEITRIFEQYQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEVARKYWSALGE 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVENSVTLPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WRRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY+V+ +G+ GE YNIGG+NE+KN+D+VF I  LLD ++PK+ S+ E I ++ DRPGH
Sbjct: 241 RALYIVVTEGKAGETYNIGGHNEKKNVDVVFTICDLLDEIVPKAASYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW P E  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAGKISRELGWKPLETFESGIRKTVEWYLANTQW 340


>gi|323189489|gb|EFZ74769.1| dTDP-glucose 4,6-dehydratase [Escherichia coli RN587/1]
          Length = 355

 Score =  418 bits (1075), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 197/337 (58%), Positives = 247/337 (73%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS+ F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALARYIINETNDAVVVVDKLTYAGNLMSLAPVAQSDRFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNALAED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V+  
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVVTT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+++V  I  LL+ L P        + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLEVVETICELLEELAPNKPHGVAHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+
Sbjct: 303 IDASKIARELGWLPQETFESGMRKTVQWYLANESWWK 339


>gi|218707425|ref|YP_002414944.1| dTDP-glucose 4,6-dehydratase [Escherichia coli UMN026]
 gi|293407418|ref|ZP_06651338.1| dTDP-glucose 4,6 dehydratase [Escherichia coli FVEC1412]
 gi|298383158|ref|ZP_06992752.1| dTDP-glucose 4,6 dehydratase [Escherichia coli FVEC1302]
 gi|300900666|ref|ZP_07118820.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 198-1]
 gi|218434522|emb|CAR15448.1| dTDP-glucose 4,6-dehydratase [Escherichia coli UMN026]
 gi|284923893|emb|CBG36992.1| dTDP-glucose 4,6-dehydratase [Escherichia coli 042]
 gi|291425529|gb|EFE98567.1| dTDP-glucose 4,6 dehydratase [Escherichia coli FVEC1412]
 gi|298276394|gb|EFI17913.1| dTDP-glucose 4,6 dehydratase [Escherichia coli FVEC1302]
 gi|300355844|gb|EFJ71714.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 198-1]
          Length = 355

 Score =  418 bits (1075), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 198/337 (58%), Positives = 245/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS  F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNALTED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V   
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKLLPVYGNGQQIRDWLYVEDHARALYCVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+D+V  I  LL+ L P        + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLDVVETICELLEELAPNKPHGVAHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+
Sbjct: 303 IDASKIARELGWLPQETFESGMRKTVQWYLANESWWK 339


>gi|9957825|gb|AAG09506.1|AF279617_1 dTDP-D-glucose-4,6-dehydratase [Salmonella enterica]
          Length = 361

 Score =  418 bits (1075), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 195/340 (57%), Positives = 250/340 (73%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++++TGGAGFIGSA+ R+++ + +  V+ IDKLTYAGNL SL +IS+SN ++F   DIC
Sbjct: 1   MKILITGGAGFIGSAVVRHIIKNTQDTVVNIDKLTYAGNLESLSDISESNRYNFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   I    +++QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L +
Sbjct: 61  DSAEITRIFEQYQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEVARKYWSALGE 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEAGNSVTLPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WRRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKSLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY+V+ +G+ GE YNIGG+NE+KN+D+VF I  LLD ++PK+ S+ E I ++ DRPGH
Sbjct: 241 RALYIVVTEGKAGETYNIGGHNEKKNLDVVFTICDLLDEIVPKAASYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW P E  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDADKISRELGWKPLETFESGIRKTVEWYLANTQW 340


>gi|324111014|gb|EGC05001.1| dTDP-glucose 4,6-dehydratase [Escherichia fergusonii B253]
          Length = 355

 Score =  418 bits (1075), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 197/337 (58%), Positives = 247/337 (73%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS+ F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETNDAVVVVDKLTYAGNLMSLAPVAQSDRFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNALAED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V+  
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVVTT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+++V  I  LL+ L P        + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLEVVETICELLEELAPNKPHGVAHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+
Sbjct: 303 IDASKIARELGWLPQETFESGMRKTVQWYLANESWWK 339


>gi|320655329|gb|EFX23271.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O55:H7 str. 3256-97
           TW 07815]
          Length = 355

 Score =  418 bits (1074), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 198/337 (58%), Positives = 245/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS  F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNVLTED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSVFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V   
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+D+V  I  LL+ L P        + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLDVVETICELLEELAPNKPQGVVHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+
Sbjct: 303 IDASKIARELGWLPQETFESGMRKTVQWYLANESWWK 339


>gi|170769842|ref|ZP_02904295.1| dTDP-glucose 4,6-dehydratase [Escherichia albertii TW07627]
 gi|170121280|gb|EDS90211.1| dTDP-glucose 4,6-dehydratase [Escherichia albertii TW07627]
          Length = 355

 Score =  418 bits (1074), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 199/337 (59%), Positives = 247/337 (73%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           +++VTGGAGFIGSAL RY++N+ +  V+V+DKLTYAGNL SL  ++QS+ F+F +VD+CD
Sbjct: 3   KILVTGGAGFIGSALVRYIINETRDAVVVVDKLTYAGNLMSLAPVAQSDRFAFEKVDVCD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +       QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L+ D
Sbjct: 63  RAELARVFARHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNTLADD 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V   
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALI---PKSYSH-TELIRFIEDRPGHDRRYA 295
           G+IGE YNIGG+NERKN+D+V  I  LL+ L    P+  +H  +LI F+ DRPGHD RYA
Sbjct: 243 GKIGETYNIGGHNERKNLDVVETICELLEELAPNKPQGVAHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+
Sbjct: 303 IDASKIARELGWLPQETFESGMRKTVQWYLTNESWWK 339


>gi|9957864|gb|AAG09537.1|AF279625_1 dTDP-D-glucose-4,6-dehydratase [Salmonella enterica]
          Length = 361

 Score =  418 bits (1074), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 195/340 (57%), Positives = 250/340 (73%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++++TGGAGFIGSA+ R+++ + +  V+ IDKLTYAGNL SL +IS+SN ++F   DIC
Sbjct: 1   MKILITGGAGFIGSAVVRHIIKNTQDTVVNIDKLTYAGNLESLSDISESNRYNFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   I    +++QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L +
Sbjct: 61  DSAEITRIFEQYQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEGARKYWSALGE 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEAENSVTLPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WRRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RAL++V+ +G+ GE YNIGG+NE+KN+D+VF I  LLD ++PK+ S+ E I ++ DRPGH
Sbjct: 241 RALHMVVTEGKAGETYNIGGHNEKKNLDVVFTICDLLDEIVPKATSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  EIGW P E  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDADKISREIGWKPLETFESGIRKTVEWYLANTQW 340


>gi|193062876|ref|ZP_03043969.1| dTDP-glucose 4,6-dehydratase [Escherichia coli E22]
 gi|260844652|ref|YP_003222430.1| putative dTDP-glucose 4,6-dehydratase [Escherichia coli O103:H2
           str. 12009]
 gi|192931519|gb|EDV84120.1| dTDP-glucose 4,6-dehydratase [Escherichia coli E22]
 gi|257759799|dbj|BAI31296.1| predicted dTDP-glucose 4,6-dehydratase [Escherichia coli O103:H2
           str. 12009]
          Length = 358

 Score =  418 bits (1074), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 195/342 (57%), Positives = 247/342 (72%), Gaps = 10/342 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSKRYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNTEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           DRRYAID+ KI  E+GW PQE  ESG+ KT+ WYL+NN W R
Sbjct: 301 DRRYAIDAEKIGRELGWKPQETFESGIRKTINWYLNNNDWCR 342


>gi|298353020|gb|ADI77000.1| RmlB [Salmonella enterica]
          Length = 363

 Score =  418 bits (1074), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 195/340 (57%), Positives = 250/340 (73%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++++TGGAGFIGSA+ R+++ + +  V+ IDKLTYAGNL SL +IS+SN ++F   DIC
Sbjct: 1   MKILITGGAGFIGSAVVRHIIKNTQDTVVNIDKLTYAGNLESLSDISESNRYNFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   I    +++QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L +
Sbjct: 61  DSTEITRIFEQYQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEVARKYWSALGE 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVGNSVTLPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WRRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKSLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY+V+ +G+ GE YNIGG+NE+KN+D+VF I  LLD ++PK+ S+ E I ++ DRPGH
Sbjct: 241 RALYIVVTEGKAGETYNIGGHNEKKNLDVVFTICDLLDEIVPKATSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW P E  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDADKISRELGWKPLETFESGIRKTVEWYLANTKW 340


>gi|24527247|gb|AAK60448.1| DTDP-glucose 4,6-dehydratase [Escherichia coli]
          Length = 358

 Score =  418 bits (1074), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 195/342 (57%), Positives = 247/342 (72%), Gaps = 10/342 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYIFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNTEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           DRRYAID+ KI  E+GW PQE  ESG+ KT+ WYL+NN W R
Sbjct: 301 DRRYAIDAEKISRELGWKPQETFESGIRKTINWYLNNNDWCR 342


>gi|330505514|ref|YP_004382383.1| dTDP-glucose 4,6-dehydratase [Pseudomonas mendocina NK-01]
 gi|328919800|gb|AEB60631.1| dTDP-glucose 4,6-dehydratase [Pseudomonas mendocina NK-01]
          Length = 353

 Score =  417 bits (1073), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 202/338 (59%), Positives = 253/338 (74%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR+++TGGAGFIGSAL R+L+ D + +VL +DKLTYAGNL SL EI+ S  + F+Q DI 
Sbjct: 1   MRVLITGGAGFIGSALTRHLIQDTEHEVLNLDKLTYAGNLESLLEIAASPRYRFVQADIA 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D E + + L EFQPDAI++ AAESHVDRSI G   FI TNI+GT+ LLE TR +W  L+ 
Sbjct: 61  DAERVAATLSEFQPDAIMHLAAESHVDRSIDGPAAFIQTNIVGTYSLLESTRAYWLGLNT 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K  FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KA+SD+LV AW  TYG+P
Sbjct: 121 VRKAAFRFHHISTDEVYGDLHGVDDLFTETTPYAPSSPYSASKAASDHLVRAWQRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           VL++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ VRDWLYVEDH RAL  V+ 
Sbjct: 181 VLITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQVRDWLYVEDHARALLKVVS 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G++GE YNIGG+NE+KN+D+V  I  LL+ L P+  +    + +LI +++DRPGHD RY
Sbjct: 241 EGKVGETYNIGGHNEQKNLDVVHSICALLEELAPQKPAGIARYEDLITYVQDRPGHDLRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID+SKI+ E+GW PQE  E+GL KTV WYLDN  W R
Sbjct: 301 AIDASKIECELGWVPQETFETGLRKTVQWYLDNLEWCR 338


>gi|62182397|ref|YP_218814.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|224585745|ref|YP_002639544.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|62130030|gb|AAX67733.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|224470273|gb|ACN48103.1| UDP-N-acetylglucosamine epimerase (UDP-GlcNAc-2-epimerase)
           [Salmonella enterica subsp. enterica serovar Paratyphi C
           strain RKS4594]
 gi|322716890|gb|EFZ08461.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
          Length = 355

 Score =  417 bits (1073), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 195/339 (57%), Positives = 250/339 (73%), Gaps = 6/339 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R++VTGGAGFIGSA+ R+++++    V+V+DKLTYAGNL SL  ++QS+ F+F +VDICD
Sbjct: 3   RILVTGGAGFIGSAVVRHIIHETADAVVVVDKLTYAGNLMSLASVTQSDRFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
              +    +++QP+++++ AAESHVDRSI G   FI TNI+GT+ LLE  R +WS L  D
Sbjct: 63  WASLERVFQQYQPNSVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWSALDAD 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            K  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 AKAAFRFHHISTDEVYGDLHTADDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V+  
Sbjct: 183 LVTNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYHVVTN 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NERKN+D+V  I  LL+ L P+      ++ +LI F++DRPGHD RYA
Sbjct: 243 GAVGETYNIGGHNERKNLDVVRTICALLEELAPQKPQGVANYHDLITFVDDRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+P+
Sbjct: 303 IDASKIARELGWTPQETFESGMRKTVQWYLANEAWWKPV 341


>gi|288816223|gb|ADC54945.1| RmlB [Escherichia coli]
          Length = 361

 Score =  417 bits (1072), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 198/340 (58%), Positives = 244/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA  R+++N+ +  V+ +DKLTYAGNL SL EIS S  +SF   DIC
Sbjct: 1   MKILVTGGAGFIGSADVRHIINNTQDSVVNVDKLTYAGNLESLAEISDSERYSFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D E +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAEAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSGLDD 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           +KK  FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 EKKKNFRFHHISTDEVYGDLPHPDEVNSNETLPLFTEMTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+VF I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVFTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDADKISRELGWKPQETFESGIRKTVEWYLSNTKW 340


>gi|327478703|gb|AEA82013.1| dTDP-glucose 4,6-dehydratase [Pseudomonas stutzeri DSM 4166]
          Length = 356

 Score =  417 bits (1072), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 201/338 (59%), Positives = 253/338 (74%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSAL R+L+ D +  VL +DKLTYAGNL SL  +  +  + FLQ DI 
Sbjct: 1   MRILVTGGAGFIGSALIRHLILDTEHSVLNLDKLTYAGNLESLAAVEDNPRYQFLQADIA 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DRE +  AL EFQPDAI++ AAESHVDRSI G  EFI TNI+GT+ LLE TR +W  L  
Sbjct: 61  DRERVSEALLEFQPDAIMHLAAESHVDRSIDGPAEFIQTNIVGTYQLLEATRAYWQSLPA 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           ++++ FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 ERREAFRFHHISTDEVYGDLHGVDDLFTETTPYAPSSPYSASKASSDHLVRAWQRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           VL++NCSNNYGPYHFPEKLIPL I   ++G  + +YGDG  +RDWL+VEDH RAL+ V+ 
Sbjct: 181 VLITNCSNNYGPYHFPEKLIPLVILNALDGKPLPVYGDGSQIRDWLFVEDHARALFKVVS 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G++GE YNIGG+NE+KNI++V  I  LL+ L P   +    + +LI F++DRPGHD RY
Sbjct: 241 EGKVGETYNIGGHNEQKNIEVVRGICALLEELAPNKPAGLARYEDLITFVKDRPGHDLRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID+SKI+ E+GW PQE  ++GL KTV WYL+N  W R
Sbjct: 301 AIDASKIERELGWVPQETFQTGLRKTVQWYLNNLEWCR 338


>gi|194434626|ref|ZP_03066882.1| dTDP-glucose 4,6-dehydratase [Shigella dysenteriae 1012]
 gi|194417145|gb|EDX33258.1| dTDP-glucose 4,6-dehydratase [Shigella dysenteriae 1012]
 gi|320178079|gb|EFW53059.1| dTDP-glucose 4,6-dehydratase [Shigella boydii ATCC 9905]
 gi|332084936|gb|EGI90118.1| dTDP-glucose 4,6-dehydratase [Shigella dysenteriae 155-74]
          Length = 355

 Score =  417 bits (1072), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 197/337 (58%), Positives = 244/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS  F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +       QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTAHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNALTED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V   
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+D+V  I  LL+ L P        + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLDVVETICELLEELAPNKPHGVVHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+
Sbjct: 303 IDASKIARELGWLPQETFESGMRKTVQWYLANESWWK 339


>gi|315285652|gb|EFU45094.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 110-3]
 gi|323956211|gb|EGB51962.1| dTDP-glucose 4,6-dehydratase [Escherichia coli H263]
          Length = 361

 Score =  417 bits (1071), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 196/340 (57%), Positives = 244/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL E+S S  +SF   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLAEVSDSERYSFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D E +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAEAMARIFSQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSGLDD 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           +KK  FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 EKKKNFRFHHISTDEVYGDLPHPDEVNNNEALPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDADKISRELGWKPQETFESGIRKTVEWYLANTNW 340


>gi|197251412|ref|YP_002147055.1| dTDP-glucose 4,6 dehydratase [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197215115|gb|ACH52512.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
          Length = 361

 Score =  417 bits (1071), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 250/340 (73%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++++TGGAGFIGSA+ R+++ + +  V+ IDKLTYAGNL SL +IS+SN ++F   DIC
Sbjct: 1   MKILITGGAGFIGSAVVRHIIKNTQDTVVNIDKLTYAGNLESLSDISESNRYNFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   I    +++QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L +
Sbjct: 61  DSAEITRIFEQYQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEVARKYWSALGE 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNNFRFHHISTDEVYGDLPHPDEVENSVTLPLFTETTTYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WRRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKSLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RAL++V+ +G+ GE YNIGG+NE+KN+D+VF I  LLD ++PK+ S+ E I ++ DRPGH
Sbjct: 241 RALHMVVTEGKAGETYNIGGHNEKKNLDVVFTICDLLDEIVPKATSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW P E  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAGKISRELGWKPLETFESGIRKTVEWYLANTQW 340


>gi|16761029|ref|NP_456646.1| dTDP-glucose 4,6 dehydratase [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|29141275|ref|NP_804617.1| dTDP-glucose 4,6 dehydratase [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56412999|ref|YP_150074.1| dTDP-glucose 4,6 dehydratase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|161613223|ref|YP_001587188.1| dTDP-glucose 4,6 dehydratase [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|167551043|ref|ZP_02344798.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|168818214|ref|ZP_02830214.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|197361927|ref|YP_002141564.1| dTDP-glucose 4,6 dehydratase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|198241929|ref|YP_002216184.1| dTDP-glucose 4,6 dehydratase [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|204928949|ref|ZP_03220092.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205353240|ref|YP_002227041.1| dTDP-glucose 4,6 dehydratase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207857533|ref|YP_002244184.1| dTDP-glucose 4,6 dehydratase [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|213023599|ref|ZP_03338046.1| dTDP-glucose 4,6 dehydratase [Salmonella enterica subsp. enterica
           serovar Typhi str. 404ty]
 gi|213052826|ref|ZP_03345704.1| dTDP-glucose 4,6 dehydratase [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213425545|ref|ZP_03358295.1| dTDP-glucose 4,6 dehydratase [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213585955|ref|ZP_03367781.1| dTDP-glucose 4,6 dehydratase [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-0664]
 gi|213650451|ref|ZP_03380504.1| dTDP-glucose 4,6 dehydratase [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|289809523|ref|ZP_06540152.1| dTDP-glucose 4,6 dehydratase [Salmonella enterica subsp. enterica
           serovar Typhi str. AG3]
 gi|289827042|ref|ZP_06545850.1| dTDP-glucose 4,6 dehydratase [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|25292364|pir||AF0767 dTDP-glucose 4,6-dehydratase [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16503327|emb|CAD02460.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29136901|gb|AAO68466.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56127256|gb|AAV76762.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|161362587|gb|ABX66355.1| hypothetical protein SPAB_00933 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|197093404|emb|CAR58859.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|197936445|gb|ACH73778.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|204321493|gb|EDZ06692.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205273021|emb|CAR37969.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205324063|gb|EDZ11902.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205344684|gb|EDZ31448.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|206709336|emb|CAR33676.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|320086529|emb|CBY96300.1| dTDP-glucose 4,6 dehydratase [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
 gi|326623931|gb|EGE30276.1| dTDP-glucose 4,6 dehydratase [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
 gi|326628327|gb|EGE34670.1| dTDP-glucose 4,6 dehydratase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 361

 Score =  417 bits (1071), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 250/340 (73%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++++TGGAGFIGSA+ R+++ + +  V+ IDKLTYAGNL SL +IS+SN ++F   DIC
Sbjct: 1   MKILITGGAGFIGSAVVRHIIKNTQDTVVNIDKLTYAGNLESLSDISESNRYNFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   I    +++QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L +
Sbjct: 61  DSAEITRIFEQYQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEVARKYWSALGE 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNNFRFHHISTDEVYGDLPHPDEVENSVTLPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WRRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RAL++V+ +G+ GE YNIGG+NE+KN+D+VF I  LLD ++PK+ S+ E I ++ DRPGH
Sbjct: 241 RALHMVVTEGKAGETYNIGGHNEKKNLDVVFTICDLLDEIVPKATSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW P E  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAGKISRELGWKPLETFESGIRKTVEWYLANTQW 340


>gi|218556351|ref|YP_002389265.1| dTDP-glucose 4,6-dehydratase [Escherichia coli IAI1]
 gi|218363120|emb|CAR00760.1| dTDP-glucose 4,6-dehydratase [Escherichia coli IAI1]
          Length = 355

 Score =  417 bits (1071), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 197/337 (58%), Positives = 244/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS  F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSEHFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNTLTED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KA SD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKAGSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V   
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+D+V  I  LL+ L P        + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLDVVETICELLEELAPNKPHGVAHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+
Sbjct: 303 IDASKIARELGWLPQETFESGMRKTVQWYLANESWWK 339


>gi|9957829|gb|AAG09509.1|AF279618_1 dTDP-D-glucose-4,6-dehydratase [Salmonella enterica]
          Length = 361

 Score =  417 bits (1071), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 250/340 (73%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++++TGGAGFIGSA+ R+++ + +  V+ IDKLTYAGNL SL +IS+SN ++F   DIC
Sbjct: 1   MKILITGGAGFIGSAVVRHIIKNTQDTVVNIDKLTYAGNLESLSDISESNRYNFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   I    +++QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L +
Sbjct: 61  DSAEITRIFEQYQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEVARKYWSALGE 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNNFRFHHISTDEVYGDLPHPDEVENSVTLPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WRRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RAL++V+ +G+ GE YNIGG+NE+KN+D+VF I  LLD ++PK+ S+ E I ++ DRPGH
Sbjct: 241 RALHMVVTEGKAGETYNIGGHNEKKNLDVVFTICDLLDEIVPKTTSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW P E  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAGKISRELGWKPLETFESGIRKTVEWYLANTQW 340


>gi|194735082|ref|YP_002115186.1| dTDP-glucose 4,6 dehydratase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|194710584|gb|ACF89805.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
          Length = 361

 Score =  417 bits (1071), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 250/340 (73%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++++TGGAGFIGSA+ R+++ + +  V+ IDKLTYAGNL SL +IS+SN ++F   DIC
Sbjct: 1   MKILITGGAGFIGSAVVRHIIKNTQDTVVNIDKLTYAGNLESLSDISESNRYNFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   I    +++QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L +
Sbjct: 61  DSAEITRIFEQYQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEVARKYWSALGE 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVENSVTLPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WRRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RAL++V+ +G+ GE YNIGG+NE+KN+D+VF I  LLD ++PK+ S+ E I ++ DRPGH
Sbjct: 241 RALHMVVTEGKAGETYNIGGHNEKKNLDVVFTICDLLDEIVPKATSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW P E  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAGKISRELGWKPLETFESGIRKTVEWYLANTQW 340


>gi|282801701|gb|ADB02811.1| RmlB [Escherichia coli]
          Length = 361

 Score =  416 bits (1070), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 245/340 (72%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F+  DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFVHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNKEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKKLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYCEQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKIGRELGWKPQETFESGIRKTVEWYLSNTKW 340


>gi|283787530|ref|YP_003367395.1| dTDP-glucose 4,6-dehydratase [Citrobacter rodentium ICC168]
 gi|282950984|emb|CBG90661.1| dTDP-glucose 4,6-dehydratase [Citrobacter rodentium ICC168]
          Length = 355

 Score =  416 bits (1070), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 195/339 (57%), Positives = 248/339 (73%), Gaps = 6/339 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R+++TGGAGFIGSA+ RY++N+     +V+DKLTYAGNL SL  ++QS+ F+F +VDICD
Sbjct: 3   RILITGGAGFIGSAVARYIINETADAAVVVDKLTYAGNLMSLAPVAQSDRFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +    + +QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W  L+ D
Sbjct: 63  RAAVDRVFQHYQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWHALAAD 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKAAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALYLV   
Sbjct: 183 LVTNCSNNYGPYHFPEKLIPLTILNALAGKPLPVYGNGQQIRDWLYVEDHARALYLVATA 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G +GE +NIGG+NERKN+ +V  I  LL+ L P+       + +LI F++DRPGHD RYA
Sbjct: 243 GTVGETWNIGGHNERKNLMVVETICDLLEELAPEKPQGIAHYRDLIAFVDDRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           ID+SKI  E+GW P+E+ ESG+ KTV WYL N  WW+P+
Sbjct: 303 IDASKIARELGWTPRESFESGMRKTVQWYLANEAWWKPV 341


>gi|323968175|gb|EGB63584.1| dTDP-glucose 4,6-dehydratase [Escherichia coli M863]
 gi|327253173|gb|EGE64827.1| dTDP-glucose 4,6-dehydratase [Escherichia coli STEC_7v]
          Length = 361

 Score =  416 bits (1070), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 196/340 (57%), Positives = 243/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL EIS S  +SF   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLAEISDSERYSFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFSQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSGLDD 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           +KK  FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 EKKKNFRFHHISTDEVYGDLPHPDEVNSNETLPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKISRELGWKPQETFESGIRKTVEWYLSNTKW 340


>gi|323135556|ref|ZP_08070639.1| dTDP-glucose 4,6-dehydratase [Methylocystis sp. ATCC 49242]
 gi|322398647|gb|EFY01166.1| dTDP-glucose 4,6-dehydratase [Methylocystis sp. ATCC 49242]
          Length = 348

 Score =  416 bits (1070), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/335 (57%), Positives = 246/335 (73%), Gaps = 1/335 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR+++TGGAGFIGSA+ R  ++     +LV+DKLTYAGNL SLK +++   FSFLQ DIC
Sbjct: 1   MRVMITGGAGFIGSAVSRAFIHSSDDHILVLDKLTYAGNLASLKPVAEDPRFSFLQADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +  A  EFQPD +++ AAESHVDRSI G   FI TN++GTF++LE    +W  L  
Sbjct: 61  DRAAVGRAYSEFQPDVVMHLAAESHVDRSIDGPAAFIETNLVGTFVMLEAALEYWRALPA 120

Query: 121 DKKDQFRFLQISTDEVYGSLDK-GLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           D+   FRF  ISTDEV+GSL   GLF ED PY P+SPYSA+KA SD+LV AW HTYG+P 
Sbjct: 121 DRARNFRFQHISTDEVFGSLGADGLFREDTPYAPTSPYSASKAGSDHLVRAWRHTYGLPT 180

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I   IEG  + +YG G+NVRDWLYVEDH  AL LV ++
Sbjct: 181 IVTNCSNNYGPYHFPEKLIPLMIINAIEGKPLPVYGRGENVRDWLYVEDHAAALMLVARE 240

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSS 299
           G +G+ YN+GG NE +NID+V  I  L++   P++  + +LI F+ DRPGHD RYAIDSS
Sbjct: 241 GVVGDSYNVGGRNEWRNIDVVHAICDLMNEFRPRAGGYRDLITFVNDRPGHDLRYAIDSS 300

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           KI+ ++GW P E  E+GL KTV WYLDN  WW+ +
Sbjct: 301 KIERDLGWKPAERFETGLRKTVQWYLDNQEWWQAI 335


>gi|82777431|ref|YP_403780.1| dTDP-glucose 4,6 dehydratase [Shigella dysenteriae Sd197]
 gi|50982496|gb|AAT91850.1| dTDP-D-glucose 4,6-dehydratase [Shigella dysenteriae]
 gi|81241579|gb|ABB62289.1| dTDP-glucose 4,6 dehydratase [Shigella dysenteriae Sd197]
          Length = 361

 Score =  416 bits (1070), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 244/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSKRYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDG 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNKEQLPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY+V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYIVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKISRELGWKPQETFESGIRKTVGWYLSNTKW 340


>gi|9957815|gb|AAG09498.1|AF279615_1 dTDP-D-glucose-4,6-dehydratase [Salmonella enterica]
 gi|9957820|gb|AAG09502.1|AF279616_1 dTDP-D-glucose-4,6-dehydratase [Salmonella enterica]
          Length = 361

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 250/340 (73%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++++TGGAGFIGSA+ R+++ + +  V+ IDKLTYAGNL SL +IS+SN ++F   DIC
Sbjct: 1   MQILITGGAGFIGSAVVRHIIKNTQDTVVNIDKLTYAGNLESLSDISESNRYNFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   I    +++QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L +
Sbjct: 61  DSAEITRIFEQYQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEVARKYWSALGE 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNNFRFHHISTDEVYGDLPHPDEVENSVTLPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WRRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RAL++V+ +G+ GE YNIGG+NE+KN+D+VF I  LLD ++PK+ S+ E I ++ DRPGH
Sbjct: 241 RALHMVVTEGKAGETYNIGGHNEKKNLDVVFTICDLLDEIVPKATSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW P E  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAGKISRELGWKPLETFESGIRKTVEWYLANTQW 340


>gi|170019633|ref|YP_001724587.1| dTDP-glucose 4,6 dehydratase [Escherichia coli ATCC 8739]
 gi|169754561|gb|ACA77260.1| dTDP-glucose 4,6-dehydratase [Escherichia coli ATCC 8739]
          Length = 361

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 244/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNKEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEQSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKISRELGWKPQETFESGIRKTVEWYLSNTKW 340


>gi|260856024|ref|YP_003229915.1| putative dTDP-glucose 4,6-dehydratase [Escherichia coli O26:H11
           str. 11368]
 gi|24417730|gb|AAN60454.1| dTDP-glucose 4,6-dehydratase [Escherichia coli]
 gi|56800696|gb|AAW31110.1| dTDP-glucose 4,6-dehydratase [Escherichia coli]
 gi|77737729|gb|ABB01681.1| dTDP-glucose 4,6-dehydratase [Escherichia coli]
 gi|257754673|dbj|BAI26175.1| predicted dTDP-glucose 4,6-dehydratase [Escherichia coli O26:H11
           str. 11368]
 gi|323152431|gb|EFZ38719.1| dTDP-glucose 4,6-dehydratase [Escherichia coli EPECa14]
          Length = 361

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 244/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNTEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEQSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKISRELGWKPQETFESGIRKTVEWYLSNTKW 340


>gi|9957850|gb|AAG09526.1|AF279622_1 dTDP-D-glucose-4,6-dehydratase [Salmonella enterica]
          Length = 361

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 195/340 (57%), Positives = 250/340 (73%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++++TGGAGFIGSA+ R+++ + +  V+ IDKLTYAGNL SL +IS+SN ++F   DIC
Sbjct: 1   MKILITGGAGFIGSAVVRHIIKNTQDTVVNIDKLTYAGNLESLCDISKSNRYNFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   I    +++QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L +
Sbjct: 61  DSAEITRIFEQYQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEVARKYWSALGE 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVGNSVTLPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WRRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKSLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY+V+ +G+ GE YNIGG+NE+KN+D+VF I  LLD ++PK+ S+ E I ++ DRPGH
Sbjct: 241 RALYIVVTEGKAGETYNIGGHNEKKNLDVVFTICDLLDEIVPKATSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW P E  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDADKISRELGWKPLETFESGIRKTVEWYLANTKW 340


>gi|315461754|emb|CBN82193.1| dTDP-glucose 4,6 dehydratase [Escherichia coli]
          Length = 361

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 195/340 (57%), Positives = 244/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDG 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNKEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY VL +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVLTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKISRELGWKPQETFESGIRKTVEWYLANTKW 340


>gi|256017786|ref|ZP_05431651.1| dTDP-glucose 4,6 dehydratase [Shigella sp. D9]
 gi|332278807|ref|ZP_08391220.1| dTDP-D-glucose 4,6-dehydratase [Shigella sp. D9]
 gi|332101159|gb|EGJ04505.1| dTDP-D-glucose 4,6-dehydratase [Shigella sp. D9]
          Length = 361

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 244/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNKEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEQSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKISRELGWKPQETFESGIRKTVEWYLSNTKW 340


>gi|209981002|gb|ACJ05178.1| dTDP-glucose 4,6 dehydratase [Salmonella enterica subsp. enterica
           serovar Pomona]
          Length = 357

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 193/342 (56%), Positives = 252/342 (73%), Gaps = 10/342 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++++TGGAGFIGSA+ R+++ + +  V+ IDKLTYAGNL SL +IS+SN ++F   DIC
Sbjct: 1   MKILITGGAGFIGSAVVRHIIKNTQDTVVNIDKLTYAGNLESLSDISESNRYNFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   I    +++QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L +
Sbjct: 61  DSAEITRIFEQYQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEVARKYWSALGE 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNNFRFHHISTDEVYGDLPHPDEVENSVTLPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WRRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RAL++V+ +G+ GE YNIGG+NE+KN+D+VF I  LLD ++PK+ S+ E I ++ DRPGH
Sbjct: 241 RALHMVVTEGKAGETYNIGGHNEKKNLDVVFTICDLLDEIVPKATSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           DRRYAI++ KI  E+ W PQE  ESG+ KT+ WYL+N  W R
Sbjct: 301 DRRYAINADKISRELDWKPQETFESGIRKTIEWYLNNTEWCR 342


>gi|110644114|ref|YP_671844.1| dTDP-glucose 4,6-dehydratase [Escherichia coli 536]
 gi|191174427|ref|ZP_03035929.1| dTDP-glucose 4,6-dehydratase [Escherichia coli F11]
 gi|300979317|ref|ZP_07174501.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 200-1]
 gi|110345706|gb|ABG71943.1| dTDP-glucose 4,6-dehydratase [Escherichia coli 536]
 gi|190905282|gb|EDV64919.1| dTDP-glucose 4,6-dehydratase [Escherichia coli F11]
 gi|300308070|gb|EFJ62590.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 200-1]
 gi|324014734|gb|EGB83953.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 60-1]
          Length = 355

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 197/337 (58%), Positives = 245/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS  F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E+QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEYQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNVLTED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V   
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+D+V  I  LL+ L P        + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLDVVETICELLEELAPNKPHGVAHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  W +
Sbjct: 303 IDASKIARELGWLPQETFESGMRKTVQWYLANESWCK 339


>gi|325499241|gb|EGC97100.1| dTDP-glucose 4,6-dehydratase [Escherichia fergusonii ECD227]
          Length = 355

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 197/337 (58%), Positives = 246/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS+ F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETNDAVVVVDKLTYAGNLMSLAPVAQSDRFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E QPD I++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+  ++D
Sbjct: 63  RAELARIFTEHQPDCIMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNAQAED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V+  
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVVTT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+++V  I  LL+ L P        + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLEVVETICELLEELAPNKPHGVAHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+
Sbjct: 303 IDASKIARELGWLPQETFESGMRKTVQWYLANESWWK 339


>gi|9957839|gb|AAG09517.1|AF279620_1 dTDP-D-glucose-4,6-dehydratase [Salmonella enterica]
          Length = 361

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 250/340 (73%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++++TGGAGFIGSA+ R+++ + +  V+ IDKLTYAGNL SL +IS+SN ++F   DIC
Sbjct: 1   MKILITGGAGFIGSAVIRHIIKNTQDTVVNIDKLTYAGNLESLSDISESNRYNFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   I    +++QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L +
Sbjct: 61  DSAEITRIFEQYQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEVARKYWSALGE 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVENSVTLPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVED+ 
Sbjct: 181 WRRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPIYGKGDQIRDWLYVEDYA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY+V+ +G+ GE YNIGG+NE+KN+D+VF I  LLD ++PK+ S+ E I ++ DRPGH
Sbjct: 241 RALYIVVTEGKAGETYNIGGHNEKKNVDVVFTICDLLDEIVPKAASYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW P E  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAGKISRELGWKPLETFESGIRKTVEWYLANTQW 340


>gi|16611766|gb|AAL27347.1|AF402315_2 dTDP-D-glucose 4,6-dehydratase [Shigella boydii]
          Length = 361

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 244/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNTEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALSIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKIGRELGWKPQETFESGIRKTVEWYLSNTKW 340


>gi|71044435|gb|AAZ20755.1| dTDP-D-glucose 4,6-dehydratase [Escherichia coli]
 gi|324019197|gb|EGB88416.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 117-3]
          Length = 358

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 195/342 (57%), Positives = 247/342 (72%), Gaps = 10/342 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DTAAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDG 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNTEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL+N+ W R
Sbjct: 301 DRRYAIDAEKIGRELGWKPQETFESGIRKTVEWYLNNSDWCR 342


>gi|301021422|ref|ZP_07185446.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 69-1]
 gi|300398058|gb|EFJ81596.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 69-1]
          Length = 355

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 197/337 (58%), Positives = 244/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS  F+F +VDIC 
Sbjct: 3   KILITGGAGFIGSALVRYIINETSDAVIVVDKLTYAGNLMSLAPVAQSERFAFEKVDICG 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARTYWNALTED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V   
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+D+V  I  LL+ L P        + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLDVVETICELLEELAPNKPHGVAHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+
Sbjct: 303 IDASKIVHELGWLPQETFESGMRKTVQWYLANESWWK 339


>gi|24115082|ref|NP_709592.1| dTDP-glucose 4,6-dehydratase [Shigella flexneri 2a str. 301]
 gi|30064917|ref|NP_839088.1| dTDP-glucose 4,6-dehydratase [Shigella flexneri 2a str. 2457T]
 gi|24054348|gb|AAN45299.1| dTDP-glucose 4,6-dehydratase [Shigella flexneri 2a str. 301]
 gi|30043178|gb|AAP18899.1| dTDP-glucose 4,6-dehydratase [Shigella flexneri 2a str. 2457T]
 gi|313647767|gb|EFS12214.1| dTDP-glucose 4,6-dehydratase [Shigella flexneri 2a str. 2457T]
 gi|332751076|gb|EGJ81480.1| dTDP-glucose 4,6-dehydratase [Shigella flexneri K-671]
 gi|333013595|gb|EGK32962.1| dTDP-glucose 4,6-dehydratase [Shigella flexneri K-304]
          Length = 355

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 198/337 (58%), Positives = 246/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS  F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNTLTED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V   
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALI---PKSYS-HTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+D+V  I  LL+ L    P   + + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLDVVETICELLEELASNKPHGVAYYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+
Sbjct: 303 IDASKIARELGWLPQETFESGMRKTVQWYLANESWWK 339


>gi|160863305|gb|ABX51872.1| dTDP-D-glucose-4,6-dehydratase [Cronobacter sakazakii]
          Length = 359

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 248/340 (72%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N  + +V+ +DKLTYAGN  S+  ++ S  ++F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINHTQDRVVNLDKLTYAGNPESVASVANSERYAFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +    KE QPDA+++ AAESHVDRSI G  +FI TNI+GT+ LLE  R +WS L +
Sbjct: 61  DRAALDRVFKEHQPDAVMHLAAESHVDRSISGPADFIETNIVGTYTLLEAARAYWSSLDE 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           ++K  FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 ERKAAFRFHHISTDEVYGDLPHPDEWHESAALPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WLRTYGLPTMVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+IGE YNIGG+NE+KN+D+V  I  LLD + PK+ S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTQGQIGETYNIGGHNEKKNLDVVLTICDLLDEIKPKATSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL+N  W
Sbjct: 301 DRRYAIDADKISRELGWRPQETFESGIRKTVHWYLNNEEW 340


>gi|320197600|gb|EFW72212.1| dTDP-glucose 4,6-dehydratase [Escherichia coli WV_060327]
          Length = 355

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 196/337 (58%), Positives = 245/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS  F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E+QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEYQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWTALTED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +R+WLYVEDH RALY V   
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIREWLYVEDHARALYCVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+D+V  I  LL+ L P        + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLDVVETICELLEELAPNKPHGVAHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  W +
Sbjct: 303 IDASKIARELGWLPQETFESGMRKTVQWYLANESWCK 339


>gi|307340768|gb|ADN43831.1| RmlB [Escherichia coli]
          Length = 361

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 193/340 (56%), Positives = 244/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   D+C
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADVC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAVMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNKEQLPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY+V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYIVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKISRELGWKPQETFESGIRKTVEWYLSNTKW 340


>gi|187880615|gb|ACD37121.1| RmlB [Shigella boydii]
          Length = 361

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 244/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDG 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNKEQLPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY+V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYIVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKISRELGWKPQETFESGIRKTVEWYLSNTKW 340


>gi|197263888|ref|ZP_03163962.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197242143|gb|EDY24763.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
          Length = 361

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 249/340 (73%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++++TGGAGFIGSA+ R+++ + +  V+ IDKLTYAGNL SL +IS+SN ++F   DIC
Sbjct: 1   MKILITGGAGFIGSAVVRHIIKNTQDTVINIDKLTYAGNLESLSDISESNRYNFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   I    +++QPDA+++ AAESHVDRSI G   FI TNI+GT+ LLE  R +WS L +
Sbjct: 61  DSAEITRIFEQYQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYALLEVARKYWSALGE 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNNFRFHHISTDEVYGDLPHPDEVENSVTLPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WRRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RAL++V+ +G+ GE YNIGG+NE+KN+D+VF I  LLD ++PK+ S+ E I ++ DRPGH
Sbjct: 241 RALHMVVTEGKAGETYNIGGHNEKKNLDVVFTICDLLDEIVPKATSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW P E  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAGKISRELGWKPLETFESGIRKTVEWYLANTQW 340


>gi|168481292|gb|ACA24782.1| RmlB [Shigella dysenteriae]
          Length = 361

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 244/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSKRYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDG 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNKEQLPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG++KTV WYL N  W
Sbjct: 301 DRRYAIDAEKISRELGWKPQETFESGIHKTVEWYLSNTKW 340


>gi|16765427|ref|NP_461042.1| dTDP-glucose 4,6 dehydratase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|167991012|ref|ZP_02572111.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|168242170|ref|ZP_02667102.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|168466245|ref|ZP_02700115.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|194443120|ref|YP_002041367.1| dTDP-glucose 4,6 dehydratase [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194449636|ref|YP_002046147.1| dTDP-glucose 4,6 dehydratase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|132499|sp|P26391|RFBB_SALTY RecName: Full=dTDP-glucose 4,6-dehydratase
 gi|13786955|pdb|1G1A|A Chain A, The Crystal Structure Of Dtdp-D-Glucose 4,6-Dehydratase
           (Rmlb)from Salmonella Enterica Serovar Typhimurium
 gi|13786956|pdb|1G1A|B Chain B, The Crystal Structure Of Dtdp-D-Glucose 4,6-Dehydratase
           (Rmlb)from Salmonella Enterica Serovar Typhimurium
 gi|13786957|pdb|1G1A|C Chain C, The Crystal Structure Of Dtdp-D-Glucose 4,6-Dehydratase
           (Rmlb)from Salmonella Enterica Serovar Typhimurium
 gi|13786958|pdb|1G1A|D Chain D, The Crystal Structure Of Dtdp-D-Glucose 4,6-Dehydratase
           (Rmlb)from Salmonella Enterica Serovar Typhimurium
 gi|18655661|pdb|1KEU|A Chain A, The Crystal Structure Of Dtdp-D-Glucose 4,6-Dehydratase
           (Rmlb) From Salmonella Enterica Serovar Typhimurium With
           Dtdp-D-Glucose Bound
 gi|18655662|pdb|1KEU|B Chain B, The Crystal Structure Of Dtdp-D-Glucose 4,6-Dehydratase
           (Rmlb) From Salmonella Enterica Serovar Typhimurium With
           Dtdp-D-Glucose Bound
 gi|18655663|pdb|1KEW|A Chain A, The Crystal Structure Of Dtdp-D-Glucose 4,6-Dehydratase
           (Rmlb) From Salmonella Enterica Serovar Typhimurium With
           Thymidine Diphosphate Bound
 gi|18655664|pdb|1KEW|B Chain B, The Crystal Structure Of Dtdp-D-Glucose 4,6-Dehydratase
           (Rmlb) From Salmonella Enterica Serovar Typhimurium With
           Thymidine Diphosphate Bound
 gi|581654|emb|CAA40115.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica]
 gi|16420629|gb|AAL21001.1| dTDP-glucose 4,6 dehydratase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|194401783|gb|ACF62005.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194407940|gb|ACF68159.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|195631509|gb|EDX50069.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|205330442|gb|EDZ17206.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205338665|gb|EDZ25429.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|261247312|emb|CBG25137.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267994151|gb|ACY89036.1| dTDP-glucose 4,6 dehydratase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301158658|emb|CBW18170.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|321224745|gb|EFX49808.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|323130420|gb|ADX17850.1| dTDP-glucose 4,6 dehydratase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|332989032|gb|AEF08015.1| dTDP-glucose 4,6 dehydratase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 361

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 249/340 (73%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++++TGGAGFIGSA+ R+++ + +  V+ IDKLTYAGNL SL +IS+SN ++F   DIC
Sbjct: 1   MKILITGGAGFIGSAVVRHIIKNTQDTVVNIDKLTYAGNLESLSDISESNRYNFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   I    +++QPDA+++ AAESHVDRSI G   FI TNI+GT+ LLE  R +WS L +
Sbjct: 61  DSAEITRIFEQYQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYALLEVARKYWSALGE 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNNFRFHHISTDEVYGDLPHPDEVENSVTLPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WRRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RAL++V+ +G+ GE YNIGG+NE+KN+D+VF I  LLD ++PK+ S+ E I ++ DRPGH
Sbjct: 241 RALHMVVTEGKAGETYNIGGHNEKKNLDVVFTICDLLDEIVPKATSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW P E  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAGKISRELGWKPLETFESGIRKTVEWYLANTQW 340


>gi|45644917|gb|AAS73163.1| putative dTDP-glucose 4,6-dehydratase [Escherichia coli]
          Length = 358

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 195/342 (57%), Positives = 247/342 (72%), Gaps = 10/342 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DSVAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDG 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNTEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKGLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           DRRYAID+ KI  E+GW PQE  ESG+ KT+ WYL+NN W R
Sbjct: 301 DRRYAIDAEKIGRELGWKPQETFESGIRKTINWYLNNNDWCR 342


>gi|205354508|ref|YP_002228309.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205274289|emb|CAR39310.1| UDP-N-acetylglucosamine epimerase (UDP-GlcNAc-2-epimerase)
           [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 287/91]
 gi|326629642|gb|EGE35985.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 355

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/339 (57%), Positives = 249/339 (73%), Gaps = 6/339 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R++VTGGAGFIGS++ R+++++    V+V+DKLTYAGNL SL  ++Q + F+F +VDICD
Sbjct: 3   RILVTGGAGFIGSSVVRHIIHETADAVVVVDKLTYAGNLMSLASVAQIDRFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +    +++QPD++++ AAESHVDRSI G   FI TNI+GT+ LLE  R +WS L  D
Sbjct: 63  RASLERVFQQYQPDSVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWSALDAD 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            K  FRF  ISTDEVYG L      F+E   Y PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 AKAAFRFHHISTDEVYGDLHTADDFFTETTLYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V+  
Sbjct: 183 LVTNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYHVVTN 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NERKN+D+V  I  LL+ L P+      ++ +LI F++DRPGHD RYA
Sbjct: 243 GAVGETYNIGGHNERKNLDVVRTICALLEELAPQKPQGVANYHDLITFVDDRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+P+
Sbjct: 303 IDASKIARELGWTPQETFESGMRKTVQWYLANEAWWKPV 341


>gi|62955957|gb|AAY23333.1| RmlB [Shigella boydii]
 gi|115503058|gb|ABI98981.1| RmlB [Escherichia coli]
          Length = 361

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 243/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK  FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKTSFRFHHISTDEVYGDLPHPDEVNNTEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKISRELGWKPQETFESGIRKTVEWYLSNTKW 340


>gi|323948399|gb|EGB44383.1| dTDP-glucose 4,6-dehydratase [Escherichia coli H120]
 gi|324119070|gb|EGC12959.1| dTDP-glucose 4,6-dehydratase [Escherichia coli E1167]
          Length = 361

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 244/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAVMARVFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDG 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNTEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKTLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKISRELGWKPQETFESGIRKTVEWYLSNTKW 340


>gi|312913088|dbj|BAJ37062.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
          Length = 354

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 249/340 (73%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++++TGGAGFIGSA+ R+++ + +  V+ IDKLTYAGNL SL +IS+SN ++F   DIC
Sbjct: 1   MKILITGGAGFIGSAVVRHIIKNTQDTVVNIDKLTYAGNLESLSDISESNRYNFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   I    +++QPDA+++ AAESHVDRSI G   FI TNI+GT+ LLE  R +WS L +
Sbjct: 61  DSAEITRIFEQYQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYALLEVARKYWSALGE 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNNFRFHHISTDEVYGDLPHPDEVENSVTLPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WRRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RAL++V+ +G+ GE YNIGG+NE+KN+D+VF I  LLD ++PK+ S+ E I ++ DRPGH
Sbjct: 241 RALHMVVTEGKAGETYNIGGHNEKKNLDVVFTICDLLDEIVPKATSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW P E  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAGKISRELGWKPLETFESGIRKTVEWYLANTQW 340


>gi|293393871|ref|ZP_06638178.1| dTDP-glucose 4,6-dehydratase [Serratia odorifera DSM 4582]
 gi|291423698|gb|EFE96920.1| dTDP-glucose 4,6-dehydratase [Serratia odorifera DSM 4582]
          Length = 357

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 196/337 (58%), Positives = 243/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R++VTGGAGFIGSA+ R++++     V+V+DKLTYAGNL SL   + S  ++F QVDICD
Sbjct: 5   RILVTGGAGFIGSAVVRHIIDATADSVVVVDKLTYAGNLESLAPAAASERYAFEQVDICD 64

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     ++QPDA+++ AAESHVDRSI G   FI TN++GT+ LLE  R +W  L+  
Sbjct: 65  RAALDRVFAQYQPDAVMHLAAESHVDRSIDGPAAFIETNVVGTYTLLEAARHYWQQLATP 124

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           ++  FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 125 RQQDFRFHHISTDEVYGDLHGTDDLFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 184

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   I G  + +YGDG  VRDWLYVEDH RALYLV   
Sbjct: 185 LITNCSNNYGPYHFPEKLIPLVILNAISGKPLPVYGDGAQVRDWLYVEDHARALYLVATT 244

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKNID+V  I  LL+ L P        + +LI +++DRPGHD RYA
Sbjct: 245 GKVGETYNIGGHNERKNIDVVQTICDLLEQLAPSKPQGVAQYRDLITYVKDRPGHDMRYA 304

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+ KI+ E+GW PQE  ESG+ KTV WYL N  WWR
Sbjct: 305 IDAGKIERELGWRPQETFESGIRKTVAWYLANETWWR 341


>gi|325497859|gb|EGC95718.1| dTDP-glucose 4,6 dehydratase [Escherichia fergusonii ECD227]
          Length = 361

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 244/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHSDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNKEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEQSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKISRELGWKPQETFESGIRKTVEWYLSNTKW 340


>gi|332751902|gb|EGJ82297.1| dTDP-glucose 4,6-dehydratase [Shigella flexneri 2747-71]
 gi|332764370|gb|EGJ94605.1| dTDP-glucose 4,6-dehydratase [Shigella flexneri 2930-71]
          Length = 355

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 197/337 (58%), Positives = 244/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS  F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNTLTED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V   
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+D+V  I  LL+ L          + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLDVVETICELLEELASNKLHGVAYYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+
Sbjct: 303 IDASKIARELGWLPQETFESGMRKTVQWYLANESWWK 339


>gi|298485664|ref|ZP_07003743.1| dTDP-glucose 4,6-dehydratase [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|298159690|gb|EFI00732.1| dTDP-glucose 4,6-dehydratase [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
          Length = 357

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 198/334 (59%), Positives = 249/334 (74%), Gaps = 4/334 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ +    V+ +DKLTYAGNL SL+   QS  ++F  VDIC
Sbjct: 1   MKILVTGGAGFIGSAVIRHIIANTADSVVNVDKLTYAGNLESLQSADQSERYAFEHVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +RE +    KE QPDA+++ AAESHVDRSI G  EFI TNIIGT++LLE  R +WS L +
Sbjct: 61  NREDLDRVFKEHQPDAVMHLAAESHVDRSITGPSEFIQTNIIGTYVLLEAARSYWSQLDE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K  FRF  ISTDEVYG L+  + LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 VRKASFRFHHISTDEVYGDLEGPEDLFTETTPYQPSSPYSASKASSDHLVRAWSRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            L++NCSNNYGP HFPEKLIPL I   +EG  + +YG G  VRDWLYVEDH RALY V+ 
Sbjct: 181 TLVTNCSNNYGPCHFPEKLIPLIILNALEGKPLPIYGKGDQVRDWLYVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY--SHTELIRFIEDRPGHDRRYAI 296
           +G IGE YNIGG+NE++NI++V  +  LLD L P S    H  LI +++DRPGHD RYAI
Sbjct: 241 EGEIGETYNIGGHNEKQNIEVVNTVCALLDQLRPDSVHRPHASLITYVQDRPGHDLRYAI 300

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           D+SKI+ E+GW P+E+ ESG+ KTV WYLDN  W
Sbjct: 301 DASKIQRELGWTPEESFESGIRKTVQWYLDNPEW 334


>gi|6729762|pdb|1BXK|A Chain A, Dtdp-Glucose 4,6-Dehydratase From E. Coli
 gi|6729763|pdb|1BXK|B Chain B, Dtdp-Glucose 4,6-Dehydratase From E. Coli
          Length = 355

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 197/337 (58%), Positives = 244/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS  F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNALTED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V   
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKSLPVYGNGQQIRDWLYVEDHARALYCVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+D+V  I  LL+ L P        + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLDVVETICELLEELAPNKPHGVAHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+G  PQE  ESG+ KTV WYL N  WW+
Sbjct: 303 IDASKIARELGCVPQETFESGMRKTVQWYLANESWWK 339


>gi|330988615|gb|EGH86718.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. lachrymans
           str. M301315]
          Length = 357

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 198/334 (59%), Positives = 249/334 (74%), Gaps = 4/334 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ +    V+ +DKLTYAGNL SL+   QS  ++F  VDIC
Sbjct: 1   MKILVTGGAGFIGSAVIRHIIANTTDSVVNVDKLTYAGNLESLQSADQSERYAFEHVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +RE +    KE QPDA+++ AAESHVDRSI G  EFI TNIIGT++LLE  R +WS L +
Sbjct: 61  NREDLDRVFKEHQPDAVMHLAAESHVDRSITGPSEFIQTNIIGTYVLLEAARSYWSQLDE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K  FRF  ISTDEVYG L+  + LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 VRKASFRFHHISTDEVYGDLEGPEDLFTETTPYQPSSPYSASKASSDHLVRAWSRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            L++NCSNNYGP HFPEKLIPL I   +EG  + +YG G  VRDWLYVEDH RALY V+ 
Sbjct: 181 TLVTNCSNNYGPCHFPEKLIPLIILNALEGKPLPIYGKGDQVRDWLYVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY--SHTELIRFIEDRPGHDRRYAI 296
           +G IGE YNIGG+NE++NI++V  +  LLD L P S    H  LI +++DRPGHD RYAI
Sbjct: 241 EGEIGETYNIGGHNEKQNIEVVNTVCALLDQLRPDSAHRPHASLITYVQDRPGHDLRYAI 300

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           D+SKI+ E+GW P+E+ ESG+ KTV WYLDN  W
Sbjct: 301 DASKIQRELGWVPEESFESGIRKTVEWYLDNPEW 334


>gi|203285008|gb|ACH97127.1| RmlB [Escherichia coli]
          Length = 361

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 244/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYIFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNNEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKISRELGWKPQETFESGIRKTVEWYLSNTKW 340


>gi|156933365|ref|YP_001437281.1| dTDP-glucose 4,6 dehydratase [Cronobacter sakazakii ATCC BAA-894]
 gi|156531619|gb|ABU76445.1| hypothetical protein ESA_01178 [Cronobacter sakazakii ATCC BAA-894]
          Length = 359

 Score =  415 bits (1066), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 247/340 (72%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N  + +V+ +DKLTYAGN  S+  ++ S  ++F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINHTQDRVVNLDKLTYAGNPESVASVANSERYAFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +    KE QPDA+++ AAESHVDRSI G  +FI TNI+GT+ LLE  R +WS L +
Sbjct: 61  DRAALDRVFKEHQPDAVMHLAAESHVDRSISGPADFIETNIVGTYTLLEAARAYWSSLDE 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
            +K  FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 QRKAAFRFHHISTDEVYGDLPHPDEWHESAALPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WLRTYGLPTMVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+IGE YNIGG+NE+KN+D+V  I  LLD + PK+ S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTQGQIGETYNIGGHNEKKNLDVVLTICDLLDEIKPKATSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL+N  W
Sbjct: 301 DRRYAIDADKISRELGWRPQETFESGIRKTVYWYLNNEEW 340


>gi|294491352|gb|ADE90108.1| dTDP-glucose 4,6-dehydratase [Escherichia coli IHE3034]
          Length = 361

 Score =  415 bits (1066), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 195/340 (57%), Positives = 243/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ND +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINDTQDSVVNVDKLTYAGNLESLADVSDSERYFFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARVFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDG 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNKEGLPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKGLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKIGRELGWKPQETFESGIRKTVEWYLSNTKW 340


>gi|237799718|ref|ZP_04588179.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. oryzae str.
           1_6]
 gi|331022573|gb|EGI02630.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. oryzae str.
           1_6]
          Length = 357

 Score =  415 bits (1066), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 197/334 (58%), Positives = 249/334 (74%), Gaps = 4/334 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ +    V+ +DKLTYAGNL SL+   QS  ++F  VDIC
Sbjct: 1   MKILVTGGAGFIGSAVIRHIIANTTDSVVNVDKLTYAGNLESLQSADQSERYAFEHVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +RE +    KE QPDA+++ AAESHVDRSI G  EFI TNIIGT++LLE  R +WS L +
Sbjct: 61  NREDLDRVFKEHQPDAVMHLAAESHVDRSITGPSEFIQTNIIGTYVLLEAARGYWSQLDE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K  FRF  ISTDEVYG L+  + LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 ARKANFRFHHISTDEVYGDLEGPEDLFTETTPYQPSSPYSASKASSDHLVRAWSRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            L++NCSNNYGP HFPEKLIPL I   +EG  + +YG G  VRDWLYVEDH RALY V+ 
Sbjct: 181 TLVTNCSNNYGPCHFPEKLIPLIILNALEGKPLPIYGKGDQVRDWLYVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY--SHTELIRFIEDRPGHDRRYAI 296
           +G IGE YNIGG+NE++NI++V  +  LLD + P S    H  LI +++DRPGHD RYAI
Sbjct: 241 EGEIGETYNIGGHNEKQNIEVVNTVCALLDQMRPDSAHRPHASLITYVQDRPGHDLRYAI 300

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           D+SKI+ E+GW P+E+ ESG+ KTV WYLDN  W
Sbjct: 301 DASKIQRELGWVPEESFESGIRKTVQWYLDNPEW 334


>gi|115503045|gb|ABI98969.1| RmlB [Escherichia coli]
          Length = 361

 Score =  415 bits (1066), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 244/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNTEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDADKIGRELGWKPQETFESGIRKTVEWYLSNTKW 340


>gi|15833975|ref|NP_312748.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O157:H7 str. Sakai]
 gi|168751746|ref|ZP_02776768.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O157:H7 str. EC4113]
 gi|168753682|ref|ZP_02778689.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O157:H7 str. EC4401]
 gi|168764134|ref|ZP_02789141.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O157:H7 str. EC4501]
 gi|168768066|ref|ZP_02793073.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O157:H7 str. EC4486]
 gi|168775664|ref|ZP_02800671.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O157:H7 str. EC4196]
 gi|168780684|ref|ZP_02805691.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O157:H7 str. EC4076]
 gi|168786623|ref|ZP_02811630.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O157:H7 str. EC869]
 gi|168801005|ref|ZP_02826012.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O157:H7 str. EC508]
 gi|195938077|ref|ZP_03083459.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O157:H7 str. EC4024]
 gi|208805689|ref|ZP_03248026.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O157:H7 str. EC4206]
 gi|208813029|ref|ZP_03254358.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O157:H7 str. EC4045]
 gi|208818281|ref|ZP_03258601.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O157:H7 str. EC4042]
 gi|209399629|ref|YP_002273306.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O157:H7 str. EC4115]
 gi|217325882|ref|ZP_03441966.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O157:H7 str.
           TW14588]
 gi|254795786|ref|YP_003080623.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O157:H7 str.
           TW14359]
 gi|261225563|ref|ZP_05939844.1| dTDP-D-glucose 4,6-dehydratase [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261255609|ref|ZP_05948142.1| dTDP-D-glucose 4,6-dehydratase [Escherichia coli O157:H7 str.
           FRIK966]
 gi|13364196|dbj|BAB38144.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O157:H7 str. Sakai]
 gi|187768885|gb|EDU32729.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O157:H7 str. EC4196]
 gi|188014279|gb|EDU52401.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O157:H7 str. EC4113]
 gi|189001405|gb|EDU70391.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O157:H7 str. EC4076]
 gi|189358938|gb|EDU77357.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O157:H7 str. EC4401]
 gi|189362621|gb|EDU81040.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O157:H7 str. EC4486]
 gi|189365802|gb|EDU84218.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O157:H7 str. EC4501]
 gi|189373224|gb|EDU91640.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O157:H7 str. EC869]
 gi|189376800|gb|EDU95216.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O157:H7 str. EC508]
 gi|208725490|gb|EDZ75091.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O157:H7 str. EC4206]
 gi|208734306|gb|EDZ82993.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O157:H7 str. EC4045]
 gi|208738404|gb|EDZ86086.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O157:H7 str. EC4042]
 gi|209161029|gb|ACI38462.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O157:H7 str. EC4115]
 gi|209753438|gb|ACI75026.1| glucose-1-phosphate thymidylyltransferase [Escherichia coli]
 gi|209753440|gb|ACI75027.1| glucose-1-phosphate thymidylyltransferase [Escherichia coli]
 gi|209753442|gb|ACI75028.1| glucose-1-phosphate thymidylyltransferase [Escherichia coli]
 gi|209753446|gb|ACI75030.1| glucose-1-phosphate thymidylyltransferase [Escherichia coli]
 gi|217322103|gb|EEC30527.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O157:H7 str.
           TW14588]
 gi|254595186|gb|ACT74547.1| dTDP-D-glucose 4,6-dehydratase [Escherichia coli O157:H7 str.
           TW14359]
 gi|320191118|gb|EFW65768.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O157:H7 str. EC1212]
 gi|320639273|gb|EFX08895.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O157:H7 str. G5101]
 gi|320644658|gb|EFX13708.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O157:H- str. 493-89]
 gi|320649983|gb|EFX18486.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O157:H- str. H 2687]
 gi|326344246|gb|EGD68006.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O157:H7 str. 1125]
 gi|326347927|gb|EGD71641.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O157:H7 str. 1044]
          Length = 355

 Score =  415 bits (1066), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 197/335 (58%), Positives = 243/335 (72%), Gaps = 6/335 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS  F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNALTED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V   
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+D+V  I  LL+ L P        + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLDVVETICELLEELAPNKPQGVVHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 303 IDASKIARELGWLPQETFESGMRKTVQWYLANESW 337


>gi|331668738|ref|ZP_08369586.1| dTDP-glucose 4,6-dehydratase [Escherichia coli TA271]
 gi|331063932|gb|EGI35843.1| dTDP-glucose 4,6-dehydratase [Escherichia coli TA271]
          Length = 361

 Score =  415 bits (1066), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 245/340 (72%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAVMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDG 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNNEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG++KTV WYL N  W
Sbjct: 301 DRRYAIDAEKISRELGWKPQETFESGIHKTVEWYLSNTKW 340


>gi|203285020|gb|ACH97138.1| RmlB [Escherichia coli]
          Length = 361

 Score =  415 bits (1066), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 243/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNKEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNENKNIDVVLTICDLLDEIVPKEQSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKISRELGWKPQETFESGIRKTVEWYLSNTKW 340


>gi|168481304|gb|ACA24793.1| RmlB [Escherichia coli]
          Length = 361

 Score =  415 bits (1066), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 244/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAVMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNTEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKIGRELGWKPQETFESGIRKTVEWYLSNTKW 340


>gi|194436137|ref|ZP_03068239.1| dTDP-glucose 4,6-dehydratase [Escherichia coli 101-1]
 gi|194424865|gb|EDX40850.1| dTDP-glucose 4,6-dehydratase [Escherichia coli 101-1]
 gi|323972812|gb|EGB68011.1| dTDP-glucose 4,6-dehydratase [Escherichia coli TA007]
          Length = 361

 Score =  415 bits (1066), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 200/366 (54%), Positives = 253/366 (69%), Gaps = 15/366 (4%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYIFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPYPDEVNNKEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY+V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYIVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKELKPDNDYSKWKNL 350
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL    W     + +K  N Y  W   
Sbjct: 301 DRRYAIDAEKISRELGWKPQETFESGIRKTVEWYLAKMQW----VENVKTGN-YQSWIEQ 355

Query: 351 NEMSCN 356
           N M  N
Sbjct: 356 NYMERN 361


>gi|83645207|ref|YP_433642.1| dTDP-glucose 4,6-dehydratase [Hahella chejuensis KCTC 2396]
 gi|83633250|gb|ABC29217.1| dTDP-glucose 4,6-dehydratase [Hahella chejuensis KCTC 2396]
          Length = 354

 Score =  415 bits (1066), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 196/338 (57%), Positives = 253/338 (74%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ RY++N     V+ +DKLTYAGNL++L  I  S  + F+Q DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRYIINCTGDSVVNVDKLTYAGNLDNLSNIENSERYEFVQADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  I + L  ++PDA+++ AAESHVDRSI G  +FI TNI+GT+ LLEE+R +W  +  
Sbjct: 61  DRAVIANVLSSYKPDAVMHLAAESHVDRSIDGPGDFIQTNIVGTYTLLEESRKYWLKMPT 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           ++K+ FRF  ISTDEV+G LD    LF+ED PY PSSPYSA+KASSD+LV AWG TYG+P
Sbjct: 121 ERKNAFRFHHISTDEVFGDLDGVTDLFTEDTPYAPSSPYSASKASSDHLVRAWGRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH  ALY V+ 
Sbjct: 181 VIVTNCSNNYGPYHFPEKLIPLMILNALEGRPLPVYGKGDQIRDWLYVEDHAAALYKVVS 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRY 294
           +G +GE YNIGG+NE+KNI++V  I  LL+ L+P        + +LI F++DRPGHD RY
Sbjct: 241 EGVVGETYNIGGHNEKKNIEVVQAICQLLEELVPNKPQGVSCYQDLISFVKDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID+SKI+ E+GW P E  ESGL KTV WYL N+ WW+
Sbjct: 301 AIDASKIQRELGWVPAETFESGLRKTVEWYLTNSAWWQ 338


>gi|300930358|ref|ZP_07145769.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 187-1]
 gi|300461758|gb|EFK25251.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 187-1]
          Length = 384

 Score =  415 bits (1066), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 196/340 (57%), Positives = 244/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           ++++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL EI  S  +SF   DIC
Sbjct: 24  VKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLAEIYDSERYSFEHADIC 83

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D E +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 84  DAEAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSGLDD 143

Query: 121 DKKDQFRFLQISTDEVYGSLDK----------GLFSEDMPYNPSSPYSATKASSDYLVLA 170
           +KK  FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 144 EKKKNFRFHHISTDEVYGDLPHPDEVNSNETLQLFTETTAYAPSSPYSASKASSDHLVRA 203

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 204 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 263

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+VF I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 264 RALYTVVTEGKAGETYNIGGHNEKKNIDVVFTICDLLDEIVPKEKSYREQITYVADRPGH 323

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 324 DRRYAIDADKISRELGWKPQETFESGIRKTVEWYLANTNW 363


>gi|187880674|gb|ACD37174.1| RmlB [Escherichia coli]
          Length = 361

 Score =  414 bits (1065), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 244/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  ++F   DIC
Sbjct: 1   MRILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYAFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L+ 
Sbjct: 61  DAVAMSRIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALND 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           +KK  FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 EKKKSFRFHHISTDEVYGDLPHPDEANNNEALPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDADKISRELGWKPQETFESGIRKTVEWYLANTNW 340


>gi|73809589|gb|AAZ85714.1| dTDP-glucose 4,6-dehydratase [Escherichia coli]
          Length = 361

 Score =  414 bits (1065), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 243/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK  FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKTSFRFHHISTDEVYGDLPHPDEVNNNEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVTDRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKIGRELGWKPQETFESGIRKTVEWYLSNTKW 340


>gi|46451851|gb|AAS98026.1| RmlB [Shigella boydii]
          Length = 361

 Score =  414 bits (1065), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 244/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAVMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGYLPHPDEVNNTEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKIARELGWKPQETFESGIRKTVEWYLSNTKW 340


>gi|91211325|ref|YP_541311.1| dTDP-glucose 4,6 dehydratase [Escherichia coli UTI89]
 gi|300986906|ref|ZP_07177884.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 45-1]
 gi|91072899|gb|ABE07780.1| RfbB, subunit of dTDP-glucose 4,6-dehydratase [Escherichia coli
           UTI89]
 gi|300407835|gb|EFJ91373.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 45-1]
 gi|307626415|gb|ADN70719.1| dTDP-glucose 4,6 dehydratase [Escherichia coli UM146]
 gi|315295249|gb|EFU54584.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 153-1]
          Length = 361

 Score =  414 bits (1065), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 195/340 (57%), Positives = 243/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ND +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINDTQDSVVNVDKLTYAGNLESLADVSDSERYFFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDG 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNKEGLPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKGLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKIGRELGWKPQETFESGIRKTVEWYLSNTKW 340


>gi|157144420|ref|YP_001451739.1| dTDP-glucose 4,6-dehydratase [Citrobacter koseri ATCC BAA-895]
 gi|157081625|gb|ABV11303.1| hypothetical protein CKO_00129 [Citrobacter koseri ATCC BAA-895]
          Length = 355

 Score =  414 bits (1065), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/339 (57%), Positives = 248/339 (73%), Gaps = 6/339 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R++VTGGAGFIGSA+ R+++++    V+V+DKLTYAGNL SL  ++Q   F+F +VDICD
Sbjct: 3   RILVTGGAGFIGSAVVRHIIDETPDAVVVVDKLTYAGNLMSLAPVAQHERFAFERVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +    +++QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L+ +
Sbjct: 63  RASLDRVFQQYQPDYVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARTYWATLNDE 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY VL  
Sbjct: 183 LVTNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYRVLTA 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NERKN+++V  I  LL+ L P+       +  LI F++DRPGHD RYA
Sbjct: 243 GEVGETYNIGGHNERKNLEVVETICDLLEELAPQKPLGVAHYRSLIAFVDDRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           ID++KI  E+GW PQE  ESG+ KTV WYL N  WW+P+
Sbjct: 303 IDAAKIARELGWTPQETFESGMRKTVQWYLANEAWWKPV 341


>gi|168481338|gb|ACA24824.1| RmlB [Escherichia coli]
 gi|320198731|gb|EFW73331.1| dTDP-glucose 4,6-dehydratase [Escherichia coli EC4100B]
          Length = 361

 Score =  414 bits (1065), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 244/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNNEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKTLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKIGRELGWKPQETFESGIRKTVEWYLANAKW 340


>gi|156539323|gb|ABU80586.1| dTDP-D-glucose 4,6-dehydratase [Shigella flexneri]
 gi|156539338|gb|ABU80596.1| dTDP-D-glucose 4,6-dehydratase [Shigella flexneri]
 gi|320185807|gb|EFW60561.1| dTDP-glucose 4,6-dehydratase [Shigella flexneri CDC 796-83]
          Length = 361

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 193/340 (56%), Positives = 244/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK +FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKTRFRFHHISTDEVYGDLPHPDEVNNTEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KT+ WYL N  W
Sbjct: 301 DRRYAIDAEKISRELGWKPQETFESGIRKTLEWYLSNTKW 340


>gi|168229419|ref|ZP_02654477.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|194472643|ref|ZP_03078627.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194459007|gb|EDX47846.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|205335648|gb|EDZ22412.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
          Length = 361

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 193/340 (56%), Positives = 249/340 (73%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++++TGGAGFIGSA+ R+++ + +  V+ IDKLTYAGNL SL +IS+SN ++F   DIC
Sbjct: 1   MKILITGGAGFIGSAVVRHIIKNTQDTVVNIDKLTYAGNLESLSDISESNRYNFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   I    +++QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L +
Sbjct: 61  DSAEITRIFEQYQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEVARKYWSALGE 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNNFRFHHISTDEVYGDLPHPDEVENSVMLPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WRRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RAL++V+ +G+ GE YNIGG+NE+ N+D+VF I  LLD ++PK+ S+ E I ++ DRPGH
Sbjct: 241 RALHMVVTEGKAGETYNIGGHNEKNNLDVVFTICDLLDEIVPKATSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW P E  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAGKISRELGWKPLETFESGIRKTVEWYLANTQW 340


>gi|189092401|gb|ACD75801.1| dTDP-glucose 4,6 dehydratase [Escherichia coli]
          Length = 383

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 195/340 (57%), Positives = 244/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           ++++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL E+S S  +SF   DIC
Sbjct: 23  VKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLAEVSDSERYSFEHADIC 82

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D E +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 83  DAEAMARIFSQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSGLDD 142

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           +KK  FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 143 EKKKNFRFHHISTDEVYGDLPHPDEVNNNEALPLFTETTAYAPSSPYSASKASSDHLVRA 202

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 203 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 262

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 263 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 322

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 323 DRRYAIDADKISRELGWKPQETFESGIRKTVEWYLANTNW 362


>gi|110806010|ref|YP_689530.1| dTDP-glucose 4,6 dehydratase [Shigella flexneri 5 str. 8401]
 gi|110615558|gb|ABF04225.1| dTDP-glucose 4,6 dehydratase [Shigella flexneri 5 str. 8401]
          Length = 361

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 193/340 (56%), Positives = 245/340 (72%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  ++F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYAFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L+ 
Sbjct: 61  DAVAMSRIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALND 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           +KK  FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 EKKKSFRFHHISTDEVYGDLPHPDEANNNEALPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G+ +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGEQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDADKISRELGWKPQETFESGIRKTVEWYLANTNW 340


>gi|330951113|gb|EGH51373.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae Cit 7]
          Length = 357

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 197/334 (58%), Positives = 248/334 (74%), Gaps = 4/334 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ +    V+ +DKLTYAGNL SL+   QS  ++F  VDIC
Sbjct: 1   MKILVTGGAGFIGSAVIRHIIANTTDSVVNVDKLTYAGNLESLQSADQSERYAFEHVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +RE +    KE QPDA+++ AAESHVDRSI G  EFI TNIIGT+ LLE  R +WS L +
Sbjct: 61  NREDVDRVFKEHQPDAVMHLAAESHVDRSITGPSEFIQTNIIGTYTLLESARGYWSQLDE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K  FRF  ISTDEVYG L+  + LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 ARKANFRFHHISTDEVYGDLEGPEDLFTETTPYQPSSPYSASKASSDHLVRAWSRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            L++NCSNNYGP HFPEKLIPL I   +EG  + +YG G  VRDWLYVEDH RALY V+ 
Sbjct: 181 TLVTNCSNNYGPCHFPEKLIPLIILNALEGKPLPIYGKGDQVRDWLYVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY--SHTELIRFIEDRPGHDRRYAI 296
           +G IGE YNIGG+NE++N+++V  +  LLD L P S    H  LI +++DRPGHD RYAI
Sbjct: 241 EGEIGETYNIGGHNEKQNLEVVNTVCALLDQLRPDSAHRPHASLITYVQDRPGHDLRYAI 300

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           D+SKI+ E+GW P+E+ ESG+ KTV WYLDN  W
Sbjct: 301 DASKIQRELGWVPEESFESGIRKTVQWYLDNPEW 334


>gi|168259599|ref|ZP_02681572.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|205350796|gb|EDZ37427.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
          Length = 361

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 248/340 (72%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++++TGGAGFIGSA+ R+++ + +  V+ IDKLTYAGNL SL +IS+SN ++F   DIC
Sbjct: 1   MKILITGGAGFIGSAVVRHIIKNTQDTVVNIDKLTYAGNLESLSDISESNRYNFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   I    +++QPDA+++ AAESHVDRSI G   FI TNI+GT+ LLE  R +WS L +
Sbjct: 61  DSAEITRIFEQYQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYALLEVARKYWSALGE 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNNFRFHHISTDEVYGDLPHPDEVENSVTLPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WRRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RAL++V+ +G+ GE YNIGG+NE+KN+D+VF I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALHMVVTEGKAGETYNIGGHNEKKNLDVVFTICDLLDEIVPKVTSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW P E  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAGKISRELGWKPLETFESGIRKTVEWYLANTQW 340


>gi|227887094|ref|ZP_04004899.1| dTDP-glucose 4,6-dehydratase [Escherichia coli 83972]
 gi|227835444|gb|EEJ45910.1| dTDP-glucose 4,6-dehydratase [Escherichia coli 83972]
 gi|307554113|gb|ADN46888.1| dTDP-D-glucose 4,6-dehydratase rmlB [Escherichia coli ABU 83972]
          Length = 361

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 242/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAIVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFSQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L             LF E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNKEKLPLFIETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICNLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDADKISRELGWKPQETFESGIRKTVEWYLSNTKW 340


>gi|332084697|gb|EGI89885.1| dTDP-glucose 4,6-dehydratase [Shigella boydii 5216-82]
          Length = 355

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 196/337 (58%), Positives = 243/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS  F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +       QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTAHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNALTED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V   
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+D+V  I  LL+ L P        + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLDVVETICELLEELAPNKPHGVVHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+GW  QE  ESG+ KTV WYL N  WW+
Sbjct: 303 IDASKIAREVGWLQQETFESGMRKTVQWYLANESWWK 339


>gi|157154898|ref|YP_001463392.1| dTDP-glucose 4,6 dehydratase [Escherichia coli E24377A]
 gi|157076928|gb|ABV16636.1| dTDP-glucose 4,6-dehydratase [Escherichia coli E24377A]
          Length = 361

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 244/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAVMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDG 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNTEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKIGRELGWKPQETFESGIRKTVEWYLSNTKW 340


>gi|168481391|gb|ACA24873.1| RmlB [Escherichia coli]
          Length = 361

 Score =  414 bits (1063), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 193/340 (56%), Positives = 243/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGS + R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSTVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G+  FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQPDAVMHLAAESHVDRSITGSAAFIETNIVGTYVLLEAARNYWSALDG 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNKEQLPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKISRELGWKPQETFESGIRKTVEWYLSNTKW 340


>gi|187730265|ref|YP_001879838.1| dTDP-glucose 4,6 dehydratase [Shigella boydii CDC 3083-94]
 gi|187427257|gb|ACD06531.1| dTDP-glucose 4,6-dehydratase [Shigella boydii CDC 3083-94]
          Length = 361

 Score =  414 bits (1063), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 243/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNRQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNIKEGLPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKGLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVTDRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKIGRELGWKPQETFESGIRKTVEWYLSNTKW 340


>gi|160863319|gb|ABX51885.1| dTDP-D-glucose-4,6-dehydratase [Cronobacter sakazakii]
          Length = 360

 Score =  414 bits (1063), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 246/340 (72%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N  + +V+ +DKLTYAGN  S+  ++ S  ++F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINHTQDRVVNLDKLTYAGNPESVASVANSERYAFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +    KE QPDA+++ AAESHVDRSI G  +FI TNI+GT+ LLE  R +WS L  
Sbjct: 61  DRAALDRVFKEHQPDAVMHLAAESHVDRSISGPADFIETNIVGTYTLLEAARAYWSSLDD 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
            +K  FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 QRKAAFRFHHISTDEVYGDLPHPDEWHESAALPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WLRTYGLPTMVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+IGE YNIGG+NE+KN+D+V  I  LLD + PK+ S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTQGQIGETYNIGGHNEKKNLDVVLTICDLLDEIKPKATSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL+N  W
Sbjct: 301 DRRYAIDADKISRELGWRPQETFESGIRKTVHWYLNNEEW 340


>gi|239831406|ref|ZP_04679735.1| dTDP-glucose 4,6-dehydratase [Ochrobactrum intermedium LMG 3301]
 gi|239823673|gb|EEQ95241.1| dTDP-glucose 4,6-dehydratase [Ochrobactrum intermedium LMG 3301]
          Length = 358

 Score =  414 bits (1063), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 197/338 (58%), Positives = 248/338 (73%), Gaps = 4/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M ++VTGGAGFIGSA+CR+L +D +I V+ +DKLTYAGNL SL++I     +SFLQ DIC
Sbjct: 1   MNILVTGGAGFIGSAVCRHLASDPRINVVNLDKLTYAGNLASLRQIENHPNYSFLQADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +  AL+  + D +++ AAESHVDRSI G   FI TNI+GTF LL     +W  L +
Sbjct: 61  DDTSVLDALRANEIDVVMHLAAESHVDRSIDGPGAFIETNIVGTFRLLNAALAYWRELPE 120

Query: 121 DKKDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K  FRF  ISTDEV+G L  D G+F+E+ PY PSSPYSA+KA+SD+LV AW  TYG+P
Sbjct: 121 PRKSCFRFHHISTDEVFGDLPFDSGIFTEETPYKPSSPYSASKAASDHLVRAWHETYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+LSNCSNNYGP+HFPEKLIPL I   ++   + +YG G NVRDWLYVEDH RAL LV  
Sbjct: 181 VVLSNCSNNYGPFHFPEKLIPLVILNALDEKPLPVYGAGANVRDWLYVEDHARALALVAT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS--YSHTELIRFIEDRPGHDRRYAI 296
            G++GE YNIGG  ER N+++V  I  +LD   P++   SH +LI F+ DRPGHDRRYAI
Sbjct: 241 TGKLGESYNIGGRAERTNLNVVETICAILDKKRPRANGKSHADLITFVTDRPGHDRRYAI 300

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           D+SKI+ E+GW PQE  E+GL KT+ WYLDN WWW P+
Sbjct: 301 DASKIERELGWKPQETFETGLEKTIQWYLDNAWWWEPI 338


>gi|301381031|ref|ZP_07229449.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. tomato
           Max13]
 gi|302059360|ref|ZP_07250901.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. tomato K40]
 gi|302134877|ref|ZP_07260867.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. tomato NCPPB
           1108]
          Length = 357

 Score =  414 bits (1063), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 196/334 (58%), Positives = 249/334 (74%), Gaps = 4/334 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ +    V+ +DKLTYAGNL SL+   QS  ++F  VDIC
Sbjct: 1   MKILVTGGAGFIGSAVIRHIIANTTDSVVNVDKLTYAGNLESLQSADQSERYAFEHVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +RE +    KE QPDA+++ AAESHVDRSI G  EFI TNIIGT++LLE  R +W+ L +
Sbjct: 61  NREDLDRVFKEHQPDAVMHLAAESHVDRSITGPSEFIQTNIIGTYVLLEAARSYWNQLDE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K  FRF  ISTDEVYG L+  + LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 ARKASFRFHHISTDEVYGDLEGPEDLFTETTPYQPSSPYSASKASSDHLVRAWSRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            L++NCSNNYGP HFPEKLIPL I   +EG  + +YG G  VRDWLYVEDH RALY V+ 
Sbjct: 181 TLVTNCSNNYGPCHFPEKLIPLIILNALEGKPLPIYGKGDQVRDWLYVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY--SHTELIRFIEDRPGHDRRYAI 296
           +G IGE YNIGG+NE++N+++V  +  LLD L P S    H  LI +++DRPGHD RYAI
Sbjct: 241 EGEIGETYNIGGHNEKQNLEVVNTVCALLDQLRPDSAHRPHANLITYVQDRPGHDLRYAI 300

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           D+SKI+ E+GW P+E+ ESG+ KTV WYLDN  W
Sbjct: 301 DASKIQRELGWVPEESFESGIRKTVQWYLDNPEW 334


>gi|168481376|gb|ACA24859.1| RmlB [Shigella dysenteriae]
          Length = 361

 Score =  414 bits (1063), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 192/340 (56%), Positives = 244/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAG+L SL ++S S  + F   D+C
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGDLESLADVSDSERYVFEHADVC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAVMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNKEQLPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY+V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYIVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKISRELGWKPQETFESGIRKTVEWYLSNTKW 340


>gi|127512332|ref|YP_001093529.1| dTDP-glucose 4,6 dehydratase [Shewanella loihica PV-4]
 gi|126637627|gb|ABO23270.1| dTDP-glucose 4,6-dehydratase [Shewanella loihica PV-4]
          Length = 365

 Score =  414 bits (1063), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 193/340 (56%), Positives = 248/340 (72%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL  + +   ++F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVINVDKLTYAGNLESLVSVDKDERYAFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     E +PDA+++ AAESHVDRSI G  +FI TNI+GT+ LLE TR +W+ L  
Sbjct: 61  DRAELDRVFNEHKPDAVMHLAAESHVDRSITGPADFIQTNIVGTYTLLEATRAYWNELPA 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK  FRF  ISTDEVYG L          +  LF+E  PY PSSPYSA+KASSD+LV A
Sbjct: 121 DKKTAFRFHHISTDEVYGDLLHPDEVQNPDELPLFTETTPYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WLRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKSLPVYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G IGE YNIGG+NE++N+++V  I  +LD L+PK   ++E I ++ DRPGH
Sbjct: 241 RALYKVVTEGVIGETYNIGGHNEKQNLEVVKTICSILDELMPKDVPYSEQITYVTDRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAIDSSK+  E+ W P+E  E+GL KTV WYLDN  W
Sbjct: 301 DRRYAIDSSKMSQELNWLPEETFETGLRKTVQWYLDNQVW 340


>gi|73809577|gb|AAZ85703.1| dTDP-glucose 4,6-dehydratase [Escherichia coli]
          Length = 361

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 243/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYIFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDG 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNKEQLPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVTDRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKIGRELGWKPQETFESGIRKTVEWYLSNTKW 340


>gi|333002403|gb|EGK21965.1| dTDP-glucose 4,6-dehydratase [Shigella flexneri K-218]
          Length = 361

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 193/340 (56%), Positives = 244/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  ++F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYAFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L+ 
Sbjct: 61  DAVAMSRIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALND 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           +KK  FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 EKKKSFRFHHISTDEVYGDLPHPDEANNNEALPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGNQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDADKISRELGWKPQETFESGIRKTVEWYLANTNW 340


>gi|297499070|gb|ADI43256.1| RmlB [Escherichia coli]
          Length = 361

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 242/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L             LF E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNKEKLPLFIETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICNLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKIGRELGWKPQETFESGIRKTVEWYLSNTKW 340


>gi|24113426|ref|NP_707936.1| dTDP-glucose 4,6 dehydratase [Shigella flexneri 2a str. 301]
 gi|30063492|ref|NP_837663.1| dTDP-glucose 4,6 dehydratase [Shigella flexneri 2a str. 2457T]
 gi|2506452|sp|P37777|RFBB_SHIFL RecName: Full=dTDP-glucose 4,6-dehydratase
 gi|294896|gb|AAA53679.1| dTDP-D-glucose 4,6-dehydratase [Shigella flexneri]
 gi|24052449|gb|AAN43643.1| dTDP-glucose 4,6 dehydratase [Shigella flexneri 2a str. 301]
 gi|30041745|gb|AAP17472.1| dTDP-glucose 4,6 dehydratase [Shigella flexneri 2a str. 2457T]
 gi|281601494|gb|ADA74478.1| dTDP-glucose 4,6-dehydratase [Shigella flexneri 2002017]
 gi|313649922|gb|EFS14342.1| dTDP-glucose 4,6-dehydratase [Shigella flexneri 2a str. 2457T]
 gi|332756674|gb|EGJ87023.1| dTDP-glucose 4,6-dehydratase [Shigella flexneri K-671]
 gi|332766386|gb|EGJ96595.1| dTDP-glucose 4,6-dehydratase [Shigella flexneri 2930-71]
          Length = 361

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 193/340 (56%), Positives = 244/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  ++F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYAFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L+ 
Sbjct: 61  DAVAMSRIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALND 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           +KK  FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 EKKKSFRFHHISTDEVYGDLPHPDEANNNEALPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDADKISRELGWKPQETFESGIRKTVEWYLANTNW 340


>gi|28868296|ref|NP_790915.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|28851533|gb|AAO54610.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|331019593|gb|EGH99649.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. lachrymans
           str. M302278PT]
          Length = 357

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 196/334 (58%), Positives = 249/334 (74%), Gaps = 4/334 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ +    V+ +DKLTYAGNL SL+   QS  ++F  VDIC
Sbjct: 1   MKILVTGGAGFIGSAVIRHIIANTTDSVVNVDKLTYAGNLESLQSADQSERYAFEHVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +RE +    KE QPDA+++ AAESHVDRSI G  EFI TNIIGT++LLE  R +W+ L +
Sbjct: 61  NREDLDRVFKEHQPDAVMHLAAESHVDRSITGPSEFIQTNIIGTYVLLEAARSYWNTLDE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K  FRF  ISTDEVYG L+  + LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 VRKANFRFHHISTDEVYGDLEGPEDLFTETTPYQPSSPYSASKASSDHLVRAWSRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            L++NCSNNYGP HFPEKLIPL I   +EG  + +YG G  VRDWLYVEDH RALY V+ 
Sbjct: 181 TLVTNCSNNYGPCHFPEKLIPLIILNALEGKPLPIYGKGDQVRDWLYVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY--SHTELIRFIEDRPGHDRRYAI 296
           +G IGE YNIGG+NE++N+++V  +  LLD L P S    H  LI +++DRPGHD RYAI
Sbjct: 241 EGEIGETYNIGGHNEKQNLEVVNTVCALLDQLRPDSAHRPHANLITYVQDRPGHDLRYAI 300

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           D+SKI+ E+GW P+E+ ESG+ KTV WYLDN  W
Sbjct: 301 DASKIQRELGWVPEESFESGIRKTVQWYLDNPEW 334


>gi|311697172|gb|ADQ00044.1| dTDP-glucose 4,6-dehydratase [marine bacterium HP15]
          Length = 357

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 198/339 (58%), Positives = 251/339 (74%), Gaps = 9/339 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+L++TGGAGFIGSA+ R+++N    +V+ +D LTYAGNL SLKE++ S+ ++F QVDIC
Sbjct: 1   MKLLITGGAGFIGSAVIRHIINGTTDEVVNLDILTYAGNLESLKEVNDSSRYTFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +   L E QPDAI++ AAESHVDRSI G  +FI TNI+GT+ LLE TR +W  L  
Sbjct: 61  DRSGVDRVLAEHQPDAIMHLAAESHVDRSIDGPADFIETNIVGTYTLLEATRQYWQGLEA 120

Query: 121 DKKDQFRFLQISTDEVYGSL---------DKGLFSEDMPYNPSSPYSATKASSDYLVLAW 171
           +KK  FRF  ISTDEVYG L         ++ LF+E   Y PSSPYSA+KASSD+LV AW
Sbjct: 121 EKKANFRFHHISTDEVYGDLPHPSETSNAEEHLFTEQTAYAPSSPYSASKASSDHLVRAW 180

Query: 172 GHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVR 231
             TYG+PVL++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH R
Sbjct: 181 QRTYGLPVLVTNCSNNYGPYHFPEKLIPLIILNALEGKPLPVYGKGDQIRDWLYVEDHAR 240

Query: 232 ALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHD 291
           ALY V+ +G+ G+ YNIGG+NE++NID+V  I  +L  L P+  S+ ELI F+ DRPGHD
Sbjct: 241 ALYKVVTEGQPGKTYNIGGHNEKQNIDVVHIICGILQELRPQERSYGELITFVRDRPGHD 300

Query: 292 RRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           RRYAID+ KI+ E+GW P+E  E+G+ KTV WYLDN  W
Sbjct: 301 RRYAIDADKIQRELGWAPEETFETGIRKTVQWYLDNLDW 339


>gi|331658121|ref|ZP_08359083.1| dTDP-glucose 4,6-dehydratase [Escherichia coli TA206]
 gi|187880656|gb|ACD37158.1| RmlB [Escherichia coli]
 gi|187880665|gb|ACD37166.1| RmlB [Escherichia coli]
 gi|331056369|gb|EGI28378.1| dTDP-glucose 4,6-dehydratase [Escherichia coli TA206]
 gi|333002553|gb|EGK22114.1| dTDP-glucose 4,6-dehydratase [Shigella flexneri VA-6]
 gi|333003381|gb|EGK22925.1| dTDP-glucose 4,6-dehydratase [Shigella flexneri K-272]
 gi|333017211|gb|EGK36531.1| dTDP-glucose 4,6-dehydratase [Shigella flexneri K-227]
          Length = 361

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 193/340 (56%), Positives = 244/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  ++F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYAFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L+ 
Sbjct: 61  DAVAMSRIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALND 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           +KK  FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 EKKKSFRFHHISTDEVYGDLPHPDEANNNEALPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDADKISRELGWKPQETFESGIRKTVEWYLANTNW 340


>gi|330961718|gb|EGH61978.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. maculicola
           str. ES4326]
          Length = 357

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 197/334 (58%), Positives = 249/334 (74%), Gaps = 4/334 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ +    V+ +DKLTYAGNL SL+   QS  ++F  VDIC
Sbjct: 1   MKILVTGGAGFIGSAVIRHIIANTTDSVVNVDKLTYAGNLESLQSADQSERYAFEHVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +RE +    KE QPDAI++ AAESHVDRSI G  EFI TNIIGT+ LLE  R +W+ L +
Sbjct: 61  NREDLDRVFKEHQPDAIMHLAAESHVDRSITGPSEFIQTNIIGTYTLLEAARGYWNQLDE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K  FRF  ISTDEVYG L+  + LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 ARKAGFRFHHISTDEVYGDLEGPEDLFTETTPYQPSSPYSASKASSDHLVRAWSRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            L++NCSNNYGP HFPEKLIPL I   +EG  + +YG G  VRDWLYVEDH RALY V+ 
Sbjct: 181 ALVTNCSNNYGPCHFPEKLIPLIILNALEGKPLPIYGKGDQVRDWLYVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS--YSHTELIRFIEDRPGHDRRYAI 296
           +G+IGE YNIGG+NE++N+++V  +  LLD L P S    H  LI +++DRPGHD RYAI
Sbjct: 241 EGKIGETYNIGGHNEKQNLEVVHAVCALLDQLRPDSAHLPHASLITYVQDRPGHDLRYAI 300

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           D+SKI+ E+GW P+E+ ESG+ KTV WYLDN  W
Sbjct: 301 DASKIQRELGWVPEESFESGIRKTVQWYLDNPEW 334


>gi|148252644|ref|YP_001237229.1| dTDP-glucose 4,6-dehydratase [Bradyrhizobium sp. BTAi1]
 gi|146404817|gb|ABQ33323.1| dTDP-glucose 4,6-dehydratase [Bradyrhizobium sp. BTAi1]
          Length = 348

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 195/335 (58%), Positives = 245/335 (73%), Gaps = 1/335 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++IVTGGAGFIGSA+CR+LV DL   VLV+DKLTYAGN  SL  +  S  FSF QVDIC
Sbjct: 1   MKIIVTGGAGFIGSAVCRHLVADLGHAVLVLDKLTYAGNTASLAPVMSSPSFSFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +R+ +  A   F PDAI++ AAE+HVDRSI G D FI TN++GTF LLE  R + +   +
Sbjct: 61  ERQKVEQAFASFAPDAIIHLAAETHVDRSIDGPDHFIQTNLVGTFTLLEVARRYLNGAGR 120

Query: 121 DKKDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            K DQFRF+ +STDEV+GSL ++GLF+E   Y+PSSPYSA+KA SD+L  AW  TYG+PV
Sbjct: 121 AKADQFRFIHVSTDEVFGSLGEEGLFTETTAYDPSSPYSASKAGSDHLARAWHRTYGLPV 180

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           ++SNCSNNYGPY FPEKLIPL I   +    + +YGDG N+RDWL+V+DH RAL  +L++
Sbjct: 181 IVSNCSNNYGPYQFPEKLIPLMILNALHAQPLPVYGDGGNIRDWLFVDDHARALVALLER 240

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSS 299
           G  G  YNIGG  ER+NID+V +I   LD L P    H  L+ F+ DRPGHDRRYA+D S
Sbjct: 241 GVPGATYNIGGRTERRNIDVVRQICQCLDRLRPAGGPHERLLTFVADRPGHDRRYALDCS 300

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           K++ E+GW  QE  E+G+ KTV WYLD + WW PL
Sbjct: 301 KLEGELGWKAQETFETGIEKTVRWYLDRSDWWMPL 335


>gi|50882468|gb|AAT85647.1| RmlB [Escherichia coli]
 gi|315299448|gb|EFU58699.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 16-3]
          Length = 361

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 193/340 (56%), Positives = 243/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNTEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+  I  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAENIGRELGWKPQETFESGIRKTVEWYLSNTKW 340


>gi|323936935|gb|EGB33218.1| dTDP-glucose 4,6-dehydratase [Escherichia coli E1520]
          Length = 361

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 244/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYIFEHEDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNKEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKISRELGWKPQETFESGIRKTVEWYLANAKW 340


>gi|82543419|ref|YP_407366.1| dTDP-glucose 4,6 dehydratase [Shigella boydii Sb227]
 gi|16611723|gb|AAL27310.1|AF402312_2 dTDP-D-glucose 4,6-dehydratase [Shigella boydii]
 gi|81244830|gb|ABB65538.1| dTDP-glucose 4,6 dehydratase [Shigella boydii Sb227]
 gi|167410109|gb|ABZ79713.1| RmlB [Escherichia coli]
 gi|332097152|gb|EGJ02135.1| dTDP-glucose 4,6-dehydratase [Shigella boydii 3594-74]
          Length = 361

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 243/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAVMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FR   ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRLHHISTDEVYGDLPHPDEVNNTEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I +I DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYIADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKIGRELGWKPQETFESGIRKTVEWYLSNTKW 340


>gi|300717503|ref|YP_003742306.1| dTDP-glucose 4,6-dehydratase [Erwinia billingiae Eb661]
 gi|299063339|emb|CAX60459.1| dTDP-glucose 4,6-dehydratase [Erwinia billingiae Eb661]
          Length = 359

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 190/338 (56%), Positives = 248/338 (73%), Gaps = 8/338 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++++TGGAGFIGSA+ R+++ D +  V+ +DKLTYAGNL S+K++S S  + F Q+DIC
Sbjct: 1   MKILITGGAGFIGSAVVRHIIQDTQDSVINVDKLTYAGNLESIKDVSDSERYQFFQLDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +   + E QPDAI++ AAESHVDRSI G  +F+ TN++GT+ LLE TR +W+ LS 
Sbjct: 61  DGAGLSKVMNETQPDAIMHLAAESHVDRSITGPADFVQTNVVGTYTLLEATRQYWNTLSD 120

Query: 121 DKKDQFRFLQISTDEVYGSL--------DKGLFSEDMPYNPSSPYSATKASSDYLVLAWG 172
           +KK  FRF  ISTDEVYG L        +  LF+E  PY PSSPYS+TKA+SD+LV AWG
Sbjct: 121 EKKQAFRFHHISTDEVYGDLPHPDEMSGELPLFTETTPYAPSSPYSSTKAASDHLVRAWG 180

Query: 173 HTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRA 232
            TY +PV+++NCSNNYGPYHFPEKLIPL I   +E   + +YG G  +RDWLYVEDH RA
Sbjct: 181 RTYKLPVIITNCSNNYGPYHFPEKLIPLIIINALEKKPLPVYGKGDQIRDWLYVEDHARA 240

Query: 233 LYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDR 292
           LY V+ +  +G  YNIGG+NE++N+++V  +  LLD L P    + +LI ++ DRPGHDR
Sbjct: 241 LYKVVTEAEVGTTYNIGGHNEKQNLEVVQTVCALLDELQPTEGRYADLITYVNDRPGHDR 300

Query: 293 RYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           RYAIDSSKI+ ++GW PQE  ESGL KTV WYL NN W
Sbjct: 301 RYAIDSSKIQKDLGWKPQETFESGLRKTVQWYLTNNEW 338


>gi|257481998|ref|ZP_05636039.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|331008858|gb|EGH88914.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 357

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 197/334 (58%), Positives = 248/334 (74%), Gaps = 4/334 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGG GFIGSA+ R+++ +    V+ +DKLTYAGNL SL+   QS  ++F  VDIC
Sbjct: 1   MKILVTGGTGFIGSAVIRHIIANTTDSVVNVDKLTYAGNLESLQSADQSERYAFEHVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +RE +    KE QPDA+++ AAESHVDRSI G  EFI TNIIGT++LLE  R +WS L +
Sbjct: 61  NREDLDRVFKEHQPDAVMHLAAESHVDRSITGPSEFIQTNIIGTYVLLEAARGYWSQLDE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K  FRF  ISTDEVYG L+  + LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 VRKASFRFHHISTDEVYGDLEGPEDLFTETTPYQPSSPYSASKASSDHLVRAWSRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            L++NCSNNYGP HFPEKLIPL I   +EG  + +YG G  VRDWLYVEDH RALY V+ 
Sbjct: 181 TLVTNCSNNYGPCHFPEKLIPLIILNALEGKPLPIYGKGDQVRDWLYVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY--SHTELIRFIEDRPGHDRRYAI 296
           +G IGE YNIGG+NE++NI++V  +  LLD L P S    H  LI +++DRPGHD RYAI
Sbjct: 241 EGEIGETYNIGGHNEKQNIEVVNTVCALLDQLRPDSVHRPHASLITYVQDRPGHDLRYAI 300

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           D+SKI+ E+GW P+E+ ESG+ KTV WYLDN  W
Sbjct: 301 DASKIQRELGWTPEESFESGIRKTVQWYLDNPEW 334


>gi|300821854|ref|ZP_07101999.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 119-7]
 gi|300525696|gb|EFK46765.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 119-7]
          Length = 361

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 200/366 (54%), Positives = 252/366 (68%), Gaps = 15/366 (4%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYIFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPYPDEVNNKEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY+V+ +G+ GE YNIGG NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYIVVTEGKAGETYNIGGYNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKELKPDNDYSKWKNL 350
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL    W     + +K  N Y  W   
Sbjct: 301 DRRYAIDAEKISRELGWKPQETFESGIRKTVEWYLAKMQW----VENVKTGN-YQSWIEQ 355

Query: 351 NEMSCN 356
           N M  N
Sbjct: 356 NYMERN 361


>gi|50429170|gb|AAT77169.1| RmlB [Escherichia coli]
 gi|323161879|gb|EFZ47754.1| dTDP-glucose 4,6-dehydratase [Escherichia coli E128010]
          Length = 358

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 194/342 (56%), Positives = 245/342 (71%), Gaps = 10/342 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSGSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +       QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFALHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDG 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNKEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDKIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           DRRYAID+ KI  E+GW PQE  ESG+ KT+ WY +NN W R
Sbjct: 301 DRRYAIDAEKIGRELGWKPQETFESGIRKTINWYFNNNDWCR 342


>gi|320666078|gb|EFX33092.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O157:H7 str. LSU-61]
          Length = 355

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 196/335 (58%), Positives = 242/335 (72%), Gaps = 6/335 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS  F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNALTED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RA Y V   
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARAQYCVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+D+V  I  LL+ L P        + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLDVVETICELLEELAPNKPQGVVHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 303 IDASKIARELGWLPQETFESGMRKTVQWYLANESW 337


>gi|117624237|ref|YP_853150.1| dTDP-glucose 4,6 dehydratase [Escherichia coli APEC O1]
 gi|237704495|ref|ZP_04534976.1| dTDP-glucose 4,6 dehydratase [Escherichia sp. 3_2_53FAA]
 gi|300936655|ref|ZP_07151559.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 21-1]
 gi|115513361|gb|ABJ01436.1| RfbB, subunit of dTDP-glucose 4,6-dehydratase [Escherichia coli
           APEC O1]
 gi|226900861|gb|EEH87120.1| dTDP-glucose 4,6 dehydratase [Escherichia sp. 3_2_53FAA]
 gi|288816198|gb|ADC54922.1| RmlB [Escherichia coli]
 gi|300458236|gb|EFK21729.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 21-1]
 gi|323951793|gb|EGB47667.1| dTDP-glucose 4,6-dehydratase [Escherichia coli H252]
          Length = 361

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 243/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDG 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNKEQLPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGQAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKIGRELGWKPQETFESGIRKTVEWYLANAKW 340


>gi|288816209|gb|ADC54932.1| RmlB [Escherichia coli]
          Length = 361

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 195/340 (57%), Positives = 243/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL E+S S  +SF   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLAEVSDSERYSFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D E +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAEAMARIFSQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSGLDD 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           +KK  FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 EKKKNFRFYHISTDEVYGDLPHPDEVNNNEALPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ES + KTV WYL N  W
Sbjct: 301 DRRYAIDADKISRELGWKPQETFESWIRKTVEWYLANTNW 340


>gi|170720583|ref|YP_001748271.1| dTDP-glucose 4,6-dehydratase [Pseudomonas putida W619]
 gi|169758586|gb|ACA71902.1| dTDP-glucose 4,6-dehydratase [Pseudomonas putida W619]
          Length = 358

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 192/334 (57%), Positives = 251/334 (75%), Gaps = 4/334 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++++    V+ +DKLTYAGNL SL+ + Q   ++F +VDIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIISNTDDSVINVDKLTYAGNLESLQSVDQDTRYAFERVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +    +E QPDA+++ AAESHVDRSI G  EFI TNIIGT+ LLE  R +W+ L +
Sbjct: 61  DRGELDRVFREHQPDAVMHLAAESHVDRSISGPSEFIQTNIIGTYNLLEAARGYWNSLDE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K  FRF  ISTDEVYG L+  + LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 TRKAAFRFHHISTDEVYGDLEGPEDLFTETTPYQPSSPYSASKASSDHLVRAWARTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            L++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH RALY V+ 
Sbjct: 181 TLVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPIYGKGDQIRDWLYVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY--SHTELIRFIEDRPGHDRRYAI 296
           +G +G+ YNIGG+NE++NI++V  +  LLD L P+S    H +L+ +++DRPGHD RYAI
Sbjct: 241 EGEVGQTYNIGGHNEKQNIEVVRTVCALLDELRPESAFRPHVDLLTYVQDRPGHDLRYAI 300

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           D+SKI+ E+GW P+E  ESG+ KTV WYLDN  W
Sbjct: 301 DASKIQRELGWVPEETFESGIRKTVQWYLDNPEW 334


>gi|293415329|ref|ZP_06657972.1| dTDP-glucose 4,6-dehydratase [Escherichia coli B185]
 gi|291432977|gb|EFF05956.1| dTDP-glucose 4,6-dehydratase [Escherichia coli B185]
          Length = 361

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 244/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DSVAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDG 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNKEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKGLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKISRELGWKPQETFESGIRKTVEWYLANAKW 340


>gi|331685507|ref|ZP_08386091.1| dTDP-glucose 4,6-dehydratase [Escherichia coli H299]
 gi|331077208|gb|EGI48422.1| dTDP-glucose 4,6-dehydratase [Escherichia coli H299]
          Length = 355

 Score =  412 bits (1060), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 195/337 (57%), Positives = 244/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS  F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E QPD +++ AAESHVDRSI G   F+ TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFVETNIVGTYTLLEAARAYWNALTED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYV+DH RALY V   
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVDDHARALYCVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+D+V  I  LL+ L P        + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLDVVETICELLEELAPNKPHGVAHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  W +
Sbjct: 303 IDASKIARELGWLPQETFESGMRKTVQWYLANESWCK 339


>gi|148191|gb|AAA67588.1| possibly rffE; (UDP-GlcNAc-2-epimerase) [Escherichia coli str. K-12
           substr. MG1655]
          Length = 355

 Score =  412 bits (1060), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 196/337 (58%), Positives = 243/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS  F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNALTED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V   
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKSLPVYGNGQQIRDWLYVEDHARALYCVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+D+V  I  LL+ L P        + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLDVVETICELLEELAPNKPHGVAHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+G  PQE  ESG+ K V WYL N  WW+
Sbjct: 303 IDASKIARELGCVPQETFESGMRKXVQWYLANESWWK 339


>gi|324114026|gb|EGC07999.1| dTDP-glucose 4,6-dehydratase [Escherichia fergusonii B253]
          Length = 361

 Score =  412 bits (1060), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 193/340 (56%), Positives = 244/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLVDVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   ++    + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAVAMKRIFSQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDD 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           +KK +FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 EKKKRFRFHHISTDEVYGDLPHPDEVNNNETLPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKIGRELGWKPQETFESGIRKTVEWYLANTKW 340


>gi|63033901|gb|AAY28252.1| RmlB [Escherichia coli]
          Length = 361

 Score =  412 bits (1060), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 243/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +       QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DATAMARIFALHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDG 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNKEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKIGRELGWKPQETFESGIRKTVEWYLSNTKW 340


>gi|21672267|gb|AAM74474.1| dTDP-D-glucose-4,6-dehydratase [Aeromonas hydrophila]
          Length = 379

 Score =  412 bits (1060), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 191/340 (56%), Positives = 247/340 (72%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ D    V+ +DKLTYAGNL SL  ++ S  ++F QVDIC
Sbjct: 19  MKILVTGGAGFIGSAVVRHIIRDTNDSVINLDKLTYAGNLESLASVANSERYAFEQVDIC 78

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +R  +     + QPDA+++ AAESHVDRSI G  +FI TNI+GT++LLE  R +W+ L +
Sbjct: 79  NRAELDRVFAQHQPDAVMHLAAESHVDRSITGPADFIETNIVGTYMLLEAARAYWNGLDE 138

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
            +K  FRF  ISTDEVYG L             LF+E  PY PSSPYSA+KASSD+LV A
Sbjct: 139 VRKAAFRFHHISTDEVYGDLPHPDEVAPGVALPLFTETTPYAPSSPYSASKASSDHLVRA 198

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   ++G  + +YG G  +RDWLYVEDH 
Sbjct: 199 WRRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALDGKPLPVYGKGDQIRDWLYVEDHA 258

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+  G IGE YNIGG+NER+N+D+V  I  LLD ++PK+ S+ + I ++ DRPGH
Sbjct: 259 RALYTVVTTGAIGETYNIGGHNERQNLDVVHTICDLLDEMVPKAGSYRDQITYVADRPGH 318

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+SK+ +E+ W PQE  ESG+ KTV WYLDN  W
Sbjct: 319 DRRYAIDASKMSAELAWLPQETFESGIRKTVQWYLDNQQW 358


>gi|117919827|ref|YP_869019.1| dTDP-glucose 4,6 dehydratase [Shewanella sp. ANA-3]
 gi|117612159|gb|ABK47613.1| dTDP-glucose 4,6-dehydratase [Shewanella sp. ANA-3]
          Length = 359

 Score =  412 bits (1059), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 191/343 (55%), Positives = 249/343 (72%), Gaps = 13/343 (3%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ +    V+ +DKLTYAGNL SLK +S +  ++F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVIRHIIMNTNDSVINVDKLTYAGNLESLKLVSTNPRYNFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     ++QPDA+++ AAESHVDRSI G  +FI TNI+GT+ILLE  R +W+ L  
Sbjct: 61  DRATLERVFSQYQPDAVMHLAAESHVDRSITGPSDFIQTNIVGTYILLEAARQYWTQLDA 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG-------------LFSEDMPYNPSSPYSATKASSDYL 167
           ++K  FRF  ISTDEVYG L                LF+E  PY PSSPYSA+KASSD+L
Sbjct: 121 ERKAAFRFHHISTDEVYGDLPHPDEQEGQAVNQYLPLFTETTPYAPSSPYSASKASSDHL 180

Query: 168 VLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVE 227
           V AW  TYG P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVE
Sbjct: 181 VRAWLRTYGFPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKSLPIYGKGDQIRDWLYVE 240

Query: 228 DHVRALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDR 287
           DH RALY V+ +G++GE YNIGG+NE++NI++V  I  +LD+L+PK+  + E I F+ DR
Sbjct: 241 DHARALYKVVTEGKVGETYNIGGHNEKQNIEVVKTICSILDSLVPKATPYAEQITFVTDR 300

Query: 288 PGHDRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           PGHDRRYAID+SK+ +E+ W PQE  E+GL KT+ WYL N  W
Sbjct: 301 PGHDRRYAIDASKMSAELNWQPQETFETGLRKTIEWYLANQEW 343


>gi|330829236|ref|YP_004392188.1| dTDP-glucose 4,6-dehydratase [Aeromonas veronii B565]
 gi|328804372|gb|AEB49571.1| dTDP-glucose 4,6-dehydratase [Aeromonas veronii B565]
          Length = 361

 Score =  412 bits (1059), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 191/340 (56%), Positives = 250/340 (73%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ D +  V+ +DKLTYAGNL SL ++S S+ ++F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIIRDTQDAVINLDKLTYAGNLESLADVSSSDRYAFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +R  +       QPDA+++ AAESHVDRSI G  +FI TNI+GT++LLE  R +W+ L +
Sbjct: 61  NRAELDRVFALHQPDAVMHLAAESHVDRSITGPADFIETNIVGTYMLLEAARAYWNGLDE 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
            +K  FRF  ISTDEVYG L             LF+E  PY PSSPYSA+KASSD+LV A
Sbjct: 121 ARKAAFRFHHISTDEVYGDLPHPDEVAAGEPLPLFTETTPYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   ++G  + +YG G  VRDWLYVEDH 
Sbjct: 181 WRRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALDGKPLPVYGKGDQVRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+  G +GE YNIGG+NE++N+++V+ I  LLD ++PKS S+ E I ++ DRPGH
Sbjct: 241 RALYKVVTTGLVGETYNIGGHNEKQNLEVVYTICDLLDEMVPKSGSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID++K+ +E+ W PQE  ESG+ KTV WYLDN  W
Sbjct: 301 DRRYAIDATKMSAELAWQPQETFESGIRKTVQWYLDNQQW 340


>gi|294637939|ref|ZP_06716207.1| dTDP-glucose 4,6-dehydratase [Edwardsiella tarda ATCC 23685]
 gi|291088900|gb|EFE21461.1| dTDP-glucose 4,6-dehydratase [Edwardsiella tarda ATCC 23685]
          Length = 356

 Score =  412 bits (1059), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 193/339 (56%), Positives = 249/339 (73%), Gaps = 6/339 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R++VTGGAGFIGSA+ R+++      V+V+DKLTYAGNL SL  ++QS+ ++F + DI D
Sbjct: 5   RILVTGGAGFIGSAVVRHIIAQTSDSVVVVDKLTYAGNLASLAPVAQSDRYAFERADIGD 64

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +   L ++QPDAI++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W  L   
Sbjct: 65  RAAMDRILAQYQPDAIMHLAAESHVDRSIDGPAAFIQTNIVGTYTLLEAARAYWITLPAT 124

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           ++  FRF  ISTDEVYG L   + LF ED PY PSSPYSA+KASSD+LV AW  TYG+PV
Sbjct: 125 RRAAFRFHHISTDEVYGDLQGPQDLFREDTPYAPSSPYSASKASSDHLVRAWLRTYGLPV 184

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+G  VRDWLYVEDH RALY V+  
Sbjct: 185 LVTNCSNNYGPYHFPEKLIPLTIINALAGKPLPVYGNGLQVRDWLYVEDHARALYRVVTA 244

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NER+NID+V  +  LL  ++P++ +    + +LI ++ DRPGHD RYA
Sbjct: 245 GKVGETYNIGGHNERRNIDVVTTLCALLQEMVPQTPAGVARYADLITYVTDRPGHDLRYA 304

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           ID+SKI+ E+GW P+E  ESG+ KTV WYL N  WWR +
Sbjct: 305 IDASKIERELGWRPEETFESGIRKTVAWYLANVPWWRAV 343


>gi|187880502|gb|ACD37020.1| RmlB [Shigella boydii]
          Length = 361

 Score =  412 bits (1059), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 193/340 (56%), Positives = 243/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHTDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNTEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +E   + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEDKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDADKIGRELGWKPQETFESGIRKTVEWYLSNTKW 340


>gi|213967233|ref|ZP_03395382.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. tomato T1]
 gi|213928075|gb|EEB61621.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. tomato T1]
          Length = 384

 Score =  412 bits (1059), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 195/334 (58%), Positives = 249/334 (74%), Gaps = 4/334 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           ++++VTGGAGFIGSA+ R+++ +    V+ +DKLTYAGNL SL+   QS  ++F  VDIC
Sbjct: 28  LKILVTGGAGFIGSAVIRHIIANTTDSVVNVDKLTYAGNLESLQSADQSERYAFEHVDIC 87

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +RE +    KE QPDA+++ AAESHVDRSI G  EFI TNIIGT++LLE  R +W+ L +
Sbjct: 88  NREDLDRVFKEHQPDAVMHLAAESHVDRSITGPSEFIQTNIIGTYVLLEAARSYWNQLDE 147

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K  FRF  ISTDEVYG L+  + LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 148 ARKASFRFHHISTDEVYGDLEGPEDLFTETTPYQPSSPYSASKASSDHLVRAWSRTYGLP 207

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            L++NCSNNYGP HFPEKLIPL I   +EG  + +YG G  VRDWLYVEDH RALY V+ 
Sbjct: 208 TLVTNCSNNYGPCHFPEKLIPLIILNALEGKPLPIYGKGDQVRDWLYVEDHARALYKVVT 267

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY--SHTELIRFIEDRPGHDRRYAI 296
           +G IGE YNIGG+NE++N+++V  +  LLD L P S    H  LI +++DRPGHD RYAI
Sbjct: 268 EGEIGETYNIGGHNEKQNLEVVNTVCALLDQLRPDSAHRPHANLITYVQDRPGHDLRYAI 327

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           D+SKI+ E+GW P+E+ ESG+ KTV WYLDN  W
Sbjct: 328 DASKIQRELGWVPEESFESGIRKTVQWYLDNPEW 361


>gi|221134345|ref|ZP_03560650.1| dTDP-glucose 4,6 dehydratase [Glaciecola sp. HTCC2999]
          Length = 357

 Score =  412 bits (1058), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 193/338 (57%), Positives = 247/338 (73%), Gaps = 8/338 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSAL RYL+     +VL +DKLTYAGNL SL ++S    + F+Q+DI 
Sbjct: 1   MKILVTGGAGFIGSALIRYLIQHTSHEVLNVDKLTYAGNLTSLSDVSDDPRYRFVQIDIV 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D + ++     FQPDA+++ AAESHVDRSIL ADEFI TNI+GTF LL+  R +W+ L  
Sbjct: 61  DSQALKQTFATFQPDAVMHLAAESHVDRSILAADEFIQTNIVGTFNLLDVARRYWAQLPA 120

Query: 121 DKKDQFRFLQISTDEVYGSLDK--------GLFSEDMPYNPSSPYSATKASSDYLVLAWG 172
           DK+ +FRF  ISTDEVYG L           LFSE  PY PSSPY+A+KA+SD+LV AW 
Sbjct: 121 DKQSRFRFQHISTDEVYGDLPHPNDADFTGQLFSETTPYAPSSPYAASKAASDHLVNAWC 180

Query: 173 HTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRA 232
            TYG+P+L++NCSNNYGPYHFPEKLIPL I   +E   + +YG G  +RDWLYVEDHV A
Sbjct: 181 RTYGLPILMTNCSNNYGPYHFPEKLIPLTILNALEQKTIPIYGKGTQIRDWLYVEDHVEA 240

Query: 233 LYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDR 292
           LYLVL++G IGE YNIGG+NE +N+ +V  +   LD L+P+S S+  LIR ++DR GHDR
Sbjct: 241 LYLVLQQGHIGETYNIGGHNEVENLQLVHILCDTLDKLVPQSTSYKTLIRHVDDRLGHDR 300

Query: 293 RYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           RYAID+SKI  E+GW P+  +E GL KT+ W +D+  W
Sbjct: 301 RYAIDASKIHKELGWKPRHTLEQGLQKTIKWVIDHRAW 338


>gi|20502681|gb|AAM22544.1|AF343089_1 putative dTDP-glucose-4-6-dehydratase [Aeromonas hydrophila]
          Length = 379

 Score =  412 bits (1058), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 190/340 (55%), Positives = 248/340 (72%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ D    V+ +DKLTYAGNL SL  ++ S  ++F QVDIC
Sbjct: 19  MKILVTGGAGFIGSAVVRHIIRDTNDSVINLDKLTYAGNLESLASVANSERYAFEQVDIC 78

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +R  +     ++QPDA+++ AAESHVDRSI G  +FI TNI+GT++LLE  R +W+ L +
Sbjct: 79  NRAELDRVFAQYQPDAVMHLAAESHVDRSITGPADFIETNIVGTYMLLEAARAYWNGLDE 138

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
            +K  FRF  ISTDEVYG L             LF+E  PY PSSPYSA+KASSD+LV A
Sbjct: 139 VRKAAFRFHHISTDEVYGDLPHPDEVAPGVALPLFTETTPYAPSSPYSASKASSDHLVRA 198

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   ++G  + +YG G  +RDWLYVEDH 
Sbjct: 199 WRRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALDGKPLPVYGKGDQIRDWLYVEDHA 258

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+  G IGE YNIGG+NE++N+D+V  I  LLD ++PK+ S+ + I ++ DRPGH
Sbjct: 259 RALYTVVTTGAIGETYNIGGHNEKQNLDVVHTICDLLDEMVPKAGSYRDQITYVADRPGH 318

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+SK+ +E+ W PQE  ESG+ KTV WYLDN  W
Sbjct: 319 DRRYAIDASKMSAELAWQPQETFESGIRKTVQWYLDNQQW 358


>gi|16611737|gb|AAL27322.1|AF402313_2 dTDP-D-glucose 4,6-dehydratase [Shigella boydii]
          Length = 361

 Score =  412 bits (1058), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 193/340 (56%), Positives = 243/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDG 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNKEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW  QE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKISRELGWKQQETFESGIRKTVEWYLSNTKW 340


>gi|153010044|ref|YP_001371259.1| dTDP-glucose 4,6-dehydratase [Ochrobactrum anthropi ATCC 49188]
 gi|151561932|gb|ABS15430.1| dTDP-glucose 4,6-dehydratase [Ochrobactrum anthropi ATCC 49188]
          Length = 358

 Score =  412 bits (1058), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 194/338 (57%), Positives = 248/338 (73%), Gaps = 4/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M ++VTGGAGFIGSA+CR+L +D K+ V+ +DKLTYAGNL SL++I     +SFL+ DIC
Sbjct: 1   MNILVTGGAGFIGSAVCRHLASDPKVNVVNLDKLTYAGNLASLRQIENHPNYSFLEADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +  AL+  + D +++ AAESHVDRSI G   FI TNI+GTF LL     +W  L +
Sbjct: 61  DDTSVLEALRAHEIDVVMHLAAESHVDRSIDGPGAFIETNIVGTFRLLNAALAYWRELPE 120

Query: 121 DKKDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K  FRF  ISTDEV+G L  D G+F+E+ PY PSSPYSA+KA+SD+LV AW  TYG+P
Sbjct: 121 SRKSNFRFHHISTDEVFGDLPFDSGIFTEETPYQPSSPYSASKAASDHLVRAWHETYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+L+NCSNNYGP+HFPEKLIPL I   ++   + +YG G NVRDWLYVEDH RAL LV  
Sbjct: 181 VVLTNCSNNYGPFHFPEKLIPLVILNALDEKPLPVYGAGANVRDWLYVEDHARALALVAT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS--YSHTELIRFIEDRPGHDRRYAI 296
            G++GE YNIGG  ER N+ +V  I  +LD   P++   S+ +LI F+ DRPGHDRRYAI
Sbjct: 241 TGKLGESYNIGGRAERTNLSVVETICAILDKKRPRANGKSYADLITFVTDRPGHDRRYAI 300

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           D+SKI+ E+GW PQE+ E+GL KT+ WYLDN WWW P+
Sbjct: 301 DASKIERELGWKPQESFETGLEKTIQWYLDNAWWWEPI 338


>gi|242240688|ref|YP_002988869.1| dTDP-glucose 4,6-dehydratase [Dickeya dadantii Ech703]
 gi|242132745|gb|ACS87047.1| dTDP-glucose 4,6-dehydratase [Dickeya dadantii Ech703]
          Length = 353

 Score =  411 bits (1057), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 192/337 (56%), Positives = 251/337 (74%), Gaps = 6/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+    V+ +DKLTYAGNL SL  I +S  ++F +VDIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTADAVVNLDKLTYAGNLESLTTIDKSERYTFERVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +R  + S  ++ QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE TR +WS L +
Sbjct: 61  NRTALDSVFQQHQPDMVMHLAAESHVDRSIDGPAAFIQTNIVGTYTLLEATRAYWSALPE 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K  FRF  ISTDEVYG L+K   LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 SRKSAFRFHHISTDEVYGDLEKTDDLFTESTPYAPSSPYSASKASSDHLVRAWYRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            L++NCSNNYGPYHFPEKLIPL I   + G  + +YGDGQ +RDWL+VEDH RALY V+ 
Sbjct: 181 TLVTNCSNNYGPYHFPEKLIPLIILNALAGKPLPVYGDGQQIRDWLFVEDHARALYNVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHT----ELIRFIEDRPGHDRRY 294
           +G+IGE YNIGG+NE+ NI++V  I  LL+ L+P+   H     +LI +++DRPGHD RY
Sbjct: 241 EGKIGETYNIGGHNEKTNIEVVETICQLLEELVPQKPQHVVFYKDLITYVKDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           AID+SKI  E+ W P E+ ++G+ KTV WYL+N  WW
Sbjct: 301 AIDASKISRELNWKPHESFDTGIRKTVLWYLNNKSWW 337


>gi|330887874|gb|EGH20535.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. mori str.
           301020]
          Length = 357

 Score =  411 bits (1057), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 196/334 (58%), Positives = 248/334 (74%), Gaps = 4/334 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ +    V+ +DKLTYAGNL SL+   QS  ++F  VDIC
Sbjct: 1   MKILVTGGAGFIGSAVIRHIIANTADSVVNVDKLTYAGNLESLQSADQSERYAFEHVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +RE +    KE QPDA+++ AAESHVDRSI G  EFI TNIIGT++LLE  R +WS L +
Sbjct: 61  NREDLDRVFKEHQPDAVMHLAAESHVDRSITGPSEFIQTNIIGTYVLLEAARSYWSQLDE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K  FRF  ISTDEVYG L+  + LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 VRKASFRFHHISTDEVYGDLEGPEDLFTETTPYQPSSPYSASKASSDHLVRAWSRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            L++NCSNNYGP HFPEKLIPL I   +EG  + +YG G  VRDWLYVEDH RALY V+ 
Sbjct: 181 TLVTNCSNNYGPCHFPEKLIPLIILNALEGKPLPIYGKGDQVRDWLYVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY--SHTELIRFIEDRPGHDRRYAI 296
           +G IGE YNIGG+NE++N+++V  +  LLD L   S    H  LI +++DRPGHD RYAI
Sbjct: 241 EGEIGETYNIGGHNEKQNLEVVNTVCALLDQLRQDSAHRPHASLITYVQDRPGHDLRYAI 300

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           D+SKI+ E+GW P+E+ ESG+ KTV WYLDN  W
Sbjct: 301 DASKIQRELGWMPEESFESGIRKTVQWYLDNPEW 334


>gi|15804379|ref|NP_290419.1| dTDP-glucose 4,6-dehydratase [Escherichia coli O157:H7 EDL933]
 gi|12518652|gb|AAG58983.1|AE005610_7 dTDP-glucose 4,6-dehydratase [Escherichia coli O157:H7 str. EDL933]
          Length = 355

 Score =  411 bits (1057), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 195/335 (58%), Positives = 241/335 (71%), Gaps = 6/335 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS  F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E QPD +++ AAESHVDR I G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEHQPDCVMHLAAESHVDRXIDGPAAFIETNIVGTYTLLEAARAYWNALTED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDE YG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEXYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V   
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+D+V  I  LL+ L P        + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLDVVETICELLEELAPNKPQGVVHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 303 IDASKIARELGWLPQETFESGMRKTVQWYLANESW 337


>gi|283785861|ref|YP_003365726.1| dTDP-glucose 4,6-dehydratase [Citrobacter rodentium ICC168]
 gi|282949315|emb|CBG88926.1| dTDP-glucose 4,6-dehydratase [Citrobacter rodentium ICC168]
          Length = 361

 Score =  411 bits (1057), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 192/340 (56%), Positives = 247/340 (72%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ IDKLTYAGNL SL +IS SN + F + DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVINIDKLTYAGNLESLNDISDSNRYVFERADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     +++PDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +W+ L  
Sbjct: 61  DATAMARIFTKYKPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAAREYWTALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           +KK  FRF  ISTDEVYG L          D  LF+E  PY PSSPYSA+KASSD+LV A
Sbjct: 121 EKKQAFRFHHISTDEVYGDLPHPDEVDANSDLPLFTEKTPYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  T+G+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WLRTFGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKTLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE++N+D+V  I  LLD ++PK  S+ + I ++ DRPGH
Sbjct: 241 RALYTVVTQGKPGETYNIGGHNEKQNLDVVHTICDLLDEIVPKEGSYRDQITYVTDRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKISRELGWKPQETFESGIRKTVEWYLANAQW 340


>gi|168481275|gb|ACA24767.1| RmlB [Shigella flexneri 6]
          Length = 361

 Score =  411 bits (1057), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 192/340 (56%), Positives = 243/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIG A+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGFAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK +FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKTRFRFHHISTDEVYGDLPHPDEVNNTEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KT+ WYL N  W
Sbjct: 301 DRRYAIDAEKISRELGWKPQETFESGIRKTLEWYLSNTKW 340


>gi|332159800|ref|YP_004296377.1| dTDP-D-glucose-4,6-dehydratase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|318607661|emb|CBY29159.1| dTDP-glucose 4,6-dehydratase [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325664030|gb|ADZ40674.1| dTDP-D-glucose-4,6-dehydratase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330863551|emb|CBX73666.1| dTDP-glucose 4,6-dehydratase [Yersinia enterocolitica W22703]
          Length = 355

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 194/337 (57%), Positives = 249/337 (73%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R++VTGGAGFIGSA+ R++++D    V+V+DKLTYAGNL SL  ++ S  ++F QVDICD
Sbjct: 3   RILVTGGAGFIGSAVVRHIIDDTSDSVVVVDKLTYAGNLESLAVVAHSERYAFEQVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     ++QPD +++ AAESHVDRSI G   FI TN++GT+ +LE  R +W  L  +
Sbjct: 63  RAELDRVFAQYQPDVVMHLAAESHVDRSIDGPAAFIETNVVGTYQMLEAARHYWQPLDAE 122

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKLAFRFHHISTDEVYGDLHGTDDLFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+G  VRDWL+VEDH RALY V+ +
Sbjct: 183 LVTNCSNNYGPYHFPEKLIPLVILNALAGKPLPVYGNGAQVRDWLFVEDHARALYQVVTE 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NERKNI++V  I  LLD L+P+  +    + +LI F++DRPGHD RYA
Sbjct: 243 GVVGETYNIGGHNERKNIEVVETICALLDELVPEKPAGIAHYRDLITFVKDRPGHDMRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI+ E+GW PQE  ESG+ KTV WYL+N  WW+
Sbjct: 303 IDASKIERELGWRPQETFESGIRKTVLWYLNNKSWWQ 339


>gi|331647692|ref|ZP_08348784.1| dTDP-glucose 4,6-dehydratase [Escherichia coli M605]
 gi|331043416|gb|EGI15554.1| dTDP-glucose 4,6-dehydratase [Escherichia coli M605]
          Length = 361

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 192/340 (56%), Positives = 243/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   D+C
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLVDVSDSERYVFEHADVC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNTEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKGLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEISYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAI + KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIGAEKIGRELGWKPQETFESGIRKTVEWYLSNTKW 340


>gi|288963204|ref|YP_003453483.1| dTDP-glucose 4,6-dehydratase [Azospirillum sp. B510]
 gi|288915456|dbj|BAI76939.1| dTDP-glucose 4,6-dehydratase [Azospirillum sp. B510]
          Length = 355

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 195/334 (58%), Positives = 247/334 (73%), Gaps = 1/334 (0%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R++VTGGAGFIGSA+ R L+ +    V+ +DKLTYA NL+SL   + +  ++F QVDICD
Sbjct: 3   RILVTGGAGFIGSAVVRQLLAETDAFVVNVDKLTYAANLSSLPGAAGNPRYAFEQVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
              +R      QPDA+++ AAESHVDRSI G  EFI TN++GTF LLE  R +WS L  +
Sbjct: 63  AAELRRVFDTHQPDAVMHLAAESHVDRSIDGPGEFIQTNVVGTFRLLEAVRGYWSALPVE 122

Query: 122 KKDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           +K++FRF  ISTDEV+G+L D G F+E   Y+P+SPYSA+KASSD+LV AW  TYG+PV+
Sbjct: 123 RKERFRFHHISTDEVFGTLGDDGFFTETTAYSPNSPYSASKASSDHLVRAWHETYGLPVV 182

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           L+NCSNNYGPYHFPEKLIPL I + + G  + +YG G N+RDWLYVEDH RAL LVL+KG
Sbjct: 183 LTNCSNNYGPYHFPEKLIPLMILKGLAGEKLPVYGKGDNIRDWLYVEDHARALRLVLEKG 242

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSSK 300
           RIGE YNIGG+NER N+++V  I   LD + P    H  LI F+ DRPGHD+RYAID+ K
Sbjct: 243 RIGESYNIGGHNERTNLEVVRAICAHLDDMDPAGAPHDRLISFVTDRPGHDKRYAIDAGK 302

Query: 301 IKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           I+ E+GW P E  ESGL KTV WYL+N  WW+ +
Sbjct: 303 IERELGWTPLETFESGLRKTVAWYLENRDWWQAI 336


>gi|298353046|gb|ADI77024.1| RmlB [Escherichia coli]
          Length = 361

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 192/340 (56%), Positives = 242/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNKEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ G  YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGGTYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ K   E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKTGRELGWKPQETFESGIRKTVEWYLSNTKW 340


>gi|16129981|ref|NP_416545.1| dTDP-glucose 4,6 dehydratase, NAD(P)-binding [Escherichia coli str.
           K-12 substr. MG1655]
 gi|89108861|ref|AP_002641.1| dTDP-glucose 4,6 dehydratase, NAD(P)-binding [Escherichia coli str.
           K-12 substr. W3110]
 gi|170081671|ref|YP_001730991.1| dTDP-glucose 4,6 dehydratase, NAD(P)-binding [Escherichia coli str.
           K-12 substr. DH10B]
 gi|238901231|ref|YP_002927027.1| dTDP-glucose 4,6 dehydratase, NAD(P)-binding [Escherichia coli
           BW2952]
 gi|2506451|sp|P37759|RMLB1_ECOLI RecName: Full=dTDP-glucose 4,6-dehydratase 1
 gi|1736731|dbj|BAA15883.1| dTDP-glucose 4,6 dehydratase, NAD(P)-binding [Escherichia coli str.
           K12 substr. W3110]
 gi|1788353|gb|AAC75102.1| dTDP-glucose 4,6 dehydratase, NAD(P)-binding [Escherichia coli str.
           K-12 substr. MG1655]
 gi|2665489|gb|AAB88398.1| dTDP-D-glucose 4,6-dehydratase [Escherichia coli]
 gi|169889506|gb|ACB03213.1| dTDP-glucose 4,6 dehydratase, NAD(P)-binding [Escherichia coli str.
           K-12 substr. DH10B]
 gi|238861014|gb|ACR63012.1| dTDP-glucose 4,6 dehydratase, NAD(P)-binding [Escherichia coli
           BW2952]
 gi|260448859|gb|ACX39281.1| dTDP-glucose 4,6-dehydratase [Escherichia coli DH1]
 gi|315136675|dbj|BAJ43834.1| dTDP-glucose 4,6 dehydratase [Escherichia coli DH1]
          Length = 361

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 192/340 (56%), Positives = 242/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGN  SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNRESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAPAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNTEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI   +GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKIGRALGWKPQETFESGIRKTVEWYLSNTKW 340


>gi|110666542|gb|ABG81781.1| RmlB [Escherichia coli]
          Length = 357

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 193/342 (56%), Positives = 245/342 (71%), Gaps = 10/342 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNSNEALPLFTEMTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G +GE YNIGG NE+KN+D+V  I  LLD ++PK  S+ + I ++ DRPGH
Sbjct: 241 RALYTVMTQGVVGETYNIGGRNEKKNLDVVNTICDLLDEIVPKQGSYRDQIIYVTDRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           DRRYAID+SKI  E+GW PQE  ESG+ KT+ WYL+N  W R
Sbjct: 301 DRRYAIDASKISDELGWKPQETFESGIRKTIGWYLNNLEWCR 342


>gi|153870011|ref|ZP_01999499.1| NAD-dependent epimerase/dehydratase [Beggiatoa sp. PS]
 gi|152073521|gb|EDN70499.1| NAD-dependent epimerase/dehydratase [Beggiatoa sp. PS]
          Length = 351

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 193/335 (57%), Positives = 251/335 (74%), Gaps = 3/335 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+LI+TGGAGFIGSA+ RYL+N+    VL +DKLTYAGNL+SL  I  +  + F Q+DIC
Sbjct: 1   MKLIITGGAGFIGSAVIRYLMNETDTTVLNLDKLTYAGNLDSLITIKNNERYHFAQIDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     ++QP AI++ AAESHVDRSI G  EFI TNI+GT+ LLE TR +W  L  
Sbjct: 61  DGPALERVFADYQPQAIMHLAAESHVDRSIDGPAEFINTNIVGTYTLLETTRHYWQTLEN 120

Query: 121 DKKDQFRFLQISTDEVYGSLDK-GLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            +K++FRF  +STDEVYGSL K GLF E   Y P+SPYSA+KA+SD+LV +W HTY +PV
Sbjct: 121 SEKEKFRFHHVSTDEVYGSLGKQGLFEESTCYQPNSPYSASKAASDHLVRSWHHTYKLPV 180

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           + +NCSNNYGPY FPEKLIPL I   +EG  + +YG G+NVRDWLYV+DH RAL LVLK+
Sbjct: 181 ITTNCSNNYGPYQFPEKLIPLIILNALEGKPLPVYGKGENVRDWLYVDDHARALDLVLKQ 240

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS--YSHTELIRFIEDRPGHDRRYAID 297
           G++GE YNIGG+NE+ N+++V  +  +LD ++P S    H++LI F+ DRPGHD RYAID
Sbjct: 241 GQLGETYNIGGHNEKTNLEVVQVLCNILDEILPNSPHKPHSQLITFVTDRPGHDLRYAID 300

Query: 298 SSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           +SKI+  + W P+E  ++GL KTV WYL+NN WW+
Sbjct: 301 ASKIQKTLNWTPKETFDTGLRKTVQWYLENNKWWQ 335


>gi|237732092|ref|ZP_04562573.1| dTDP-D-glucose-4,6-dehydratase [Citrobacter sp. 30_2]
 gi|226907631|gb|EEH93549.1| dTDP-D-glucose-4,6-dehydratase [Citrobacter sp. 30_2]
          Length = 361

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 243/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ D +  V+ +DKLTYAGNL SL E+S+SN + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIIKDTQDTVVNVDKLTYAGNLESLAEVSESNRYYFEHTDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D+  +       +PDA+++ AAESHVDRSI G   FI TNI+GT+ILLE  R +W+ L  
Sbjct: 61  DKSAMERIFATHKPDAVMHLAAESHVDRSITGPAAFIETNIVGTYILLEAARGYWNELDA 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK  FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKQAFRFHHISTDEVYGDLPHPDEVVACNVLPLFTEKTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WLRTYGFPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G +GE YNIGG+NE+KN+D+V  I  LLDA++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTQGIVGETYNIGGHNEKKNLDVVHTICDLLDAIVPKGGSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID++KI  E+GW P E  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAAKISDELGWKPLETFESGIRKTVQWYLANQKW 340


>gi|9957845|gb|AAG09522.1|AF279621_1 dTDP-D-glucose-4,6-dehydratase [Salmonella enterica]
          Length = 361

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 192/340 (56%), Positives = 248/340 (72%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++++TGGAGFIGSA+ R+++ + +  V+ IDKLTYAGNL SL +IS+SN ++F   DIC
Sbjct: 1   MKILITGGAGFIGSAVVRHIIKNTQDTVVNIDKLTYAGNLESLSDISESNRYNFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   I    +++QPDA+++ AAESHVDRSI G   FI TNI+GT+ILLE  R +WS L +
Sbjct: 61  DSAEIARIFEQYQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYILLEVARKYWSALGE 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVENSVTLPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WRRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKSLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RAL++V+ +G +GE YNIGG+NE+KN+++V  I  LLD ++PK  S+ + I ++ DRPGH
Sbjct: 241 RALHMVVTQGEVGETYNIGGHNEKKNLEVVHTICDLLDEIVPKEGSYRDQITYVGDRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW P E  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDADKISRELGWKPLETFESGIRKTVEWYLANTQW 340


>gi|72003791|gb|AAZ65831.1| putative dTDP-glucose 4,6 dehydratase [Escherichia coli]
 gi|115503035|gb|ABI98960.1| RmlB [Escherichia coli]
 gi|332343822|gb|AEE57156.1| dTDP-glucose 4,6-dehydratase RfbB [Escherichia coli UMNK88]
          Length = 361

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 193/340 (56%), Positives = 242/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFSQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L             LF E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNKEKLPLFIETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKMLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAI++ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAINAEKIGRELGWKPQETFESGIRKTVEWYLANAKW 340


>gi|110666559|gb|ABG81797.1| RmlB [Escherichia coli]
          Length = 357

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 193/342 (56%), Positives = 245/342 (71%), Gaps = 10/342 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNSNEALPLFTEMTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G +GE YNIGG NE+KN+D+V  I  LLD ++PK  S+ + I ++ DRPGH
Sbjct: 241 RALYTVMTQGVVGETYNIGGRNEKKNLDVVNTICDLLDEIVPKQGSYRDQIIYVTDRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           DRRYAID+SKI  E+GW PQE  ESG+ KT+ WYL+N  W R
Sbjct: 301 DRRYAIDASKISDELGWKPQETFESGIRKTIGWYLNNLEWCR 342


>gi|168481239|gb|ACA24734.1| RmlB [Escherichia coli]
          Length = 361

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 192/340 (56%), Positives = 242/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVINVDKLTYAGNLESLADVSDSERYIFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QP A+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQPHAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNTEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+  I  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAENIGRELGWKPQETFESGIRKTVEWYLSNTKW 340


>gi|1710031|sp|P55293|RFBB_ECOLX RecName: Full=dTDP-glucose 4,6-dehydratase
 gi|799232|gb|AAC63612.1| RmlB [Escherichia coli]
          Length = 361

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 198/340 (58%), Positives = 243/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL EIS S  +SF   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLAEISDSERYSFENADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D E       + Q DA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAEGDGLYFGQHQLDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSGLDD 120

Query: 121 DKKDQFRFLQISTDEVYGSLDK----------GLFSEDMPYNPSSPYSATKASSDYLVLA 170
           +KK  FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 EKKKNFRFHHISTDEVYGDLPHPDEVNSNETLQLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P ++SNCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVSNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+VF I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVFTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDADKISRELGWKPQETFESGIRKTVEWYLANTNW 340


>gi|295148975|gb|ADF80974.1| dTDP-glucose 4,6-dehydratase [Vibrio cholerae]
          Length = 362

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 190/342 (55%), Positives = 249/342 (72%), Gaps = 10/342 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++++TGGAGFIGSA+ R+++ND +  V+ +DKLTYAGNL SL  ++    ++F QVDIC
Sbjct: 1   MKILITGGAGFIGSAVVRHIINDTQDSVVNLDKLTYAGNLESLANVAGCERYAFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +R  +     E+QPDA+++ AAESHVDRSI G   FI TNI+GTF LLE TR +W+ L  
Sbjct: 61  ERSELDRVFAEYQPDAVMHLAAESHVDRSITGPAAFIETNIVGTFTLLEATREYWNKLDD 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
             K  FRF  ISTDEVYG L          +  LF E  PY PSSPYSA+KASSD+LV A
Sbjct: 121 KAKQAFRFHHISTDEVYGDLPHPDEVADGSELPLFLETTPYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGP+HFPEKLIPL I   +EG  + +YG G  +RDWL+VEDH 
Sbjct: 181 WLRTYGLPAIVTNCSNNYGPFHFPEKLIPLVILNALEGKQLPIYGKGDQIRDWLFVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G++GE YNIGG+NE++N+++V  I  +LD L+PK   + E IR+++DRPGH
Sbjct: 241 RALYKVVTEGKVGETYNIGGHNEKQNLEVVQAICSILDELVPKVTPYAEQIRYVQDRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           DRRYAI+SSK++ E+GW P E  E+GL KTV WYLDN  W +
Sbjct: 301 DRRYAINSSKMQRELGWTPIETFETGLRKTVQWYLDNQQWCK 342


>gi|146309303|ref|YP_001189768.1| dTDP-glucose 4,6-dehydratase [Pseudomonas mendocina ymp]
 gi|145577504|gb|ABP87036.1| dTDP-glucose 4,6-dehydratase [Pseudomonas mendocina ymp]
          Length = 353

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 199/338 (58%), Positives = 248/338 (73%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR+++TGGAGFIGSAL R+L+   + +VL +DKLTYAGNL SL E++ S  + F++ DI 
Sbjct: 1   MRILITGGAGFIGSALIRHLIRHTEHEVLNLDKLTYAGNLESLAEVAGSPRYRFVRADIA 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +   L EFQPDAI++ AAESHVDRSI G   FI TNI+GT+ LLE TR +W  L  
Sbjct: 61  DSALVAQTLAEFQPDAIMHLAAESHVDRSIDGPAAFIQTNIVGTYALLESTRAYWQQLDA 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           ++K  FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KA+SD+LV AW  TYG+P
Sbjct: 121 ERKAAFRFHHISTDEVYGDLHGVDDLFTETTPYAPSSPYSASKAASDHLVRAWQRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           VL++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ VRDWLYVEDH RAL  V+ 
Sbjct: 181 VLITNCSNNYGPYHFPEKLIPLMILSALAGKPLPVYGNGQQVRDWLYVEDHARALLKVVC 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G++GE YNIGG+NE+KN+D+V  I  LL+ L P   S    + +LI +++DRPGHD RY
Sbjct: 241 EGKVGETYNIGGHNEQKNLDVVRAICALLEELAPHKPSGVARYEDLITYVQDRPGHDLRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID+ KI+ E+GW PQE  ESGL KTV WYLDN  W R
Sbjct: 301 AIDAGKIERELGWVPQETFESGLRKTVQWYLDNLDWCR 338


>gi|269137463|ref|YP_003294163.1| dTDP-D-glucose 4,6-dehydratase [Edwardsiella tarda EIB202]
 gi|267983123|gb|ACY82952.1| dTDP-D-glucose 4,6-dehydratase [Edwardsiella tarda EIB202]
 gi|304557537|gb|ADM40201.1| dTDP-glucose 4,6-dehydratase [Edwardsiella tarda FL6-60]
          Length = 356

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 194/339 (57%), Positives = 246/339 (72%), Gaps = 6/339 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R++VTGGAGFIGSA+ R+++ D    V+V+DKLTYAGNL SL   + S+ ++F + DI D
Sbjct: 5   RILVTGGAGFIGSAVVRHIIMDTADSVVVVDKLTYAGNLASLAPAAGSDRYAFERADIGD 64

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +   L +++PDAI++ AAESHVDRSI G  +FI TNI+GT+ LLE TR +WS L   
Sbjct: 65  RAAMDRILAQYRPDAIMHLAAESHVDRSIDGPADFIQTNIVGTYTLLEATRRYWSALPAA 124

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            +  FRF  ISTDEVYG L   + LF ED PY PSSPYSA+KA+SD+LV AW  TYG+P 
Sbjct: 125 PRAAFRFHHISTDEVYGDLHGPQALFREDTPYAPSSPYSASKAASDHLVRAWLRTYGLPT 184

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   +    + +YG+G  VRDWLYVEDH RALY VL  
Sbjct: 185 LITNCSNNYGPYHFPEKLIPLTIINALAAKPLPVYGNGLQVRDWLYVEDHARALYRVLMT 244

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
           GR+GE YNIGG+NER+NID+V  +  LL  ++P+  +      +LI ++ DRPGHD RYA
Sbjct: 245 GRVGETYNIGGHNERRNIDVVTTLCALLQEMVPEKPAGVRHFADLITYVADRPGHDVRYA 304

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           ID+SKI+ E+GW PQE  ESG+ KTV WYL N  WWR +
Sbjct: 305 IDASKIERELGWRPQETFESGIRKTVAWYLANERWWRAV 343


>gi|50083368|ref|YP_044878.1| dTDP-D-glucose-4,6-dehydratase [Acinetobacter sp. ADP1]
 gi|49529344|emb|CAG67056.1| dTDP-D-glucose-4,6-dehydratase [Acinetobacter sp. ADP1]
          Length = 356

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 193/336 (57%), Positives = 250/336 (74%), Gaps = 6/336 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++++TGGAGFIGSA+ R+++ +    VL +DKLTYAGNL SL +++ ++ + F Q DIC
Sbjct: 2   MKILITGGAGFIGSAVVRHIIQNTDNTVLNVDKLTYAGNLESLAKVADNSRYQFSQTDIC 61

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +    + FQPDA+++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L+Q
Sbjct: 62  DRAALDQLFETFQPDAVMHLAAESHVDRSITGPAAFIETNILGTYQLLEAARHYWNGLAQ 121

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           DKK +FRF  ISTDEVYG L+  + LF E  PY PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 122 DKKAEFRFHHISTDEVYGDLEGTEDLFVETTPYAPSSPYSASKASSDHLVRAWHRTYGLP 181

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+L+NCSNNYGPYHFPEKLIPL I   + G  + +YG+G  +RDWLYVEDH RALY V+ 
Sbjct: 182 VVLTNCSNNYGPYHFPEKLIPLVILNALAGKPLPVYGNGAQIRDWLYVEDHARALYKVVT 241

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRY 294
           + ++GE YNIGG+NE++NID+V  I  LL+ L P       ++ +LI +++DRPGHD RY
Sbjct: 242 EAKVGETYNIGGHNEQQNIDVVKAICNLLEELAPNKPEGIANYQDLITYVKDRPGHDLRY 301

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           AID+SKIK ++GW PQE  ESGL KTV WYL N  W
Sbjct: 302 AIDASKIKKDLGWVPQETFESGLRKTVEWYLANQEW 337


>gi|306814835|ref|ZP_07448997.1| dTDP-glucose 4,6 dehydratase [Escherichia coli NC101]
 gi|305852229|gb|EFM52681.1| dTDP-glucose 4,6 dehydratase [Escherichia coli NC101]
          Length = 361

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 193/340 (56%), Positives = 241/340 (70%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL + S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADASDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSGLDD 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           +KK  FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 EKKKNFRFHHISTDEVYGDLPHPDEVNSNETLPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGQAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDADKISRELGWKPQETFESGIRKTVEWYLSNTKW 340


>gi|209693795|ref|YP_002261723.1| dTDP-D-glucose-4,6-dehydratase [Aliivibrio salmonicida LFI1238]
 gi|209693854|ref|YP_002261782.1| dTDP-D-glucose-4,6-dehydratase [Aliivibrio salmonicida LFI1238]
 gi|208007746|emb|CAQ77865.1| dTDP-D-glucose-4,6-dehydratase [Aliivibrio salmonicida LFI1238]
 gi|208007805|emb|CAQ77928.1| dTDP-D-glucose-4,6-dehydratase [Aliivibrio salmonicida LFI1238]
          Length = 363

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 192/337 (56%), Positives = 250/337 (74%), Gaps = 6/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M ++VTGGAGFIGSA+ R+++++    V+ +D LTYAGNL SL ++  S+ +SF  VDIC
Sbjct: 1   MNILVTGGAGFIGSAVIRHIISNTSNSVINVDSLTYAGNLESLSQVEASDRYSFEHVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +R  +     E+QPDA+++ AAESHVDRSI G   FI TNI+GT+ LLE TR +W+ L+ 
Sbjct: 61  NRTELDRIFSEYQPDAVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEATRAYWNLLAD 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           DKK  FRF  ISTDEVYG L+    LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 DKKQAFRFHHISTDEVYGDLEGTDDLFTETTPYEPSSPYSASKASSDHLVRAWQRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYGPYHFPEKLIPL I   +EG ++ +YG+G  +RDWL+VEDH RALY V+ 
Sbjct: 181 TVITNCSNNYGPYHFPEKLIPLMILNALEGKYLPVYGNGMQIRDWLFVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRY 294
           +G IGE YNIGG+NE+ NI++V  I  LL+ L+P        + +LI ++ DRPGHD RY
Sbjct: 241 EGEIGETYNIGGHNEKANIEVVKTICSLLEELVPNKPEGVAQYLDLITYVTDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           AID+SKI+ E+GW P+E+ ESG+ KTV WYLDN  WW
Sbjct: 301 AIDASKIEHELGWKPEESFESGIRKTVQWYLDNKQWW 337


>gi|260596016|ref|YP_003208587.1| dTDP-glucose 4,6-dehydratase [Cronobacter turicensis z3032]
 gi|260215193|emb|CBA27031.1| dTDP-glucose 4,6-dehydratase [Cronobacter turicensis z3032]
          Length = 365

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 195/337 (57%), Positives = 246/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R +VTGGAGFIGSA+ R+L+ +    VLV+DKLTYAGNL SL  ++Q + F+F QVDICD
Sbjct: 13  RFLVTGGAGFIGSAVVRHLIQNTDHAVLVLDKLTYAGNLASLAPVAQDSRFAFEQVDICD 72

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
            + +     +F+PD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +WS L+  
Sbjct: 73  AQSLDRLFTQFKPDVVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARRYWSELADA 132

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           +K  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KA SD+LV AW  TYG+P 
Sbjct: 133 EKTAFRFHHISTDEVYGDLHGLDDFFTETTPYAPSSPYSASKAGSDHLVRAWRRTYGLPT 192

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RAL LV  +
Sbjct: 193 LVTNCSNNYGPYHFPEKLIPLTILNALAGKPLPVYGNGQQIRDWLYVEDHARALCLVATE 252

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NE+KN+D+V  I  LL+ L P+  +    ++ LI F++DRPGHD RYA
Sbjct: 253 GVVGETYNIGGHNEQKNLDVVKTICALLEELAPQKPAGVDQYSSLITFVQDRPGHDLRYA 312

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI+ E+GW PQE  ESG+ KTV WYLDN  WW+
Sbjct: 313 IDASKIERELGWRPQETFESGMRKTVQWYLDNETWWK 349


>gi|302186453|ref|ZP_07263126.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. syringae
           642]
          Length = 357

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 194/334 (58%), Positives = 248/334 (74%), Gaps = 4/334 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ +    V+ +DKLTYAGNL SL+   +S  ++F  VDIC
Sbjct: 1   MKILVTGGAGFIGSAVIRHIIANTTDSVVNVDKLTYAGNLESLQSADKSERYAFEHVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +RE +    KE QPDA+++ AAESHVDRSI G  EFI TNIIGT+ LLE  R +W+ L +
Sbjct: 61  NREDVDRVFKEHQPDAVMHLAAESHVDRSITGPSEFIQTNIIGTYTLLEAARGYWNQLDE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K  FRF  ISTDEVYG L+  + LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 ARKANFRFHHISTDEVYGDLEGPEDLFTETTPYQPSSPYSASKASSDHLVRAWSRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            L++NCSNNYGP HFPEKLIPL I   +EG  + +YG G  VRDWLYVEDH RALY V+ 
Sbjct: 181 TLVTNCSNNYGPCHFPEKLIPLIILNALEGKPLPIYGKGDQVRDWLYVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY--SHTELIRFIEDRPGHDRRYAI 296
           +G IGE YNIGG+NE++N+++V  +  LLD + P S    H  LI +++DRPGHD RYAI
Sbjct: 241 EGEIGETYNIGGHNEKQNLEVVNTVCALLDQMRPDSAHRPHASLITYVQDRPGHDLRYAI 300

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           D+SKI+ E+GW P+E+ ESG+ KTV WYLDN  W
Sbjct: 301 DASKIQRELGWVPEESFESGIRKTVQWYLDNPEW 334


>gi|86147261|ref|ZP_01065576.1| dTDP-D-glucose 4,6-dehydratase [Vibrio sp. MED222]
 gi|85834976|gb|EAQ53119.1| dTDP-D-glucose 4,6-dehydratase [Vibrio sp. MED222]
          Length = 365

 Score =  410 bits (1053), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 190/340 (55%), Positives = 250/340 (73%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N     V+ +DKLTYAGNL SL E+  +  ++F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVIRHIINKTTDSVVNVDKLTYAGNLESLIEVDSNGRYAFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +R  +     E +PDA+++ AAESHVDRSI G   FI TNI+GT+ LLE TR +W+ L +
Sbjct: 61  NRSELDRVFSEHKPDAVMHLAAESHVDRSITGPAAFIETNIVGTYTLLEATREYWNKLEE 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           D K +FRF  ISTDEVYG L          +  +F E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DAKAEFRFHHISTDEVYGDLPHPDEVPEGTELPMFLETTSYEPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWL+VEDH 
Sbjct: 181 WLRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKDLPIYGKGDQIRDWLFVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G++GE YNIGG+NE+KN+++V  I  +LD L+PK  ++ E I +++DRPGH
Sbjct: 241 RALYKVVSEGKVGETYNIGGHNEKKNLEVVNTICDILDTLVPKESAYAEQITYVQDRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAIDSSK++ E+GW P+E  E+GL KTV WYLDN+ W
Sbjct: 301 DRRYAIDSSKMQRELGWTPEETFETGLRKTVQWYLDNSAW 340


>gi|206577340|ref|YP_002241145.1| dTDP-glucose 4,6-dehydratase [Klebsiella pneumoniae 342]
 gi|206566398|gb|ACI08174.1| dTDP-glucose 4,6-dehydratase [Klebsiella pneumoniae 342]
          Length = 355

 Score =  410 bits (1053), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 197/336 (58%), Positives = 243/336 (72%), Gaps = 6/336 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIGSA+ R ++     +V+V+DKLTYAGNL SL  ++Q   F+F QVDICDR
Sbjct: 4   ILVTGGAGFIGSAVVREIIQHTADRVVVVDKLTYAGNLMSLAPVAQDARFAFEQVDICDR 63

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             +    ++ QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R WW+ L+ +K
Sbjct: 64  GELDRIFRQHQPDTVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARSWWNTLTTEK 123

Query: 123 KDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           K  FRF  ISTDEVYG L   +  F+E  PY PSSPYSA+KASSD+LV AW  TYG+P L
Sbjct: 124 KSAFRFHHISTDEVYGDLHGSEDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPTL 183

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           ++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALYLV  +G
Sbjct: 184 ITNCSNNYGPYHFPEKLIPLTILNALAGKPLPVYGNGQQIRDWLYVEDHARALYLVATRG 243

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALI---PKSYSH-TELIRFIEDRPGHDRRYAI 296
             GE YNIGG+NERKNI++V  I  LL+ L    P+S +H  +LI F+ DRPGHD RYAI
Sbjct: 244 EPGETYNIGGHNERKNIEVVETICQLLEELAPHKPQSVAHYRDLITFVADRPGHDLRYAI 303

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           D+SKI  E+GW P E   SG+ KTV WYL N  WWR
Sbjct: 304 DASKIARELGWTPAETFTSGMRKTVAWYLANESWWR 339


>gi|168481316|gb|ACA24804.1| RmlB [Shigella dysenteriae]
          Length = 361

 Score =  410 bits (1053), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 192/340 (56%), Positives = 241/340 (70%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S    + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDPERYIFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QP A+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQPHAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNKEQLPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKISRELGWKPQETFESGIRKTVEWYLANAKW 340


>gi|306842188|ref|ZP_07474857.1| dTDP-glucose 4,6-dehydratase [Brucella sp. BO2]
 gi|306287775|gb|EFM59206.1| dTDP-glucose 4,6-dehydratase [Brucella sp. BO2]
          Length = 358

 Score =  410 bits (1053), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 195/338 (57%), Positives = 249/338 (73%), Gaps = 4/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M ++VTGGAGFIGSA+CR+L +D +I V+ +DKLTYAGNL SL++I     +SFLQ DIC
Sbjct: 1   MNILVTGGAGFIGSAVCRHLASDPEINVVNLDKLTYAGNLASLRQIENYPNYSFLQADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +  AL+  + D +++ AAESHVDRSI G   FI TNI+GTF LL     +W  L +
Sbjct: 61  DDATVLDALRANEIDVVMHLAAESHVDRSIDGPAAFIETNIVGTFRLLNTALAYWRELPE 120

Query: 121 DKKDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K +FRF  ISTDEV+G L  D G+F+E+ PY PSSPYSA+KA+SD+LV AW  TYG+P
Sbjct: 121 PRKSRFRFHHISTDEVFGDLPFDSGIFTEETPYQPSSPYSASKAASDHLVRAWHETYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+L+NCSNNYGP+HFPEKLIPL I   ++   + +YG G NVRDWLYVEDH RAL LV  
Sbjct: 181 VVLTNCSNNYGPFHFPEKLIPLVILNALDEKPLPVYGAGANVRDWLYVEDHARALALVAT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPK--SYSHTELIRFIEDRPGHDRRYAI 296
            G++GE YNIGG  ER N+++V  I  +LD   P+    S+ +LI F+ DRPGHDRRYAI
Sbjct: 241 TGKLGESYNIGGRAERTNLNVVETICSILDKKRPRENGKSYADLITFVTDRPGHDRRYAI 300

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           D+SKI+ E+GW PQE+ E+GL KT+ WYLDN WWW P+
Sbjct: 301 DASKIERELGWKPQESFETGLGKTIQWYLDNAWWWEPI 338


>gi|239503782|ref|ZP_04663092.1| dTDP-D-glucose-4,6-dehydratase [Acinetobacter baumannii AB900]
          Length = 358

 Score =  410 bits (1053), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 194/336 (57%), Positives = 250/336 (74%), Gaps = 6/336 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ +    VL +DKLTYAGNL SLKE+ Q++ + F Q DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIIKNTNNHVLNVDKLTYAGNLESLKEVDQNSRYQFSQTDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR+ +    KEFQPD +++ AAESHVDRSI G+  FI TNIIGT+ LLE  R +W+ L+ 
Sbjct: 61  DRKALDVLFKEFQPDLVMHLAAESHVDRSITGSAAFIETNIIGTYQLLEAARHYWNNLND 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           DKK  FRF  ISTDEVYG L+    LF E   Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 DKKIAFRFHHISTDEVYGDLEGTDDLFHETTSYAPSSPYSASKASSDHLVRAWNRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+++NCSNNYGPYHFPEKLIPL I   ++G  + +YG G  +RDWLYVEDH RALY V+ 
Sbjct: 181 VVITNCSNNYGPYHFPEKLIPLVILNALKGKALPIYGKGDQIRDWLYVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRY 294
           + ++GE YNIGG+NE+KNID+V  I  LL+ L P        + +LI +++DRPGHD RY
Sbjct: 241 EAKVGETYNIGGHNEQKNIDVVKAICELLEELAPNKPEGVNHYVDLITYVKDRPGHDLRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           AID++KIK ++GW P+E+ E+GL KTV WYL+N  W
Sbjct: 301 AIDATKIKEDLGWVPEESFETGLRKTVEWYLNNQEW 336


>gi|197287133|ref|YP_002153005.1| dTDP-D-glucose-4,6-dehydratase [Proteus mirabilis HI4320]
 gi|194684620|emb|CAR46515.1| dTDP-D-glucose-4,6-dehydratase [Proteus mirabilis HI4320]
          Length = 357

 Score =  409 bits (1052), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 194/337 (57%), Positives = 247/337 (73%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R++VTGGAGFIGSA+ R+++++    V+V+DKLTYAGNL SL  ++ S  ++F QVDICD
Sbjct: 5   RILVTGGAGFIGSAVVRHIIDNTNDSVVVVDKLTYAGNLESLAPVANSERYAFEQVDICD 64

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  + S   ++QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +WS L +D
Sbjct: 65  RAALDSLFAQYQPDIVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARHFWSVLPED 124

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L+     F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 125 KKAAFRFHHISTDEVYGDLEGTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 184

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   I G  + +YG G+ +RDWLYVEDH RALYLV   
Sbjct: 185 LITNCSNNYGPYHFPEKLIPLIILNAISGKPLPVYGKGEQIRDWLYVEDHARALYLVATT 244

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
            + G+ YNIGG+NER+NID+V  I  LL+ L P   +    + +LI  ++DRPGHD RYA
Sbjct: 245 AQPGKTYNIGGHNERRNIDVVTTICELLEELHPNKPAGVAKYVDLITHVKDRPGHDLRYA 304

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID++KI +E+GW PQE  ESG+ KTV WYL+N  WW+
Sbjct: 305 IDAAKIAAELGWKPQETFESGIRKTVLWYLNNQTWWQ 341


>gi|327395969|dbj|BAK13391.1| dTDP-glucose 4,6-dehydratase RffG [Pantoea ananatis AJ13355]
          Length = 356

 Score =  409 bits (1052), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 191/339 (56%), Positives = 252/339 (74%), Gaps = 7/339 (2%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
            ++TGGAGFIGSAL R+L+N+ +  V+V+DKL+YAGNL+SL  ++++  F F +VDICDR
Sbjct: 4   FLITGGAGFIGSALVRFLINETEHNVVVVDKLSYAGNLSSLACVTENPRFKFERVDICDR 63

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             + S   + QPD +++ AAE+HVDRSI G   FI TNI+GT+ LLE  R +W+ L+ D+
Sbjct: 64  AALDSVFSQHQPDCVMHLAAETHVDRSIDGPIAFIETNIVGTYQLLEAARHYWNALTGDR 123

Query: 123 KDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           K  F F  ISTDEV+G LD     F+ED PY PSSPYSATKASSD+LV AW  TYG+PV+
Sbjct: 124 KKNFLFHHISTDEVFGDLDDTSAFFTEDTPYAPSSPYSATKASSDHLVRAWLRTYGLPVI 183

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           ++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ VRDWLYVEDH RALY V+ +G
Sbjct: 184 VTNCSNNYGPYHFPEKLIPLTIINALAGKSLPVYGNGQQVRDWLYVEDHARALYTVVTRG 243

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS-----YSHTELIRFIEDRPGHDRRYA 295
           + GE YNIGG+NER+NI++V  I  LL+ L P+      +++ +LI ++ DRPGHD+RYA
Sbjct: 244 KTGETYNIGGHNERQNIEVVETICCLLEELAPERKLTGLHNYKDLISYVTDRPGHDQRYA 303

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           ID+ KI+ E+GW P E  ESG+ KTV W+LDN  WW+ +
Sbjct: 304 IDARKIERELGWTPLETFESGMRKTVSWFLDNATWWQAI 342


>gi|315125543|ref|YP_004067546.1| dTDP-glucose 4,6 dehydratase, NAD(P)-binding protein
           [Pseudoalteromonas sp. SM9913]
 gi|315014056|gb|ADT67394.1| dTDP-glucose 4,6 dehydratase, NAD(P)-binding protein
           [Pseudoalteromonas sp. SM9913]
          Length = 367

 Score =  409 bits (1052), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 196/345 (56%), Positives = 247/345 (71%), Gaps = 13/345 (3%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR+IVTGGAGFIGSAL R ++ +    V+ +DKLTYAGNL SLK I  +  ++F QVDIC
Sbjct: 1   MRIIVTGGAGFIGSALIRNIIENTNDSVINLDKLTYAGNLESLKLIDNNERYTFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +R  +   LK+F+PDAI++ AAESHVDRSI G  EFI TNI+GT+ LLE  R +W+ L+ 
Sbjct: 61  NRAELDRVLKQFEPDAIMHLAAESHVDRSITGPAEFIQTNIVGTYNLLEAAREYWNTLTD 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG-------------LFSEDMPYNPSSPYSATKASSDYL 167
             K  FRF  ISTDEVYG L                LF+E   Y PSSPYSA+KASSD+L
Sbjct: 121 TAKKAFRFHHISTDEVYGDLPHPDEQDENTLGKELLLFTEKTAYAPSSPYSASKASSDHL 180

Query: 168 VLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVE 227
           V AW  TYG+P++++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVE
Sbjct: 181 VRAWLRTYGLPIIITNCSNNYGPYHFPEKLIPLVILNALEGKELPIYGKGDQIRDWLYVE 240

Query: 228 DHVRALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDR 287
           DH RALY V+ +G++GE YNIGG+NE++NI++V  I  +L+ L+PK  S+ E I F+ DR
Sbjct: 241 DHARALYKVVTEGKVGETYNIGGHNEKQNIEVVKTICSILNELVPKKSSYAEQITFVNDR 300

Query: 288 PGHDRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           PGHDRRYAID+SK+  E+ W P E  E+GL KTV WYLDN  W +
Sbjct: 301 PGHDRRYAIDASKMSEELNWQPVETFETGLRKTVQWYLDNQTWCK 345


>gi|191167723|ref|ZP_03029531.1| dTDP-glucose 4,6-dehydratase [Escherichia coli B7A]
 gi|76366002|gb|ABA42227.1| RmlB [Escherichia coli]
 gi|190902236|gb|EDV61977.1| dTDP-glucose 4,6-dehydratase [Escherichia coli B7A]
          Length = 361

 Score =  409 bits (1052), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 193/340 (56%), Positives = 242/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+    V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTHDSVVNVDKLTYAGNLESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQPDAVMHLAAESHVDRSISGPAAFIETNIVGTYVLLEAARNYWSALDG 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNDTEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGP HFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPNHFPEKLIPLVILNALEGKGLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKIGRELGWKPQETFESGIRKTVEWYLSNTKW 340


>gi|110773112|ref|XP_001123275.1| PREDICTED: dTDP-glucose 4,6-dehydratase-like [Apis mellifera]
          Length = 357

 Score =  409 bits (1051), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 198/354 (55%), Positives = 254/354 (71%), Gaps = 12/354 (3%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M +++TGGAGFIGSA+ RYL+N+   ++L +DKLTYAGNL SL  I+ ++ + F Q DI 
Sbjct: 1   MNILITGGAGFIGSAVIRYLINETDHKILNVDKLTYAGNLESLATIANNSRYHFCQADIS 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D+  I    K+FQPD +++ AAESHVDRSI  + EFI TNI+GTF LLE +R +W  L +
Sbjct: 61  DQAHITQLFKQFQPDTVMHLAAESHVDRSISSSVEFIQTNIVGTFQLLEISRHYWENLPE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD---KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGI 177
           +K+  FRF  ISTDEVYG L      LF+E  PY PSSPYSA+KASSD+LV AW  TYG+
Sbjct: 121 EKQHLFRFHHISTDEVYGDLSDLSSELFTESTPYAPSSPYSASKASSDHLVRAWHRTYGL 180

Query: 178 PVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVL 237
           PV+++NCSNNYGPYHFPEKLIPL I   ++G  + +YG+G+ +RDWLYVEDH RALY V+
Sbjct: 181 PVIITNCSNNYGPYHFPEKLIPLTILNALQGKKLPVYGNGEQIRDWLYVEDHARALYQVV 240

Query: 238 KKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY----SHTELIRFIEDRPGHDRR 293
            K + G  YNIGG+NE+KNID+V  I  LLD L P       S+ +LI F+ DRPGHD R
Sbjct: 241 TKAKAGSTYNIGGHNEQKNIDVVKNICTLLDELAPNKILGIKSYKDLITFVPDRPGHDVR 300

Query: 294 YAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKELKPDNDYSKW 347
           YAID+SKIK ++GW P+EN +SGL KTV WYL+N  W   ++       +Y KW
Sbjct: 301 YAIDASKIKHDLGWEPEENFQSGLRKTVLWYLNNQDWVNHIFT-----GEYQKW 349


>gi|183597263|ref|ZP_02958756.1| hypothetical protein PROSTU_00507 [Providencia stuartii ATCC 25827]
 gi|188023578|gb|EDU61618.1| hypothetical protein PROSTU_00507 [Providencia stuartii ATCC 25827]
          Length = 358

 Score =  409 bits (1051), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 194/336 (57%), Positives = 248/336 (73%), Gaps = 6/336 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+    V+ +DKLTYAGNL SL  I +   ++F+Q DIC
Sbjct: 1   MKILVTGGAGFIGSAVIRHIINNTNDTVINVDKLTYAGNLESLTSICEDPRYTFVQADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   I +     QPDAI++ AAESHVDRSI G  EFI TNIIGT+ LLE  R +W+ L  
Sbjct: 61  DSAAITNIFNLHQPDAIMHLAAESHVDRSIDGPSEFIQTNIIGTYTLLEAARQYWNQLPA 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           DKK  FRF  ISTDEVYG L+    LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 DKKATFRFHHISTDEVYGDLESTTDLFTETTPYAPSSPYSASKASSDHLVRAWQRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            L++NCSNNYGP+H+PEKLIPL I   +EG  + +YG+GQ +RDWLYVEDH RALY V+ 
Sbjct: 181 TLVTNCSNNYGPFHYPEKLIPLMILNALEGKPLPVYGNGQQIRDWLYVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRY 294
           +G++GE YNIGG+NE+ NID+V  I  +L+ L+P       S+++LI ++ DRPGHD RY
Sbjct: 241 EGKVGETYNIGGHNEKANIDVVKTICNILEELVPNKPNNIQSYSDLITYVTDRPGHDLRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           AID++KIK+E+ W P E  E+GL KTV WYL NN W
Sbjct: 301 AIDATKIKNELNWVPAETFETGLRKTVEWYLANNEW 336


>gi|54873717|gb|AAV41066.1| RmlB [Shigella boydii]
          Length = 361

 Score =  409 bits (1050), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 192/340 (56%), Positives = 242/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LL+  R +WS L  
Sbjct: 61  DAAAMARIFSQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLDAARNYWSALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L             LF E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNKEKLPLFIETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKMLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAI++ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAINAEKIGRELGWKPQETFESGIRKTVEWYLANAKW 340


>gi|88858863|ref|ZP_01133504.1| dTDP-glucose 4,6-dehydratase [Pseudoalteromonas tunicata D2]
 gi|88819089|gb|EAR28903.1| dTDP-glucose 4,6-dehydratase [Pseudoalteromonas tunicata D2]
          Length = 359

 Score =  409 bits (1050), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 198/342 (57%), Positives = 252/342 (73%), Gaps = 11/342 (3%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL+ I+QS  +SF QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVIRHVINNTEDSVVNVDKLTYAGNLESLESIAQSERYSFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   I+   ++ QPD I++ AAESHVDRSI G  EFI TNIIGT+ LLE  R +W  L  
Sbjct: 61  DAVAIKRVFEQHQPDIIMHLAAESHVDRSIDGPAEFIGTNIIGTYTLLEAARQYWLALDA 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            ++  FRF  ISTDEVYG L+  + LF+E   Y PSSPYSA+KA+SD+LV AW  TYG+P
Sbjct: 121 VRQAHFRFHHISTDEVYGDLEGPEDLFTETTAYAPSSPYSASKAASDHLVRAWLRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            L++NCSNNYGPYHFPEKLIPL I   +EG  + +YG+G  +RDWLYVEDH RALYLV  
Sbjct: 181 TLVTNCSNNYGPYHFPEKLIPLMILNALEGKTLPVYGNGLQIRDWLYVEDHARALYLVAT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS-YSHTE--------LIRFIEDRPG 289
           KG +GE YNIGG+NE+ NID+V  I  LL+ L+P + YS           LI +++DRPG
Sbjct: 241 KGVVGETYNIGGHNEKANIDVVNTICALLEELVPSNPYSKASGSEQGFAGLITYVKDRPG 300

Query: 290 HDRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           HD RYAID++KI +E+GW P+E+ ESG+ KTV WYLDN  WW
Sbjct: 301 HDVRYAIDANKIANELGWTPEESFESGIRKTVQWYLDNQAWW 342


>gi|218558920|ref|YP_002391833.1| dTDP-glucose 4,6 dehydratase [Escherichia coli S88]
 gi|160419867|emb|CAN87672.1| dTDP-glucose 4,6 dehydratase, NAD(P)-binding [Escherichia coli S88]
 gi|218365689|emb|CAR03425.1| dTDP-glucose 4,6 dehydratase, NAD(P)-binding [Escherichia coli S88]
          Length = 360

 Score =  409 bits (1050), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 192/340 (56%), Positives = 241/340 (70%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFSQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLETARQYWSSLDS 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
            +K  FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 ARKATFRFHHISTDEVYGDLPHPDEVAQGSILPLFTEQTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WLRTYGLPTMVTNCSNNYGPYHFPEKLIPLVILNALEGKSLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ KG  GE YNIGG+NE+KN+D+V  I  LLD ++PK+ S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTKGIPGETYNIGGHNEKKNLDVVHTICDLLDEIVPKAVSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDADKISRELGWKPQETFESGIRKTVEWYLANTSW 340


>gi|289626549|ref|ZP_06459503.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289649197|ref|ZP_06480540.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|330869504|gb|EGH04213.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. aesculi str.
           0893_23]
          Length = 360

 Score =  409 bits (1050), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 197/338 (58%), Positives = 252/338 (74%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSAL R+L+N+ + +VL  DKLTYAGNL SL+ I+    + F+Q DIC
Sbjct: 1   MRILVTGGAGFIGSALIRHLINNTEHEVLNFDKLTYAGNLESLQSIATDTRYEFVQADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D+  + + L+ F P AI++ AAESHVDRSI G  EFI TNI+GT+ LLE TR WW  L +
Sbjct: 61  DQARVSAVLERFAPQAIMHLAAESHVDRSIDGPAEFIQTNIVGTYSLLEATRAWWLKLPE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            ++  FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KA+SD+LV AW  TYG+P
Sbjct: 121 AQRQAFRFHHISTDEVYGDLHGVDDLFTETTPYAPSSPYSASKAASDHLVRAWHRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+++NCSNNYGP+HFPEKLIPL I   + G  + +YG+G  VRDWLYVEDH RAL  V+ 
Sbjct: 181 VVVTNCSNNYGPFHFPEKLIPLVILNALAGKPLPVYGNGLQVRDWLYVEDHARALLKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G++GE YNIGG+NE+KNID+V  I  LLD L P+  +    +++LI ++ DRPGHD+RY
Sbjct: 241 EGKVGETYNIGGHNEQKNIDVVRGICALLDELAPQHPTGVAQYSDLITYVVDRPGHDQRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID+SKI +++GW P+E  ESGL KTV WYLDN  W R
Sbjct: 301 AIDASKIDNDLGWTPEETFESGLRKTVQWYLDNLDWCR 338


>gi|168481327|gb|ACA24814.1| RmlB [Escherichia coli]
          Length = 361

 Score =  408 bits (1049), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 191/340 (56%), Positives = 243/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  ++ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSIVNVDKLTYAGNLESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +       QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFALHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDD 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           ++K+ FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 EEKNNFRFHHISTDEVYGDLPHPDEVNNKEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKGLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLAICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKIGRELGWKPQETFESGIRKTVEWYLSNTKW 340


>gi|113969661|ref|YP_733454.1| dTDP-glucose 4,6 dehydratase [Shewanella sp. MR-4]
 gi|113884345|gb|ABI38397.1| dTDP-glucose 4,6-dehydratase [Shewanella sp. MR-4]
          Length = 359

 Score =  408 bits (1049), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 191/343 (55%), Positives = 250/343 (72%), Gaps = 13/343 (3%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++++ +  V+ +DKLTYAGNL SL  +  S  ++F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIISNTQDSVINLDKLTYAGNLESLVSVEASERYAFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     +++PDA+++ AAESHVDRSI G  +FI TNI+GT+ LLE  R +W  L  
Sbjct: 61  DRAELDRVFSQYKPDAVMHLAAESHVDRSITGPADFIQTNIVGTYTLLEAARHYWMQLDA 120

Query: 121 DKKDQFRFLQISTDEVYGSL-------------DKGLFSEDMPYNPSSPYSATKASSDYL 167
           ++K  FRF  ISTDEVYG L             +  LF+E  PY PSSPYSA+KASSD+L
Sbjct: 121 ERKVAFRFHHISTDEVYGDLPHPDEQEGQVVNQELPLFTETTPYAPSSPYSASKASSDHL 180

Query: 168 VLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVE 227
           V AW  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVE
Sbjct: 181 VRAWLRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKQLPIYGKGDQIRDWLYVE 240

Query: 228 DHVRALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDR 287
           DH RALY V+ +G+IGE YNIGG+NE++N+++V  I  +LDAL+PK+ S+ E I ++ DR
Sbjct: 241 DHARALYKVVTEGQIGETYNIGGHNEKQNLEVVQTICTILDALVPKASSYAEQITYVTDR 300

Query: 288 PGHDRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           PGHDRRYAID+SKI +E+ W PQE  E+GL KTV WYL N  W
Sbjct: 301 PGHDRRYAIDASKISNELNWQPQETFETGLCKTVEWYLANQEW 343


>gi|254421040|ref|ZP_05034764.1| dTDP-glucose 4,6-dehydratase [Brevundimonas sp. BAL3]
 gi|196187217|gb|EDX82193.1| dTDP-glucose 4,6-dehydratase [Brevundimonas sp. BAL3]
          Length = 351

 Score =  408 bits (1049), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 190/334 (56%), Positives = 247/334 (73%), Gaps = 2/334 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSAL R L+     +VLV DKLTYAG L+SL+ ++ SN +SF+Q DIC
Sbjct: 1   MRILVTGGAGFIGSALVRRLIEHTDHEVLVFDKLTYAGVLSSLQPVTSSNRYSFVQADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D + +  AL+EF+PD + + AAESHVDRSI G   FI TN++GTF++L +   +W  L +
Sbjct: 61  DADVVSRALREFKPDVVAHLAAESHVDRSIDGPGAFIQTNMVGTFVMLNQALGYWRGLPE 120

Query: 121 DKKDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            +K  FRF  ISTDEV+GSL + G F+E   Y+P SPYSA+KA SD+LV AWGHTYG+PV
Sbjct: 121 AEKAGFRFHHISTDEVFGSLGEDGFFTETTSYDPRSPYSASKAGSDHLVRAWGHTYGLPV 180

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I R + G  + +YGDG NVRDWL+V+DH RAL  V + 
Sbjct: 181 LVTNCSNNYGPYHFPEKLIPLIIIRALNGEPLPVYGDGSNVRDWLFVDDHARALQAVFET 240

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS-HTELIRFIEDRPGHDRRYAIDS 298
           G  GE YN+GGN ERKNI++V  I  +LD L PK+   + + I ++ DRPGHD RYAID+
Sbjct: 241 GTPGETYNVGGNAERKNIEVVTAICSILDRLRPKAEGQYADQITYVTDRPGHDHRYAIDA 300

Query: 299 SKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           SKI++++GW P    E G+ +TV WYL+N  WW+
Sbjct: 301 SKIRADLGWVPSVTFEEGIERTVTWYLENPSWWQ 334


>gi|288937784|ref|YP_003441843.1| dTDP-glucose 4,6-dehydratase [Klebsiella variicola At-22]
 gi|288892493|gb|ADC60811.1| dTDP-glucose 4,6-dehydratase [Klebsiella variicola At-22]
          Length = 355

 Score =  408 bits (1049), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 197/336 (58%), Positives = 242/336 (72%), Gaps = 6/336 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIGSA+ R ++     +V+V+DKLTYAGNL SL  ++Q   F+F QVDICDR
Sbjct: 4   ILVTGGAGFIGSAVVREIIQHTADRVVVVDKLTYAGNLMSLAPVAQDARFAFEQVDICDR 63

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             +    ++ QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R WW+ L+ +K
Sbjct: 64  GELDRIFRQHQPDTVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARSWWNTLATEK 123

Query: 123 KDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           K  FRF  ISTDEVYG L   +  F+E  PY PSSPYSA+KASSD+LV AW  TYG+P L
Sbjct: 124 KSAFRFHHISTDEVYGDLHGSEDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPTL 183

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           ++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALYLV  +G
Sbjct: 184 ITNCSNNYGPYHFPEKLIPLTILNALAGKPLPVYGNGQQIRDWLYVEDHARALYLVATRG 243

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALI---PKSYSH-TELIRFIEDRPGHDRRYAI 296
             GE YNIGG+NERKNI++V  I  LL+ L    P+S  H  +LI F+ DRPGHD RYAI
Sbjct: 244 EPGETYNIGGHNERKNIEVVETICQLLEELAPHKPQSVVHYHDLITFVADRPGHDLRYAI 303

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           D+SKI  E+GW P E   SG+ KTV WYL N  WWR
Sbjct: 304 DASKIARELGWTPAETFTSGMRKTVAWYLANESWWR 339


>gi|148976932|ref|ZP_01813587.1| dTDP-D-glucose 4,6-dehydratase [Vibrionales bacterium SWAT-3]
 gi|145963806|gb|EDK29066.1| dTDP-D-glucose 4,6-dehydratase [Vibrionales bacterium SWAT-3]
          Length = 365

 Score =  408 bits (1049), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 190/340 (55%), Positives = 248/340 (72%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+    V+ +DKLTYAGNL SL E+  +  + F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVIRHIINNTSNSVVNVDKLTYAGNLESLVEVDTNARYVFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +R  +     E +PDA+++ AAESHVDRSI G   FI TN++GT+ LLE TR +W+ L +
Sbjct: 61  NRSELDRVFAEHKPDAVMHLAAESHVDRSITGPAAFIETNVVGTYTLLEATREYWNNLEK 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
             K +FRF  ISTDEVYG L          +  +F E  PY PSSPYSA+KASSD+LV A
Sbjct: 121 RAKAEFRFHHISTDEVYGDLPHPDEVPEGTELPMFLETTPYEPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWL+VEDH 
Sbjct: 181 WLRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKELPIYGKGDQIRDWLFVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G++GE YNIGG+NE+KNI++V  I  +LDAL+PK   + E I +++DRPGH
Sbjct: 241 RALYKVVTEGKVGETYNIGGHNEKKNIEVVNTICDILDALVPKEPKYAEQITYVQDRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAIDSSK++ E+ W P E  E+GL KTV WYLDN+ W
Sbjct: 301 DRRYAIDSSKMQRELNWTPNETFETGLRKTVQWYLDNSKW 340


>gi|253991611|ref|YP_003042967.1| dtdp-glucose 4,6-dehydratase [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253783061|emb|CAQ86226.1| dtdp-glucose 4,6-dehydratase [Photorhabdus asymbiotica]
          Length = 356

 Score =  408 bits (1048), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 188/337 (55%), Positives = 251/337 (74%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R+++TGGAGFIGSA+ R+++++ +  V+V+D LTYAGNL SL  ++ S+ ++F +VDIC 
Sbjct: 3   RILITGGAGFIGSAVVRHIIDNTQDSVVVVDSLTYAGNLESLASVADSSRYAFERVDICQ 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           RE +    +++QPD +++ AAESHVDRSI G   F+ TNI+GT++LLE  R +W  LS++
Sbjct: 63  REALDRVFEQYQPDCVMHLAAESHVDRSIDGPAAFVETNIVGTYVLLEAARAFWQKLSKE 122

Query: 122 KKDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           K+  FRF  ISTDEVYG L  + G F+E+ PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KQVTFRFHHISTDEVYGDLHGEDGFFTEETPYAPSSPYSASKASSDHLVRAWHRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I   + G  + +YG+G+ +RDWLYVEDH RALYLV+ K
Sbjct: 183 IITNCSNNYGPYHFPEKLIPLMILNALAGKSLPVYGEGKQIRDWLYVEDHARALYLVVTK 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
              G  YNIGG+NERKNID+V  I  LL+   P+  +    + +LI  + DRPGHD RYA
Sbjct: 243 AEPGRTYNIGGHNERKNIDVVCAICELLEEFCPEKPANIAYYRDLIAHVTDRPGHDMRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID++KI+ E+GW PQE  ESG+ KTV WYL+N  WWR
Sbjct: 303 IDAAKIEHELGWKPQETFESGIRKTVQWYLENENWWR 339


>gi|290513180|ref|ZP_06552542.1| dTDP-glucose 4,6-dehydratase [Klebsiella sp. 1_1_55]
 gi|289774391|gb|EFD82397.1| dTDP-glucose 4,6-dehydratase [Klebsiella sp. 1_1_55]
          Length = 355

 Score =  408 bits (1048), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 197/336 (58%), Positives = 242/336 (72%), Gaps = 6/336 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIGSA+ R ++     +V+V+DKLTYAGNL SL  ++Q   F+F QVDICDR
Sbjct: 4   ILVTGGAGFIGSAVVREIIQHTADRVVVVDKLTYAGNLMSLAPVAQDARFAFEQVDICDR 63

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             +    ++ QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R WW+ L+ +K
Sbjct: 64  GELDRIFRQHQPDTVMHLAAESHVDRSIDGPAAFIETNILGTYTLLEAARSWWNTLATEK 123

Query: 123 KDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           K  FRF  ISTDEVYG L   +  F+E  PY PSSPYSA+KASSD+LV AW  TYG+P L
Sbjct: 124 KSAFRFHHISTDEVYGDLHGSEDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPTL 183

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           ++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALYLV  +G
Sbjct: 184 ITNCSNNYGPYHFPEKLIPLTILNALAGKPLPVYGNGQQIRDWLYVEDHARALYLVATRG 243

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALI---PKSYSH-TELIRFIEDRPGHDRRYAI 296
             GE YNIGG+NERKNI++V  I  LL+ L    P+S  H  +LI F+ DRPGHD RYAI
Sbjct: 244 EPGETYNIGGHNERKNIEVVETICQLLEELAPHKPQSVVHYHDLITFVADRPGHDLRYAI 303

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           D+SKI  E+GW P E   SG+ KTV WYL N  WWR
Sbjct: 304 DASKIARELGWTPAETFTSGMRKTVAWYLANESWWR 339


>gi|148549141|ref|YP_001269243.1| dTDP-glucose 4,6-dehydratase [Pseudomonas putida F1]
 gi|148513199|gb|ABQ80059.1| dTDP-glucose 4,6-dehydratase [Pseudomonas putida F1]
          Length = 358

 Score =  408 bits (1048), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 190/334 (56%), Positives = 248/334 (74%), Gaps = 4/334 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++++    V+ +DKLTYAGNL SL+ ++Q+  ++F  VDIC
Sbjct: 1   MKILVTGGAGFIGSAVIRHIISNTADSVVNVDKLTYAGNLESLQSVAQNPRYAFEHVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
            RE +    +E QPDA+++ AAESHVDRSI G   FI TNIIGT++LLE  R +WS L +
Sbjct: 61  SREEMDRVFREHQPDAVMHLAAESHVDRSITGPSAFIETNIIGTYVLLEAARGYWSGLDE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K  FRF  ISTDEVYG L+  + LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 ARKSAFRFHHISTDEVYGDLEGPEDLFTEATPYQPSSPYSASKASSDHLVRAWARTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            L++NCSNNYGP+HFPEKLIPL I   +EG  + +YG G  +RDWL+VEDH RALY V+ 
Sbjct: 181 TLVTNCSNNYGPFHFPEKLIPLVILNALEGKPLPIYGKGDQIRDWLFVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS--YSHTELIRFIEDRPGHDRRYAI 296
           +G +GE YNIGG+NE++NI++V  +  LLD L P S    H  L+ ++ DRPGHD RYAI
Sbjct: 241 EGEVGETYNIGGHNEKQNIEVVRTVCELLDELRPDSAFAPHFNLVTYVTDRPGHDVRYAI 300

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           D+SKI+ E+GW P+E  ESG+ KTV WYL N  W
Sbjct: 301 DASKIQRELGWVPEETFESGIRKTVEWYLSNAEW 334


>gi|307340806|gb|ADN43866.1| RmlB [Escherichia coli]
          Length = 361

 Score =  408 bits (1048), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 193/340 (56%), Positives = 241/340 (70%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +       QPDA+++ AAESHVDRSI G   FI TNI+GT++ LE  R +WS L  
Sbjct: 61  DAAAMVRIFALHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVPLEAARNYWSALDG 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNKEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNENKNIDVVLAICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKIGRELGWKPQETFESGIRKTVEWYLSNTKW 340


>gi|283832536|ref|ZP_06352277.1| dTDP-glucose 4,6-dehydratase [Citrobacter youngae ATCC 29220]
 gi|291072203|gb|EFE10312.1| dTDP-glucose 4,6-dehydratase [Citrobacter youngae ATCC 29220]
          Length = 360

 Score =  408 bits (1048), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 189/340 (55%), Positives = 245/340 (72%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL E+S+++ + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIIKNTQDTVVNVDKLTYAGNLESLAEVSENHRYYFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D+  +      ++PDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +W+ L  
Sbjct: 61  DKAAMERIFATYKPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARGYWNGLDA 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK  FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKQAFRFHHISTDEVYGDLPHPDEVAAGGVFPLFTEKTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WLRTYGFPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ KG +GE YNIGG+NE+KN+D+V  I  LLD ++PK  S+ + + ++ DRPGH
Sbjct: 241 RALYTVVTKGVVGETYNIGGHNEKKNLDVVHTICDLLDEIVPKEGSYRDQLTYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID++KI +E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAAKISNELGWKPQETFESGIRKTVEWYLSNTQW 340


>gi|56415781|ref|YP_152856.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197364711|ref|YP_002144348.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|56130038|gb|AAV79544.1| UDP-N-acetylglucosamine epimerase (UDP-GlcNAc-2-epimerase)
           [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. ATCC 9150]
 gi|197096188|emb|CAR61784.1| UDP-N-acetylglucosamine epimerase (UDP-GlcNAc-2-epimerase)
           [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. AKU_12601]
          Length = 355

 Score =  408 bits (1048), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 195/339 (57%), Positives = 249/339 (73%), Gaps = 6/339 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R++VTGGAGFIGSA+ R+++++    V+V+DKLTYAGNL SL  ++QS+ F+F +VDICD
Sbjct: 3   RILVTGGAGFIGSAVVRHIIHETVDAVVVVDKLTYAGNLMSLASVAQSDRFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +    +++QPD++++ AAESHVDRSI G   FI TNI+GT+ LLE  R +WS    D
Sbjct: 63  RASLERVFQQYQPDSVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWSAFDAD 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            K  FRF  ISTDEVYG L      F+E   Y PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 AKAAFRFHHISTDEVYGDLHTADDFFTETTSYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V+  
Sbjct: 183 LVTNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYHVVTN 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NERKN+D+V  I  LL+ L P+      ++ +LI F++DRPGHD RYA
Sbjct: 243 GAVGETYNIGGHNERKNLDVVRTICALLEELAPQKPQGVANYHDLITFVDDRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+P+
Sbjct: 303 IDASKIARELGWTPQETFESGMRKTVQWYLANEAWWKPV 341


>gi|323497087|ref|ZP_08102110.1| dTDP-glucose 4,6-dehydratase [Vibrio sinaloensis DSM 21326]
 gi|323317931|gb|EGA70919.1| dTDP-glucose 4,6-dehydratase [Vibrio sinaloensis DSM 21326]
          Length = 352

 Score =  408 bits (1048), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 194/337 (57%), Positives = 247/337 (73%), Gaps = 6/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL+++  S  + F  VDIC
Sbjct: 1   MKILVTGGAGFIGSAVIRHIINETQDSVVNLDKLTYAGNLESLQDVESSARYHFECVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     E QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W  LS 
Sbjct: 61  DRGKLERVFDEHQPDIVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLETARSYWQSLSS 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           ++K QFRF  ISTDEVYG L+  + LF+E  PY PSSPYSA+KASSD+LV AW  T+G P
Sbjct: 121 ERKRQFRFHHISTDEVYGDLEDTESLFTEQTPYAPSSPYSASKASSDHLVRAWLRTFGFP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            L++NCSNNYGPYHFPEKLIPL I   +EG  + +YGDG+ +RDWLYVEDH RALY V  
Sbjct: 181 TLITNCSNNYGPYHFPEKLIPLMILNALEGKSLPVYGDGKQIRDWLYVEDHARALYTVAT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY----SHTELIRFIEDRPGHDRRY 294
           KG++GE YNIGG+NE  N+++V  I  L++ L P       ++ ELI F+EDRPGHD RY
Sbjct: 241 KGKVGETYNIGGHNELTNLEVVHRICELMEELCPDKPNGIGAYAELITFVEDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           AID+SKI+ E+GW P+E  ESG+ KTV WYL N  WW
Sbjct: 301 AIDASKIERELGWKPEETFESGICKTVRWYLSNRIWW 337


>gi|271499807|ref|YP_003332832.1| dTDP-glucose 4,6-dehydratase [Dickeya dadantii Ech586]
 gi|270343362|gb|ACZ76127.1| dTDP-glucose 4,6-dehydratase [Dickeya dadantii Ech586]
          Length = 354

 Score =  407 bits (1047), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 196/338 (57%), Positives = 244/338 (72%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M ++VTGGAGFIGSA+ R+++   + +V+V+D LTYAGNL SLKE++    F F +V+IC
Sbjct: 1   MNILVTGGAGFIGSAVVRHIIQHTQDRVMVVDCLTYAGNLASLKEVAADPRFLFEKVNIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +      FQPDA+++ AAESHVDRSI G   FI TNI GT+ LLE  R +WS L Q
Sbjct: 61  DRAALDRVFTTFQPDAVMHLAAESHVDRSIDGPSAFIETNITGTYTLLEAARQYWSALPQ 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K+ FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KA+SD+LV AW  TYG+P
Sbjct: 121 VRKEAFRFHHISTDEVYGDLHGTDDLFTETTPYAPSSPYSASKAASDHLVRAWLRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG+G  +RDWL+VEDH RALY V+ 
Sbjct: 181 TMVTNCSNNYGPYHFPEKLIPLMILNALEGKPLPVYGEGNQIRDWLFVEDHARALYTVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
            G +GE YNIGG+NERKNI++V  I  LLD L P+  S    + ELI  + DRPGHD RY
Sbjct: 241 TGEVGETYNIGGHNERKNIEVVQTICALLDELRPEKPSGIRHYAELITHVTDRPGHDLRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID+SKI  E+GW P+E  ESG+ KTV WYL N  WWR
Sbjct: 301 AIDASKIYRELGWKPKETFESGIRKTVEWYLANETWWR 338


>gi|298484710|ref|ZP_07002812.1| dTDP-glucose 4,6-dehydratase [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|298160743|gb|EFI01762.1| dTDP-glucose 4,6-dehydratase [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
          Length = 360

 Score =  407 bits (1047), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 197/338 (58%), Positives = 251/338 (74%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSAL R+L+N+ + +VL  DKLTYAGNL SL+ I+    + F+Q DIC
Sbjct: 1   MRILVTGGAGFIGSALIRHLINNTEHEVLNFDKLTYAGNLESLQSIATDTRYEFVQADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D+  + + L+ F P AI++ AAESHVDRSI G  EFI TNI+GT+ LLE TR WW  L +
Sbjct: 61  DQARVSAVLERFAPQAIMHLAAESHVDRSIDGPAEFIQTNIVGTYSLLEATRAWWLKLPE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            ++  FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KA+SD+LV AW  TYG+P
Sbjct: 121 AQRQAFRFHHISTDEVYGDLHGVDDLFTETTPYAPSSPYSASKAASDHLVRAWHRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+++NCSNNYGP+HFPEKLIPL I   + G  + +YG+G  VRDWLYVEDH RAL  V+ 
Sbjct: 181 VVVTNCSNNYGPFHFPEKLIPLVILNALAGKPLPVYGNGLQVRDWLYVEDHARALLKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G++GE YNIGG+NE+KNID+V  I  LLD L P+  +    + +LI ++ DRPGHD+RY
Sbjct: 241 EGKVGETYNIGGHNEQKNIDVVRGICALLDELAPQHPTGVAQYRDLITYVVDRPGHDQRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID+SKI +++GW P+E  ESGL KTV WYLDN  W R
Sbjct: 301 AIDASKIDNDLGWTPEETFESGLRKTVQWYLDNLDWCR 338


>gi|168481427|gb|ACA24906.1| RmlB [Shigella dysenteriae]
          Length = 361

 Score =  407 bits (1047), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 191/340 (56%), Positives = 241/340 (70%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL ++S S  +     DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIIKNTQDSVVNVDKLTYAGNLESLADVSDSKRYVLEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + Q DA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQADAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNNEELPLFTERTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKIGRELGWKPQETFESGIRKTVEWYLSNTKW 340


>gi|229587855|ref|YP_002869974.1| dTDP-glucose 4,6-dehydratase [Pseudomonas fluorescens SBW25]
 gi|229359721|emb|CAY46569.1| dTDP-glucose 4,6-dehydratase [Pseudomonas fluorescens SBW25]
          Length = 360

 Score =  407 bits (1047), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 197/338 (58%), Positives = 248/338 (73%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR+++TGGAGFIGSAL R+L+ + + QVL +DKLTYAGNL SL  I+  + + F+Q DI 
Sbjct: 1   MRILITGGAGFIGSALIRHLIENTEHQVLNLDKLTYAGNLESLTSIASDSRYEFVQADIV 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D+  + + L  F+P AI++ AAESHVDRSI G  +FI TNI+GT+ LLE TR +W  L +
Sbjct: 61  DQATVSAVLARFEPQAIMHLAAESHVDRSIDGPSDFIQTNIVGTYSLLEATRAYWQKLDE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
             K  FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KA+SD+LV AW  TYG+P
Sbjct: 121 PAKRAFRFHHISTDEVYGDLHGVDDLFTETTPYAPSSPYSASKAASDHLVRAWQRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           VLL+NCSNNYGP+HFPEKLIPL I   + G  + +YGDG  VRDWL+VEDH RAL  V+ 
Sbjct: 181 VLLTNCSNNYGPFHFPEKLIPLVILNALAGKPLPVYGDGLQVRDWLFVEDHARALLTVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G +GE YNIGG+NE+KNID+V  I  LL+ L P+  +      +LI F++DRPGHD+RY
Sbjct: 241 EGVVGETYNIGGHNEQKNIDVVRGICALLEELAPQRPAGVAQFADLITFVKDRPGHDQRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID+SKI+ E+GW P+E  ESGL KTV WYLDN  W R
Sbjct: 301 AIDASKIERELGWVPEETFESGLRKTVQWYLDNLEWCR 338


>gi|192361310|ref|YP_001983888.1| dTDP-glucose 4,6-dehydratase [Cellvibrio japonicus Ueda107]
 gi|190687475|gb|ACE85153.1| dTDP-glucose 4,6-dehydratase [Cellvibrio japonicus Ueda107]
          Length = 356

 Score =  407 bits (1046), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 196/341 (57%), Positives = 253/341 (74%), Gaps = 9/341 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ + +V+ +DKLTYAGNL SL  I Q+  + F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDEVINLDKLTYAGNLESLASIDQNPRYRFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +R+ +     E QPDA+++ AAESHVDRSI G   FI TNI+GT+ LLE +R +W  L +
Sbjct: 61  NRQALDRIFHEHQPDAVMHLAAESHVDRSIDGPAAFIETNILGTYQLLEASRDYWKNLPE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
             K  FRF  ISTDEVYG L+  + LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 AGKAAFRFHHISTDEVYGDLEGPEDLFTETTPYAPSSPYSASKASSDHLVRAWRRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            L++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWL+VEDH RALY V+ 
Sbjct: 181 TLVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPVYGKGNQIRDWLFVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS------HTELIRFIEDRPGHDR 292
           +G++GE YNIGG+NE++NI++V +I  LLD L P + +      H ELI F+ DRPGHD 
Sbjct: 241 EGKVGETYNIGGHNEKQNIEVVHKICELLDELRPLNSTNLPIKYHKELITFVTDRPGHDL 300

Query: 293 RYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDN-NWWWR 332
           RYAID+SKIK E+GW P+E  +SG+ KTV WYL+N NW  R
Sbjct: 301 RYAIDASKIKRELGWVPEETFDSGIRKTVIWYLENLNWAHR 341


>gi|51594528|ref|YP_068719.1| dTDP-D-glucose-4,6-dehydratase [Yersinia pseudotuberculosis IP
           32953]
 gi|153949720|ref|YP_001399183.1| dTDP-glucose 4,6-dehydratase [Yersinia pseudotuberculosis IP 31758]
 gi|170026239|ref|YP_001722744.1| dTDP-glucose 4,6-dehydratase [Yersinia pseudotuberculosis YPIII]
 gi|186893526|ref|YP_001870638.1| dTDP-glucose 4,6-dehydratase [Yersinia pseudotuberculosis PB1/+]
 gi|51587810|emb|CAH19412.1| dTDP-D-glucose-4,6-dehydratase [Yersinia pseudotuberculosis IP
           32953]
 gi|152961215|gb|ABS48676.1| dTDP-glucose 4,6-dehydratase [Yersinia pseudotuberculosis IP 31758]
 gi|169752773|gb|ACA70291.1| dTDP-glucose 4,6-dehydratase [Yersinia pseudotuberculosis YPIII]
 gi|186696552|gb|ACC87181.1| dTDP-glucose 4,6-dehydratase [Yersinia pseudotuberculosis PB1/+]
          Length = 355

 Score =  407 bits (1046), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 193/337 (57%), Positives = 246/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R++VTGGAGFIGSA+ R++++     V+V+DKLTYAGNL SL  ++ S  ++F QVDICD
Sbjct: 3   RILVTGGAGFIGSAVVRHIIDGTSDSVVVVDKLTYAGNLESLSVVAGSERYAFEQVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     ++QP+ +++ AAESHVDRSI G   FI TN++GT+ LLE  R +W  LS +
Sbjct: 63  RSELDRVFAQYQPNVVMHLAAESHVDRSIDGPAAFIETNVVGTYTLLEAARHYWQQLSVE 122

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            K  FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 AKQAFRFHHISTDEVYGDLHGTDDLFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+G  VRDWLYVEDH RALY V+ +
Sbjct: 183 LVTNCSNNYGPYHFPEKLIPLVILNALAGKPLPVYGNGAQVRDWLYVEDHARALYQVVTE 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NERKNI++V  I  LLD L+P   +    + +LI +++DRPGHD RYA
Sbjct: 243 GVVGETYNIGGHNERKNIEVVETICALLDELVPAKPAGIAHYRDLITYVKDRPGHDMRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+ KI+ E+GW PQE  ESG+ KTV WYL+N  WWR
Sbjct: 303 IDAGKIERELGWRPQETFESGIRKTVLWYLNNESWWR 339


>gi|302382271|ref|YP_003818094.1| dTDP-glucose 4,6-dehydratase [Brevundimonas subvibrioides ATCC
           15264]
 gi|302192899|gb|ADL00471.1| dTDP-glucose 4,6-dehydratase [Brevundimonas subvibrioides ATCC
           15264]
          Length = 352

 Score =  407 bits (1046), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 187/335 (55%), Positives = 249/335 (74%), Gaps = 3/335 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSAL R L+     +VLV DKLTYAG L+SL+ ++ S+ ++F+Q DIC
Sbjct: 1   MRILVTGGAGFIGSALVRRLIEHSDHEVLVFDKLTYAGVLSSLEPVAASDRYAFVQADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D + +  ALK+F+PD + + AAESHVDRSI G   F+ TN++GTF++L +T  +W  L  
Sbjct: 61  DPDAVAKALKDFRPDVVAHLAAESHVDRSIDGPGAFVQTNLVGTFVMLNQTLGYWRGLPD 120

Query: 121 DKKDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            +K  FRF  ISTDEV+GSL + G F+E  PY+P SPYSA+KA SD+LV AWGHTYG+PV
Sbjct: 121 VEKAAFRFHHISTDEVFGSLGEDGFFTETTPYDPRSPYSASKAGSDHLVRAWGHTYGLPV 180

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I R + G  + +YGDG NVRDWL+V+DH RAL  V + 
Sbjct: 181 LVTNCSNNYGPYHFPEKLIPLIIIRALNGEPLPVYGDGSNVRDWLFVDDHARALQAVFET 240

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS--YSHTELIRFIEDRPGHDRRYAID 297
           G  GE YN+GGN ER+NI++V  I  +LD L P++   ++ + I F+ DRPGHD RYAID
Sbjct: 241 GTPGETYNVGGNAERRNIEVVTAICTILDRLRPRADGKAYADQITFVADRPGHDHRYAID 300

Query: 298 SSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           +SKI++++GW P    E G+ +T+ WYL+N  WW+
Sbjct: 301 ASKIRNDLGWTPSVTFEQGIEQTIAWYLENKTWWQ 335


>gi|212550126|gb|ACJ26778.1| dTDP-D-glucose-4,6-dehydratase [Salmonella enterica subsp. salamae]
          Length = 356

 Score =  407 bits (1046), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 192/342 (56%), Positives = 249/342 (72%), Gaps = 10/342 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++++TGGAGFIGSA+ R+++ + +  V+ IDKLTYAGNL SL +IS+SN ++F   DIC
Sbjct: 1   MKILITGGAGFIGSAVVRHIIKNTQDTVVNIDKLTYAGNLESLCDISKSNRYNFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D+  +       +PDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +W+ L+ 
Sbjct: 61  DKAAMEHIFAAHKPDAVMHLAAESHVDRSITGPANFIETNIVGTYVLLEAARGYWNELNA 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK  FRF  ISTDEVYG L             LF+E+M Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKLAFRFHHISTDEVYGDLPHPDEVQAGSTLPLFTENMAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WLRTYGFPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGRGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ KG +GE YNIGG+NE+KN+D+V  I  LLD ++PK  S+ + + ++ DRPGH
Sbjct: 241 RALYTVVTKGVVGETYNIGGHNEKKNLDVVHTICDLLDEIVPKEGSYRDQLTYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           DRRYAID++KI  E+GW PQE  ESG+ KT+ WYL+N  W R
Sbjct: 301 DRRYAIDAAKISDELGWKPQETFESGIRKTIDWYLNNIEWCR 342


>gi|71065769|ref|YP_264496.1| dTDP-glucose 4,6-dehydratase [Psychrobacter arcticus 273-4]
 gi|71038754|gb|AAZ19062.1| dTDP-glucose 4,6-dehydratase [Psychrobacter arcticus 273-4]
          Length = 360

 Score =  407 bits (1046), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 194/336 (57%), Positives = 242/336 (72%), Gaps = 6/336 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M +++TGGAGFIGSA+ R+++ +    VL IDKLTYAGNL SL  +S S  + F Q DIC
Sbjct: 7   MNILITGGAGFIGSAVIRHIITNTTDTVLNIDKLTYAGNLESLASVSDSTHYQFSQTDIC 66

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D+  I +   +FQPD +++ AAESHVDRSI G+  F+ TNIIGT  LLE  R ++  LS 
Sbjct: 67  DQPAIEAHFTDFQPDIVMHLAAESHVDRSITGSAAFMQTNIIGTHTLLEVARHYYETLSG 126

Query: 121 DKKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           DKK  FRF  ISTDEVYG LD    LF+E   Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 127 DKKSNFRFHHISTDEVYGDLDNDDDLFTETTSYAPSSPYSASKASSDHLVRAWDRTYGLP 186

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALYLV  
Sbjct: 187 VVITNCSNNYGPYHFPEKLIPLVILNALAGKPLPIYGNGQQIRDWLYVEDHARALYLVAT 246

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRY 294
           +G+ GE YNIGG+NE  NI++V  I  LL+ L P       S+ ELI +++DRPGHD RY
Sbjct: 247 EGKTGETYNIGGHNEHTNIEVVQTICALLEELAPNKPHGITSYAELITYVKDRPGHDLRY 306

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           AID+SKI+  +GW PQE   SGL +TV WYL+N+ W
Sbjct: 307 AIDASKIQQALGWTPQETFSSGLRQTVLWYLNNSEW 342


>gi|123440570|ref|YP_001004564.1| dTDP-D-glucose-4,6-dehydratase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122087531|emb|CAL10312.1| dTDP-D-glucose-4,6-dehydratase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 355

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 193/337 (57%), Positives = 247/337 (73%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R++VTGGAGFIGSA+ R++++     V+V+DKLTYAGNL SL  ++ S  ++F QVDICD
Sbjct: 3   RILVTGGAGFIGSAVVRHIIDGTSDSVVVVDKLTYAGNLESLAVVAHSERYAFEQVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     ++QPD +++ AAESHVDRSI G   FI TN++GT+ +LE  R +W  L   
Sbjct: 63  RAELDRVFAQYQPDVVMHLAAESHVDRSIDGPAAFIETNVVGTYQMLEAARHYWQPLDAK 122

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKLAFRFHHISTDEVYGDLHGTDDLFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+G  VRDWL+VEDH RALY V+ +
Sbjct: 183 LVTNCSNNYGPYHFPEKLIPLVILNALAGKPLPVYGNGAQVRDWLFVEDHARALYQVVTE 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NERKNI++V  I  LLD L+P+  +    + +LI F++DRPGHD RYA
Sbjct: 243 GVVGETYNIGGHNERKNIEVVETICALLDELVPEKPAGIARYRDLITFVKDRPGHDMRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI+ E+GW PQE  ESG+ KTV WYL+N  WW+
Sbjct: 303 IDASKIERELGWRPQETFESGIRKTVLWYLNNKSWWQ 339


>gi|291615362|ref|YP_003525519.1| dTDP-glucose 4,6-dehydratase [Sideroxydans lithotrophicus ES-1]
 gi|291585474|gb|ADE13132.1| dTDP-glucose 4,6-dehydratase [Sideroxydans lithotrophicus ES-1]
          Length = 355

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 190/330 (57%), Positives = 241/330 (73%), Gaps = 1/330 (0%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           + +VTGGAGFIGSA+ R  +ND    V+ +DKLTYAGNL SL  +S +  + F QVDICD
Sbjct: 3   KTLVTGGAGFIGSAVIRQFINDTACSVVNVDKLTYAGNLQSLASVSDNPRYRFEQVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
              +    +E QPDA+++ AAESHVDRSI G  +FI TNIIGT+ LLE  R +W+ L  +
Sbjct: 63  AAEVARVFREHQPDAVMHLAAESHVDRSISGPADFIQTNIIGTYTLLEAARGYWNSLDGE 122

Query: 122 KKDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           +K  FRF  ISTDEVYGSL D G F+E+  Y P+SPYSA+KASSD+LV AW HTYG PV+
Sbjct: 123 RKAGFRFHHISTDEVYGSLGDTGFFTEETAYEPNSPYSASKASSDHLVRAWHHTYGFPVV 182

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
            +NCSNNYGPYHFPEKLIPL I   + G  + +YG G N+RDWLYV+DH RAL LVL++G
Sbjct: 183 TTNCSNNYGPYHFPEKLIPLVILNAVNGKPLPIYGKGDNIRDWLYVDDHARALRLVLERG 242

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSSK 300
           ++GE YNIGG NE+ N+++V  I   LD L P+   H +LI ++ DRPGHD+RYAID++K
Sbjct: 243 KLGETYNIGGWNEKTNLEVVLAICAALDELRPQGAPHNKLITYVADRPGHDKRYAIDATK 302

Query: 301 IKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           +  ++GW PQE  E+GL KTV WYL N  W
Sbjct: 303 LARDLGWKPQETFETGLRKTVEWYLQNTDW 332


>gi|257483685|ref|ZP_05637726.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 360

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 196/338 (57%), Positives = 252/338 (74%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSAL R+L+N+ + +VL  DKLTYAGNL SL+ I+    + F+Q DIC
Sbjct: 1   MRILVTGGAGFIGSALIRHLINNTEHEVLNFDKLTYAGNLESLQSIATDTRYEFVQADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D+  + + L+ F P AI++ AAESHVDRSI G  EFI TNI+GT+ LLE TR +W  L +
Sbjct: 61  DQASVSAVLERFAPQAIMHLAAESHVDRSIDGPAEFIQTNIVGTYSLLEATRAYWLRLPE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            ++  FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KA+SD+LV AW  TYG+P
Sbjct: 121 AERQAFRFHHISTDEVYGDLHGVDDLFTETTPYAPSSPYSASKAASDHLVRAWHRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+++NCSNNYGP+HFPEKLIPL I   + G  + +YG+G  VRDWLYVEDH RAL  V+ 
Sbjct: 181 VVVTNCSNNYGPFHFPEKLIPLVILNALAGKPLPVYGNGLQVRDWLYVEDHARALLKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G++GE YNIGG+NE+KNID+V  I  LLD L P+  +    +++LI ++ DRPGHD+RY
Sbjct: 241 EGKVGETYNIGGHNEQKNIDVVRGICALLDELAPQHPTGVAQYSDLITYVVDRPGHDQRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID+SKI +++GW P+E  ESGL KTV WYLDN  W R
Sbjct: 301 AIDASKIDNDLGWTPEETFESGLRKTVQWYLDNLDWCR 338


>gi|9957834|gb|AAG09513.1|AF279619_1 dTDP-D-glucose-4,6-dehydratase [Salmonella enterica]
          Length = 361

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 189/340 (55%), Positives = 244/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ D +  V+ +DKLTYAGNL SL E+S+S+ + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIIKDTQDTVVNVDKLTYAGNLESLTEVSESHRYHFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D+  +       QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +W+ L  
Sbjct: 61  DKAAMERIFVTHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARSYWNALDV 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           +KK  FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 EKKAAFRFHHISTDEVYGDLPHPDEVSAGSVLPLFTEKTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WLRTYGFPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G +GE YNIGG+NE+KN+D+V  I  LLD ++PK  ++ + + ++ DRPGH
Sbjct: 241 RALYTVVTQGVVGETYNIGGHNEKKNLDVVQTICDLLDEIVPKEGAYRDQLIYVTDRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID++KI  E+GW PQE  ESG+ KTV WYL+N  W
Sbjct: 301 DRRYAIDAAKISDELGWKPQETFESGIRKTVEWYLNNTQW 340


>gi|241759011|ref|ZP_04757123.1| dTDP-glucose 4,6-dehydratase [Neisseria flavescens SK114]
 gi|241320832|gb|EER57065.1| dTDP-glucose 4,6-dehydratase [Neisseria flavescens SK114]
          Length = 355

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 190/337 (56%), Positives = 250/337 (74%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           +++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL E++ +  ++F QVDICD
Sbjct: 3   KILVTGGAGFIGSAVVRHIIQNTQDSVVNVDKLTYAGNLESLTEVADNPRYAFEQVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     + QPDA+++ AAESHVDRSI  A EFI TNI+GTF LLE  R +W  +  +
Sbjct: 63  RAELDRVFAQHQPDAVMHLAAESHVDRSIDSAGEFIQTNIVGTFNLLEAARAYWQQMPSE 122

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           K++ FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KREAFRFHHISTDEVYGDLHGTDDLFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I   ++G  + +YGDG  +RDWL+VEDH RALY V+ +
Sbjct: 183 IVTNCSNNYGPYHFPEKLIPLMILNALDGKPLPVYGDGMQIRDWLFVEDHARALYQVVTE 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NE+ NI++V  I  LL+ L+P+  +    + +LI F++DRPGHD RYA
Sbjct: 243 GVVGETYNIGGHNEKANIEVVKTICTLLEELVPEKPAGVARYEDLITFVQDRPGHDVRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID++KI  E+GW PQE  ESG+ KTV WYLDN  WW+
Sbjct: 303 IDAAKIGRELGWKPQETFESGIRKTVQWYLDNKTWWQ 339


>gi|157376125|ref|YP_001474725.1| dTDP-glucose 4,6-dehydratase [Shewanella sediminis HAW-EB3]
 gi|157318499|gb|ABV37597.1| dTDP-glucose 4,6-dehydratase [Shewanella sediminis HAW-EB3]
          Length = 352

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 190/337 (56%), Positives = 251/337 (74%), Gaps = 6/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++++TGGAGFIGSA+ R+++N  +  V+ +DKLTYAGNL SL+EI  S+ + F Q+DIC
Sbjct: 1   MKILITGGAGFIGSAVIRHIINHTQDSVVNLDKLTYAGNLESLQEIENSSRYCFEQLDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   ++   ++ +PD +++ AAESHVDRSI G   FI TNI+GT+ LLE TR +W  L +
Sbjct: 61  DSVELKRVFEQHKPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYALLEATRAYWIALDE 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           DKK  FRF  ISTDEVYG L+    LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 DKKAAFRFHHISTDEVYGDLEGTVDLFTETTPYEPSSPYSASKASSDHLVRAWQRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYGPYHFPEKLIPL I   +EG  + +YGDG  +RDWLYVEDH RALY V+ 
Sbjct: 181 TIVTNCSNNYGPYHFPEKLIPLMILNALEGKPLPVYGDGMQIRDWLYVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRY 294
           +G +GE YNIGG+NE+ NI++V  +  LL+ L+P       ++++LI F++DRPGHD RY
Sbjct: 241 EGMVGETYNIGGHNEKANIEVVTTLCSLLEELVPNKPAGVSTYSDLILFVKDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           AID+SKI+ E+ W P+E  ESG+ KTV WYL+N  WW
Sbjct: 301 AIDASKIERELSWKPEETFESGIRKTVLWYLNNKEWW 337


>gi|330806985|ref|YP_004351447.1| dTDP-glucose 4,6-dehydratase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327375093|gb|AEA66443.1| dTDP-glucose 4,6-dehydratase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 360

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 197/336 (58%), Positives = 245/336 (72%), Gaps = 6/336 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR+++TGGAGFIGSAL R+L+ D   QVL +DKLTYAGNL SL  I   + + F+Q DI 
Sbjct: 1   MRILITGGAGFIGSALIRHLILDTGHQVLNLDKLTYAGNLESLSSIDHDSRYEFVQADIV 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D+  + + L  F+PDAI++ AAESHVDRSI G  +FI TNI+GT+ LLE TR +W  L +
Sbjct: 61  DQSTVSAVLARFKPDAIMHLAAESHVDRSIDGPADFIQTNIVGTYSLLEATRAYWQTLPE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K  FRF  ISTDEVYG L     LF+E   Y PSSPYSA+KA+SD+LV AW  TYG+P
Sbjct: 121 PQKRAFRFHHISTDEVYGDLHGVDDLFTETTAYAPSSPYSASKAASDHLVRAWQRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           VLL+NCSNNYGP+HFPEKLIPL I   + G  + +YG+GQ VRDWL+VEDH RAL  V+ 
Sbjct: 181 VLLTNCSNNYGPFHFPEKLIPLVILNALAGKPLPVYGNGQQVRDWLFVEDHARALLKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTE----LIRFIEDRPGHDRRY 294
           +G +GE YNIGG+NE+KNID+V  I  LL+ L P+     E    LI F++DRPGHD RY
Sbjct: 241 EGAVGETYNIGGHNEQKNIDVVRSICALLEELAPRKPEGVEHYADLISFVQDRPGHDLRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           AID+SKI+ E+GW PQE  E+GL KTV WYL+N  W
Sbjct: 301 AIDASKIERELGWTPQETFETGLRKTVQWYLENLLW 336


>gi|160425304|gb|ABX39496.1| RmlB [Aeromonas hydrophila]
          Length = 361

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 191/340 (56%), Positives = 247/340 (72%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ D    V+  DKLTYAGNL SL E+S S+ ++F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIIWDTNDSVINFDKLTYAGNLESLAEVSASDRYAFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +R  +       QPDA+++ AAESHVDRSI G  +FI TNI+GT++LLE  R +W+ L +
Sbjct: 61  NRGELDRVFALHQPDAVMHLAAESHVDRSITGPADFIETNIVGTYVLLEAARAYWNDLDE 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
            +K  FRF  ISTDEVYG L             LF+E  PY PSSPYSA+KASSD+LV A
Sbjct: 121 TRKAAFRFHHISTDEVYGDLPHPDEVSAGEALPLFTETTPYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   ++G  + +YG G  +RDWLYVEDH 
Sbjct: 181 WRRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALDGKPLPVYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+  G IGE YNIGG+NE++N+D+V  +  LLD ++PK+ S+ + I ++ DRPGH
Sbjct: 241 RALYKVVTSGVIGETYNIGGHNEKQNLDVVHTVCDLLDDMVPKAGSYRDQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+SK+ +E+ W PQE  ESG+ KTV WYLDN  W
Sbjct: 301 DRRYAIDASKMSAELDWQPQETFESGIRKTVQWYLDNQQW 340


>gi|255068257|ref|ZP_05320112.1| dTDP-glucose 4,6-dehydratase [Neisseria sicca ATCC 29256]
 gi|255047527|gb|EET42991.1| dTDP-glucose 4,6-dehydratase [Neisseria sicca ATCC 29256]
          Length = 354

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 190/337 (56%), Positives = 251/337 (74%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           +++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL +++ S  ++F QVDICD
Sbjct: 3   KILVTGGAGFIGSAVVRHIIQNTQDSVINLDKLTYAGNLESLTDVADSPRYAFEQVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     + QPDA+++ AAESHVDRSI  A EFI TNI+GTF LLE  R +W  +S +
Sbjct: 63  RAELDRVFAQHQPDAVMHLAAESHVDRSIDSAGEFIQTNIVGTFNLLEAARAYWQQMSSE 122

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           K++ FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KREAFRFHHISTDEVYGDLHGTDDLFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I   ++G  + +YGDG  +RDWL+VEDH RALY V+ +
Sbjct: 183 IVTNCSNNYGPYHFPEKLIPLMILNALDGKPLPVYGDGMQIRDWLFVEDHARALYQVVTE 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NE+ NI++V  I  LL+ L+P+  +    + +LI F++DRPGHD RYA
Sbjct: 243 GVVGETYNIGGHNEKANIEVVKTICALLEELVPEKPAGVARYEDLITFVQDRPGHDVRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID++KI  E+GW PQE  ESG+ KTV WYL+N  WW+
Sbjct: 303 IDAAKIGRELGWKPQETFESGIRKTVQWYLNNKTWWQ 339


>gi|152972781|ref|YP_001337927.1| dTDP-glucose 4,6-dehydratase [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|150957630|gb|ABR79660.1| dTDP-glucose 4,6-dehydratase [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
          Length = 357

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 195/336 (58%), Positives = 240/336 (71%), Gaps = 6/336 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIGSA+ R ++     +V+V+DKLTYAGNL SL  ++Q   F+F QVDICDR
Sbjct: 6   ILVTGGAGFIGSAVVREIIQHTADRVVVVDKLTYAGNLMSLAPVAQDARFAFEQVDICDR 65

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             +    ++ QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R WW+ L+  +
Sbjct: 66  AELDRIFRQHQPDTVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARSWWNTLAMAQ 125

Query: 123 KDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           K  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P L
Sbjct: 126 KSAFRFHHISTDEVYGDLHGSDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPTL 185

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           ++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALYLV  +G
Sbjct: 186 ITNCSNNYGPYHFPEKLIPLTILNALAGKPLPVYGNGQQIRDWLYVEDHARALYLVATRG 245

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALI---PKSYSH-TELIRFIEDRPGHDRRYAI 296
             GE YNIGG+NERKNI++V  I  LL+ L    P+  +H  +LI F+ DRPGHD RYAI
Sbjct: 246 EPGETYNIGGHNERKNIEVVETICQLLEELAPDKPQGVAHYRDLIAFVADRPGHDLRYAI 305

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           D+SKI  E+GW P E   SG+ KTV WYL N  WWR
Sbjct: 306 DASKIARELGWTPAETFTSGMRKTVAWYLANEAWWR 341


>gi|289672185|ref|ZP_06493075.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. syringae
           FF5]
 gi|330980591|gb|EGH78694.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. aptata str.
           DSM 50252]
          Length = 360

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 197/338 (58%), Positives = 249/338 (73%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSAL R+L+N+ + +VL  DKLTYAGNL SL+ I+    + F+Q DIC
Sbjct: 1   MRILVTGGAGFIGSALIRHLINNTEHEVLNFDKLTYAGNLESLQSIATDTRYEFVQADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D+  + + L+ F P AI++ AAESHVDRSI G  EFI TNI+GT+ LLE TR WW  L +
Sbjct: 61  DQARVSAVLERFAPQAIMHLAAESHVDRSIDGPAEFIQTNIVGTYSLLEATRAWWLKLPE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            ++  FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KA+SD+LV AW  TYG+P
Sbjct: 121 AQRQAFRFHHISTDEVYGDLHGVDDLFTETTPYAPSSPYSASKAASDHLVRAWHRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+++NCSNNYGP+HFPEKLIPL I   + G  + +YG+G  VRDWLYVEDH RAL  V+ 
Sbjct: 181 VVVTNCSNNYGPFHFPEKLIPLVILNALAGKPLPVYGNGLQVRDWLYVEDHARALLKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G +GE YNIGG+NE+KNID+V  I  LLD L P+  +    +++LI ++ DRPGHD+RY
Sbjct: 241 EGEVGETYNIGGHNEQKNIDVVRGICALLDELAPQHPAGVAQYSDLITYVVDRPGHDQRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID+SKI  E+ W P+E  ESGL KTV WYLDN  W R
Sbjct: 301 AIDASKIDKELDWTPEETFESGLRKTVQWYLDNLDWCR 338


>gi|227357175|ref|ZP_03841544.1| dTDP-D-glucose-4,6-dehydratase [Proteus mirabilis ATCC 29906]
 gi|227162707|gb|EEI47674.1| dTDP-D-glucose-4,6-dehydratase [Proteus mirabilis ATCC 29906]
          Length = 357

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 193/337 (57%), Positives = 246/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R++VTGGAGFIGSA+ R+++++    V+V+DKLTYAGNL SL  ++ S  ++F QVDICD
Sbjct: 5   RILVTGGAGFIGSAVVRHIIDNTNDSVVVVDKLTYAGNLESLAPVANSERYAFEQVDICD 64

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  + S   ++QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +WS L +D
Sbjct: 65  RATLDSLFAQYQPDIVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARHFWSVLPED 124

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L+     F+E   Y PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 125 KKAAFRFHHISTDEVYGDLEGTDDFFTETTSYAPSSPYSASKASSDHLVRAWLRTYGLPT 184

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   I G  + +YG G+ +RDWLYVEDH RALYLV   
Sbjct: 185 LITNCSNNYGPYHFPEKLIPLIILNAISGKPLPVYGKGEQIRDWLYVEDHARALYLVATT 244

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
            + G+ YNIGG+NER+NID+V  I  LL+ L P   +    + +LI  ++DRPGHD RYA
Sbjct: 245 AQPGKTYNIGGHNERRNIDVVTTICELLEELHPNKPAGVAKYVDLITHVKDRPGHDLRYA 304

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID++KI +E+GW PQE  ESG+ KTV WYL+N  WW+
Sbjct: 305 IDAAKIAAELGWKPQETFESGIRKTVLWYLNNQTWWQ 341


>gi|301643908|ref|ZP_07243937.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 146-1]
 gi|301077728|gb|EFK92534.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 146-1]
          Length = 354

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 191/338 (56%), Positives = 249/338 (73%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ + + +V V+D LTYAGNL SL+ ++ S  +SF Q DI 
Sbjct: 1   MKILVTGGAGFIGSAVVRHIIENTRDEVRVVDCLTYAGNLESLEPVAGSERYSFSQTDIT 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   + +   EF+PD +++ AAESHVDRSI G   FI TN+IGTF LLE  R +WS L +
Sbjct: 61  DAAAVAAQFSEFRPDIVMHLAAESHVDRSIDGPAAFIQTNVIGTFTLLEAARHYWSELGE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K  FRF  ISTDEVYG L     LF+E+ PY PSSPYSA+KA SD+LV AW  TYG+P
Sbjct: 121 AQKQAFRFHHISTDEVYGDLHGTDDLFTEETPYAPSSPYSASKAGSDHLVRAWNRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+++NCSNNYGPYHFPEKLIPL I   + G  + +YG+G+ +RDWLYVEDH RALY V  
Sbjct: 181 VVVTNCSNNYGPYHFPEKLIPLTILNALAGKPLPVYGNGEQIRDWLYVEDHARALYKVAT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALI---PKSYSH-TELIRFIEDRPGHDRRY 294
           +G+ GE YNIGG+NERKNID+V  I  +LD ++   P + +H  +LI F+ DRPGHD RY
Sbjct: 241 EGKSGETYNIGGHNERKNIDVVRTICAILDKVVAQKPGNITHFADLITFVTDRPGHDLRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID++KI+ ++GW PQE  ESG+ KTV WYL+N  WW+
Sbjct: 301 AIDAAKIQRDLGWVPQETFESGIEKTVHWYLNNQTWWQ 338


>gi|262040897|ref|ZP_06014123.1| dTDP-glucose 4,6-dehydratase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259041786|gb|EEW42831.1| dTDP-glucose 4,6-dehydratase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 357

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 195/336 (58%), Positives = 240/336 (71%), Gaps = 6/336 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIGSA+ R ++     +V+V+DKLTYAGNL SL  ++Q   F+F QVDICDR
Sbjct: 6   ILVTGGAGFIGSAVVREIIQHTADRVVVVDKLTYAGNLMSLAPVAQDARFAFEQVDICDR 65

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             +    ++ QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R WW+ L+  +
Sbjct: 66  AELDRIFRQHQPDTVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARSWWNTLATAQ 125

Query: 123 KDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           K  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P L
Sbjct: 126 KSAFRFHHISTDEVYGDLHGSDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPTL 185

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           ++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALYLV  +G
Sbjct: 186 ITNCSNNYGPYHFPEKLIPLTILNALAGKPLPVYGNGQQIRDWLYVEDHARALYLVATRG 245

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALI---PKSYSH-TELIRFIEDRPGHDRRYAI 296
             GE YNIGG+NERKNI++V  I  LL+ L    P+  +H  +LI F+ DRPGHD RYAI
Sbjct: 246 EPGETYNIGGHNERKNIEVVETICQLLEELAPDKPQGVAHYRDLIAFVADRPGHDLRYAI 305

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           D+SKI  E+GW P E   SG+ KTV WYL N  WWR
Sbjct: 306 DASKIARELGWTPAETFTSGMRKTVAWYLANEAWWR 341


>gi|312958394|ref|ZP_07772915.1| dTDP-glucose 4,6-dehydratase [Pseudomonas fluorescens WH6]
 gi|311287458|gb|EFQ66018.1| dTDP-glucose 4,6-dehydratase [Pseudomonas fluorescens WH6]
          Length = 360

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 194/338 (57%), Positives = 251/338 (74%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR+++TGGAGFIGSAL R+L+   + +VL +DKLTYAGNL SL  I+ ++ + F+Q DI 
Sbjct: 1   MRILITGGAGFIGSALIRHLIQHTEHEVLNLDKLTYAGNLESLASIASNSRYEFVQADII 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D+  + + L  F+PDAI++ AAESHVDRSI G  +F+ TNI+GT+ LLE  R +W  L++
Sbjct: 61  DQATVSAVLARFEPDAIMHLAAESHVDRSIDGPSDFVQTNIVGTYSLLEAARGYWQQLAE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
             +  FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KA+SD+LV AW HTYG+P
Sbjct: 121 PARRAFRFHHISTDEVYGDLHGVDDLFTEATPYAPSSPYSASKAASDHLVRAWRHTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           VLL++CSNNYGP+HFPEKLIPL I   + G+ + +YGDG  VRDWLYVEDH RAL  V+ 
Sbjct: 181 VLLTHCSNNYGPFHFPEKLIPLVILNALAGNPLPVYGDGLQVRDWLYVEDHARALLSVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRY 294
           +G +GE YNIGG+NE+KNID+V  I  LL+ L P+      ++ +LI F++DRPGHD+RY
Sbjct: 241 QGVVGETYNIGGHNEQKNIDVVRSICALLEELAPQHPQGVNTYIDLITFVKDRPGHDQRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID+SKI+ E+GW P E  E+GL KTV WYLDN  W R
Sbjct: 301 AIDASKIQRELGWEPMETFETGLRKTVQWYLDNLEWCR 338


>gi|330989099|gb|EGH87202.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. lachrymans
           str. M301315]
          Length = 360

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 196/338 (57%), Positives = 252/338 (74%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSAL R+L+N+ + +VL  DKLTYAGNL SL+ I+    + F+Q DIC
Sbjct: 1   MRILVTGGAGFIGSALIRHLINNTEHEVLNFDKLTYAGNLESLQSIATDTRYEFVQADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D+  + + L+ F P AI++ AAESHVDRSI G  EFI TNI+GT+ LLE TR +W  L +
Sbjct: 61  DQASVSAVLERFAPQAIMHLAAESHVDRSIDGPAEFIQTNIVGTYSLLEGTRAYWLRLPE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            ++  FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KA+SD+LV AW  TYG+P
Sbjct: 121 AERQAFRFHHISTDEVYGDLHGVDDLFTETTPYAPSSPYSASKAASDHLVRAWHRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+++NCSNNYGP+HFPEKLIPL I   + G  + +YG+G  VRDWLYVEDH RAL  V+ 
Sbjct: 181 VVVTNCSNNYGPFHFPEKLIPLVILNALAGKPLPVYGNGLQVRDWLYVEDHARALLKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G++GE YNIGG+NE+KNID+V  I  LLD L P+  +    +++LI ++ DRPGHD+RY
Sbjct: 241 EGKVGETYNIGGHNEQKNIDVVRGICALLDELAPQHPTGVAQYSDLITYVVDRPGHDQRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID+SKI +++GW P+E  ESGL KTV WYLDN  W R
Sbjct: 301 AIDASKIDNDLGWTPEETFESGLRKTVQWYLDNLDWCR 338


>gi|59803191|gb|AAX07738.1| dTDP-D-glucose-4,6-dehydratase [Escherichia coli]
          Length = 379

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 187/340 (55%), Positives = 247/340 (72%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           ++++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL E+S S+ ++F   DIC
Sbjct: 20  VKILVTGGAGFIGSAVVRHIIKNTQDDVVNVDKLTYAGNLESLSEVSDSDRYAFEHADIC 79

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D++ +   L + +PDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L +
Sbjct: 80  DKDAMDRILAKHKPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARAYWSTLDE 139

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
             K  FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 140 QAKKAFRFHHISTDEVYGDLPHPDEHPASTELSLFTETTAYAPSSPYSASKASSDHLVRA 199

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG P +++NCSNNYGPYHFPEKLIPL I   ++G  + +YG G  +RDWLYVEDH 
Sbjct: 200 WLRTYGFPTIVTNCSNNYGPYHFPEKLIPLVILNALDGKVLPIYGKGDQIRDWLYVEDHA 259

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE++N+D+V  I  LLD ++PK  S+ + I ++ DRPGH
Sbjct: 260 RALYTVVTQGKPGETYNIGGHNEKQNLDVVHTICDLLDEIVPKEGSYRDQITYVTDRPGH 319

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID++KI +E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 320 DRRYAIDANKISAELGWTPQETFESGIRKTVEWYLTNTEW 359


>gi|268593353|ref|ZP_06127574.1| dTDP-glucose 4,6-dehydratase [Providencia rettgeri DSM 1131]
 gi|291311050|gb|EFE51503.1| dTDP-glucose 4,6-dehydratase [Providencia rettgeri DSM 1131]
          Length = 352

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 194/336 (57%), Positives = 247/336 (73%), Gaps = 6/336 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++ VTGGAGFIGSA+ R+++N+    V+ IDKLTYAGNL SL  IS+S+ + F Q DIC
Sbjct: 1   MKIFVTGGAGFIGSAVIRHIINNTNDSVINIDKLTYAGNLESLASISESSNYIFAQTDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   I+   +  QPDA+++ AAESHVDRSI G  EFI TNIIGT+ LLE  R +W+ L  
Sbjct: 61  DSAAIKQLFELHQPDAVMHLAAESHVDRSIDGPSEFIQTNIIGTYTLLEAARHYWNQLPS 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           +KK  FRF  ISTDEVYG L+    LF+E   Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 EKKSAFRFHHISTDEVYGDLESTTDLFTETTSYAPSSPYSASKASSDHLVRAWQRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYGPYH+PEKLIPL I   +EG  + +YG+GQ +RDWLYVEDH RALY V+ 
Sbjct: 181 TIVTNCSNNYGPYHYPEKLIPLIILNALEGKPLPVYGNGQQIRDWLYVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G+I E YNIGG+NE+ NID+V  I  +LD L+P   +    + ELI ++ DRPGHD RY
Sbjct: 241 EGKISETYNIGGHNEKANIDVVKTICSILDELVPNKPNGINHYEELITYVTDRPGHDLRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           AID++KIK+E+ W P+E  E+GL KTV WYL N+ W
Sbjct: 301 AIDATKIKNELNWVPEETFETGLRKTVEWYLANSEW 336


>gi|320326580|gb|EFW82630.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. glycinea
           str. B076]
 gi|320331098|gb|EFW87070.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. glycinea
           str. race 4]
 gi|330871969|gb|EGH06118.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. glycinea
           str. race 4]
          Length = 360

 Score =  405 bits (1042), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 195/338 (57%), Positives = 253/338 (74%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSAL R+L+N+ + +VL  DKLTYAGNL SL+ I+ +  + F+Q DIC
Sbjct: 1   MRILVTGGAGFIGSALIRHLINNTEHEVLNFDKLTYAGNLESLQSIATNTRYEFVQADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D+  + + L+ F P AI++ AAESHVDRSI G  EFI TNI+GT+ LLE TR +W  L +
Sbjct: 61  DQASVSAVLERFAPQAIMHLAAESHVDRSIDGPAEFIQTNIVGTYSLLEATRAYWLKLPE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            ++  FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KA+SD+LV AW  TYG+P
Sbjct: 121 AERQAFRFHHISTDEVYGDLHGVDDLFTETTPYAPSSPYSASKAASDHLVRAWHRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+++NCSNNYGP+HFPEKLIPL I   + G  + +YG+G  VRDWLYVEDH RAL  V+ 
Sbjct: 181 VVVTNCSNNYGPFHFPEKLIPLVILNALAGKPLPVYGNGLQVRDWLYVEDHARALLKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G++GE YNIGG+NE+KNID+V  I  LLD L P+  +    +++LI ++ DRPGHD+RY
Sbjct: 241 EGKVGETYNIGGHNEQKNIDVVRGICALLDELAPQHPAGIAQYSDLITYVVDRPGHDQRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID+SKI +++GW P+E  +SGL KTV WYLDN  W R
Sbjct: 301 AIDASKIDNDLGWTPEETFKSGLRKTVQWYLDNLDWCR 338


>gi|300721431|ref|YP_003710702.1| dTDP-glucose 4,6-dehydratase [Xenorhabdus nematophila ATCC 19061]
 gi|297627919|emb|CBJ88465.1| dTDP-glucose 4,6-dehydratase [Xenorhabdus nematophila ATCC 19061]
          Length = 356

 Score =  405 bits (1042), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 192/338 (56%), Positives = 249/338 (73%), Gaps = 7/338 (2%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R+++TGGAGFIGSA+ R+++N  +  V+V+D LTYAGNL SL  +++   ++F QVDIC 
Sbjct: 3   RILITGGAGFIGSAVVRHIINQTEDSVVVVDSLTYAGNLESLAPVAEHPRYAFEQVDICQ 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           RE +    +++QPDA+++ AAESHVDRSI G   FI TNIIGT+ILLE  R +W  L ++
Sbjct: 63  REALDRVFQQYQPDAVMHLAAESHVDRSIDGPAAFIETNIIGTYILLEAARTYWQQLDEE 122

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           K+  FRF  ISTDEVYG LD  +  F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KRAAFRFHHISTDEVYGDLDGQESFFTETTPYAPSSPYSASKASSDHLVRAWRRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I     G  + +YG G+ +RDWLYVEDH RAL+LV+ K
Sbjct: 183 VITNCSNNYGPYHFPEKLIPLMILNAQAGKPLPVYGKGEQIRDWLYVEDHARALHLVVTK 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
              GE YNIGG+NER+NID+V  I  LL+ L P+  +    + +LI ++ DRPGHD RYA
Sbjct: 243 AVPGETYNIGGHNERRNIDVVETICGLLEELCPEKPAGVSHYRDLITYVTDRPGHDMRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDN-NWWWR 332
           ID++KI+ E+GW PQE  ESG+ KTV WYL + NWW R
Sbjct: 303 IDAAKIERELGWTPQETFESGIRKTVQWYLGHENWWCR 340


>gi|261365322|ref|ZP_05978205.1| dTDP-glucose 4,6-dehydratase [Neisseria mucosa ATCC 25996]
 gi|288566255|gb|EFC87815.1| dTDP-glucose 4,6-dehydratase [Neisseria mucosa ATCC 25996]
          Length = 361

 Score =  405 bits (1042), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 191/337 (56%), Positives = 250/337 (74%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           +++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL +++ S  ++F QVDICD
Sbjct: 3   KILVTGGAGFIGSAVVRHIIKNTQDSVVNLDKLTYAGNLESLTDVADSLRYAFEQVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     + QPDA+++ AAESHVDRSI  A EFI TNI+GTF LLE  R +W  +S +
Sbjct: 63  RAELGRVFAQHQPDAVMHLAAESHVDRSIDSAGEFIQTNIVGTFNLLEAARTYWQQMSSE 122

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           K+  FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KQAAFRFHHISTDEVYGDLHGTDDLFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I   ++G  + +YGDG  +RDWL+VEDH RALY V+ +
Sbjct: 183 IVTNCSNNYGPYHFPEKLIPLMILNALDGKPLPVYGDGMQIRDWLFVEDHARALYQVVTE 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NE+ NI++V  I  LL+ L+P+  +    + +LI F++DRPGHD RYA
Sbjct: 243 GVVGETYNIGGHNEKANIEVVKTICALLEELVPEKPAGVARYEDLITFVQDRPGHDVRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID++KI  E+GW PQE  ESG+ KTV WYLDN  WW+
Sbjct: 303 IDAAKIGRELGWKPQETFESGIRKTVQWYLDNKTWWQ 339


>gi|84386900|ref|ZP_00989924.1| dTDP-D-glucose 4,6-dehydratase [Vibrio splendidus 12B01]
 gi|84378190|gb|EAP95049.1| dTDP-D-glucose 4,6-dehydratase [Vibrio splendidus 12B01]
          Length = 371

 Score =  405 bits (1042), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 188/346 (54%), Positives = 249/346 (71%), Gaps = 16/346 (4%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+    V+ +DKLTYAGNL SL E+  +  + F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVIRHIINNTSDSVINVDKLTYAGNLESLVEVDSNEHYVFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +R  +     E +PDA+++ AAESHVDRSI G   FI TNI+GT+ LLE TR +W+ L +
Sbjct: 61  NRSELDRVFVEHKPDAVMHLAAESHVDRSITGPAAFIETNIVGTYTLLEATREYWNTLEE 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------------DKGLFSEDMPYNPSSPYSATKASS 164
             K +FRF  ISTDEVYG L                +  +F E   Y PSSPYSA+KASS
Sbjct: 121 SAKSEFRFHHISTDEVYGDLPHPDDLETGTEPSANEELPMFLETTSYEPSSPYSASKASS 180

Query: 165 DYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWL 224
           D+LV AW  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWL
Sbjct: 181 DHLVRAWLRTYGLPTMVTNCSNNYGPYHFPEKLIPLVILNALEGKDLPIYGKGDQIRDWL 240

Query: 225 YVEDHVRALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFI 284
           +VEDH RALY V+ +G++GE YNIGG+NE+KN+++V  I  +LD L+PK  ++ E I ++
Sbjct: 241 FVEDHARALYKVVTEGKVGETYNIGGHNEKKNLEVVSTICEILDTLVPKESAYAEQITYV 300

Query: 285 EDRPGHDRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           +DRPGHDRRYAIDSSK++ E+GW P+E  ++GL KTV WYLDN+ W
Sbjct: 301 QDRPGHDRRYAIDSSKMQRELGWTPEETFKTGLRKTVQWYLDNSTW 346


>gi|322832467|ref|YP_004212494.1| dTDP-glucose 4,6-dehydratase [Rahnella sp. Y9602]
 gi|321167668|gb|ADW73367.1| dTDP-glucose 4,6-dehydratase [Rahnella sp. Y9602]
          Length = 354

 Score =  405 bits (1042), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 197/338 (58%), Positives = 242/338 (71%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M +++TGGAGFIGSA+ R++++     VLV+D LTYAGNL SLK +     + F   +IC
Sbjct: 1   MNILITGGAGFIGSAVVRHIISATNDNVLVVDSLTYAGNLESLKLVENDPRYRFSLANIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  + +   EF+PDA+++ AAESHVDRSI G   FI TNI GT+ LLE  R +WS L  
Sbjct: 61  DRAALDAIFSEFKPDAVMHLAAESHVDRSIDGPSAFIDTNITGTYTLLEAARHYWSALED 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           +KK  FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KA+SD+LV AW  TYG P
Sbjct: 121 EKKILFRFHHISTDEVYGDLHGTTELFTETTPYAPSSPYSASKAASDHLVRAWNRTYGFP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            L++NCSNNYGPYHFPEKLIPL I   I G  + +YGDG  +RDWL+VEDH RALY V+ 
Sbjct: 181 TLVTNCSNNYGPYHFPEKLIPLVILNAIAGKPLPVYGDGAQIRDWLFVEDHARALYEVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALI---PKSYSH-TELIRFIEDRPGHDRRY 294
           KG IGE YNIGG+NERKNID+V  I  +LD L+   P   +H  ELI F++DRPGHD RY
Sbjct: 241 KGVIGETYNIGGHNERKNIDVVTTICAILDQLVSEKPAGLTHFNELITFVKDRPGHDMRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID+SKI+ E+GW P E  ESG+ KTV WYL+N  WW+
Sbjct: 301 AIDASKIERELGWKPVETFESGILKTVKWYLENETWWK 338


>gi|330970570|gb|EGH70636.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 360

 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 196/338 (57%), Positives = 249/338 (73%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSAL R+L+N+   +VL  DKLTYAGNL SL+ I+    + F+Q DIC
Sbjct: 1   MRILVTGGAGFIGSALIRHLINNTDHEVLNFDKLTYAGNLESLQSIATDTRYEFVQADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D+  + + L+ F P AI++ AAESHVDRSI G  EFI TNI+GT+ LLE TR WW  L +
Sbjct: 61  DQTRVSAVLERFAPQAIMHLAAESHVDRSIDGPAEFIQTNIVGTYSLLEATRAWWLKLPE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            ++  FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KA+SD+LV AW  TYG+P
Sbjct: 121 AQRQAFRFHHISTDEVYGDLHGVDDLFTETTPYAPSSPYSASKAASDHLVRAWHRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+++NCSNNYGP+HFPEKLIPL I   + G  + +YG+G  VRDWLYVEDH RAL  V+ 
Sbjct: 181 VVVTNCSNNYGPFHFPEKLIPLVILNALAGKPLPVYGNGLQVRDWLYVEDHARALLKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G +GE YNIGG+NE+KNID+V  I  LLD L P+  +    +++LI ++ DRPGHD+RY
Sbjct: 241 EGEVGETYNIGGHNEQKNIDVVRGICALLDELAPQHPAGVAQYSDLITYVVDRPGHDQRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID+ KI +++GW P+E  ESGL KTV WYLDN  W R
Sbjct: 301 AIDAGKIDNDLGWTPEETFESGLRKTVQWYLDNLDWCR 338


>gi|319638875|ref|ZP_07993633.1| dTDP-glucose 4,6-dehydratase [Neisseria mucosa C102]
 gi|317399779|gb|EFV80442.1| dTDP-glucose 4,6-dehydratase [Neisseria mucosa C102]
          Length = 355

 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 189/337 (56%), Positives = 250/337 (74%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           +++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL E++ +  ++F QVDIC+
Sbjct: 3   KILVTGGAGFIGSAVVRHIIQNTQDSVVNVDKLTYAGNLESLTEVADNPRYAFEQVDICN 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     + QPDA+++ AAESHVDRSI  A EFI TNI+GTF LLE  R +W  +  +
Sbjct: 63  RAELDRVFAQHQPDAVMHLAAESHVDRSIDSAGEFIQTNIVGTFNLLEAARAYWQQMPSE 122

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           K++ FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KREAFRFHHISTDEVYGDLHGTDDLFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I   ++G  + +YGDG  +RDWL+VEDH RALY V+ +
Sbjct: 183 IVTNCSNNYGPYHFPEKLIPLMILNALDGKPLPVYGDGMQIRDWLFVEDHARALYQVVTE 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NE+ NI++V  I  LL+ L+P+  +    + +LI F++DRPGHD RYA
Sbjct: 243 GVVGETYNIGGHNEKANIEVVKTICALLEELVPEKPAGVARYEDLITFVQDRPGHDVRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID++KI  E+GW PQE  ESG+ KTV WYLDN  WW+
Sbjct: 303 IDAAKIARELGWKPQETFESGIRKTVQWYLDNKTWWQ 339


>gi|126175093|ref|YP_001051242.1| dTDP-glucose 4,6 dehydratase [Shewanella baltica OS155]
 gi|125998298|gb|ABN62373.1| dTDP-glucose 4,6-dehydratase [Shewanella baltica OS155]
          Length = 356

 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 186/340 (54%), Positives = 250/340 (73%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL  + ++  ++F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVVRFIINNTQDSVINVDKLTYAGNLESLLSVEKNQRYAFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     ++QPDA+++ AAESHVDRSI G  +FI TNI+GT+ LLE  R +W  L  
Sbjct: 61  DRVELDRVFNKYQPDAVMHLAAESHVDRSITGPGDFIQTNIVGTYTLLEAARHYWMQLDA 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           ++K  FRF  ISTDEVYG L          +  LF+E  PY PSSPYSA+KASSD+LV A
Sbjct: 121 ERKSAFRFHHISTDEVYGDLPHPDEVVPGSELALFTEITPYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WLRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+IGE YNIGG+NE++N+++V  I  +LD+L+PK+  + E I ++ DRPGH
Sbjct: 241 RALYKVVTEGKIGETYNIGGHNEKQNLEVVQTICSILDSLVPKATPYAEQITYVTDRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID++K+ +E+ W P+E  E+GL KT+ WYL N  W
Sbjct: 301 DRRYAIDATKMSNELKWQPEETFETGLRKTIEWYLANQEW 340


>gi|117621343|ref|YP_857412.1| dTDP-glucose 4,6 dehydratase [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117562750|gb|ABK39698.1| dTDP-glucose 4,6-dehydratase [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 361

 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 189/340 (55%), Positives = 246/340 (72%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ +    VL +DKLTYAGNL SL  ++ S  ++F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIIQNTNDSVLNLDKLTYAGNLESLASVASSERYAFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +R  +     + QPDA+++ AAESHVDRSI G  +FI TNI+GT++LLE  R +W+ L +
Sbjct: 61  NRAELERVFAQHQPDAVMHLAAESHVDRSITGPADFIETNIVGTYMLLEVARAYWNGLDE 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
            +K  FRF  ISTDEVYG L             LF+E  PY PSSPYSA+KASSD+LV A
Sbjct: 121 VRKAAFRFHHISTDEVYGDLPHPDEVALGVALPLFTETTPYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   ++G  + +YG G  +RDWLYVEDH 
Sbjct: 181 WRRTYGLPTVVTNCSNNYGPYHFPEKLIPLVILNSLDGKPLPVYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+  G IGE YNIGG+NE++N+++V  I  LLD ++PK+ S+ + I ++ DRPGH
Sbjct: 241 RALYTVVTTGVIGETYNIGGHNEKQNLEVVHTICDLLDEMVPKTGSYHDQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+SK+  E+ W PQE  ESG+ KTV WYLDN  W
Sbjct: 301 DRRYAIDASKMSVELAWQPQETFESGIRKTVQWYLDNQQW 340


>gi|238021506|ref|ZP_04601932.1| hypothetical protein GCWU000324_01406 [Kingella oralis ATCC 51147]
 gi|237868486|gb|EEP69492.1| hypothetical protein GCWU000324_01406 [Kingella oralis ATCC 51147]
          Length = 354

 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 192/338 (56%), Positives = 249/338 (73%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N  +  V+ +DKLTYAGNL+S+  ++ S  ++F+Q DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINHTQDSVVNLDKLTYAGNLDSVSSVANSERYAFVQADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     E QPDA+++ AAESHVDRSI  A EFI TNI+GTF LLE  R ++  L +
Sbjct: 61  DRAALDKIFAEHQPDAVMHLAAESHVDRSIDSAGEFIQTNIVGTFTLLEAARAYYQTLPE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           +++  FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 NRQAAFRFHHISTDEVYGDLHGTDDLFTETTPYAPSSPYSASKASSDHLVRAWRRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYG YHFPEKLIP  I   ++G  + +YGDG+ +RDWLYVEDH RALYLV+ 
Sbjct: 181 TIVTNCSNNYGCYHFPEKLIPHMILNALDGKPLPVYGDGKQIRDWLYVEDHARALYLVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALI---PKSYSH-TELIRFIEDRPGHDRRY 294
           +GRIGE YNIGG NE++NI++V  I  LL+ L    P+  +H  +LI  + DR GHD RY
Sbjct: 241 QGRIGETYNIGGFNEKQNIEVVRTICQLLEELAPNKPQGIAHYADLITHVTDRAGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID+SKI+ E+GW PQE  ESG+ KTV WYLDN  WW+
Sbjct: 301 AIDASKIQRELGWAPQETFESGIRKTVQWYLDNQAWWQ 338


>gi|317494814|ref|ZP_07953225.1| dTDP-glucose 4,6-dehydratase [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316917139|gb|EFV38487.1| dTDP-glucose 4,6-dehydratase [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 354

 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 191/337 (56%), Positives = 245/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R++VTGGAGFIGSA+ R+++ D    V+V+DKLTYAGNL SL  +S S+ ++F QVDIC+
Sbjct: 3   RILVTGGAGFIGSAVVRHIIADTNNSVVVVDKLTYAGNLESLTPVSDSDRYAFEQVDICN 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     ++QPD +++ AAESHVDRSI G   FI TNI+GT+ +LE  R +W+ L + 
Sbjct: 63  RTELDRVFAQYQPDYVMHLAAESHVDRSIDGPAAFIETNIVGTYTILEAARQYWNGLDEQ 122

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           +K  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG P 
Sbjct: 123 RKSAFRFHHISTDEVYGDLHGTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGFPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I   + G  + +YG+G  +RDWLYVEDH RALYLV+ +
Sbjct: 183 IVTNCSNNYGPYHFPEKLIPLIILNALAGKPLPVYGNGAQIRDWLYVEDHARALYLVVTE 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G IGE YNIGG+NERKNID+V  +  LL+ L+P        + +LI ++ DRPGHD RYA
Sbjct: 243 GVIGETYNIGGHNERKNIDVVKTVCTLLEELVPSKPDGVEHYADLITYVTDRPGHDMRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID++KI+ E+GW PQE  ESG+ KTV WYL N  WW+
Sbjct: 303 IDAAKIERELGWRPQETFESGIRKTVEWYLANESWWK 339


>gi|239993211|ref|ZP_04713735.1| dTDP-glucose 4,6 dehydratase [Alteromonas macleodii ATCC 27126]
          Length = 360

 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 194/342 (56%), Positives = 243/342 (71%), Gaps = 10/342 (2%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIGSA+ R+L+ND    V+ +DKLTYAGNL SL  +S S+ +SF QVDICD 
Sbjct: 5   ILVTGGAGFIGSAVVRHLINDTDHTVVNLDKLTYAGNLESLTPVSDSDRYSFEQVDICDA 64

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
           E ++      QPD I++ AAESHVDRSI G  EFI TN++GT+ LLE+ R +WS L  DK
Sbjct: 65  EEVKRVFNTHQPDIIMHLAAESHVDRSIDGPGEFIQTNVVGTYTLLEQARAYWSALEGDK 124

Query: 123 KDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLAWG 172
           K  F+F  ISTDEVYG L          +  LF+E  PY PSSPYSA+KASSD LV +W 
Sbjct: 125 KAGFKFHHISTDEVYGDLPHPDEVEPGTELPLFTETTPYAPSSPYSASKASSDQLVRSWL 184

Query: 173 HTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRA 232
            TY +P L++NCSNNYGPYHFPEKLIPL I   + G  + +YG G  +RDWLYVEDH RA
Sbjct: 185 RTYKLPTLVTNCSNNYGPYHFPEKLIPLVILNALAGKPLPVYGKGNQIRDWLYVEDHARA 244

Query: 233 LYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDR 292
           L +V   G IGE YNIGG+NE++NI++V  I  +LD + PK   + E I +++DRPGHD 
Sbjct: 245 LVVVALNGEIGETYNIGGHNEKQNIEVVQTICSILDEVKPKDTKYAEQITYVQDRPGHDM 304

Query: 293 RYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           RYAID+SKI+ E+GW PQE  ESG+ KTV WYL N  WW+ +
Sbjct: 305 RYAIDASKIERELGWKPQETFESGIRKTVEWYLANEGWWKAV 346


>gi|254669573|emb|CBA03564.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis alpha153]
          Length = 386

 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 189/337 (56%), Positives = 248/337 (73%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           +++VTGGAGFIGSA+ R+++ND +  V+ +DKLTYAGNL SL+ ++    ++F QVDICD
Sbjct: 34  KILVTGGAGFIGSAVVRHIINDTQDAVVNVDKLTYAGNLESLESVANHPRYAFEQVDICD 93

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E QPDA+++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W  +  +
Sbjct: 94  RAALDRVFAEHQPDAVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWHDMPPE 153

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 154 KKAAFRFHHISTDEVYGDLHGTDDLFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 213

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I   ++G  + +YGDG  +RDWL+VEDH RALY V+ +
Sbjct: 214 IVTNCSNNYGPYHFPEKLIPLMILNALDGKPLPVYGDGMQIRDWLFVEDHARALYQVVTE 273

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NE+ NI++V  I  LL+ L+P+  +    + +LI F++DRPGHD RYA
Sbjct: 274 GVVGETYNIGGHNEKANIEVVKTICTLLEELVPEKPAGVARYEDLITFVQDRPGHDVRYA 333

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           +D++KI+ ++GW P E  ESGL KTV WYLDN  WW+
Sbjct: 334 VDAAKIRRDLGWLPLETFESGLRKTVQWYLDNKTWWQ 370


>gi|22124281|ref|NP_667704.1| dTDP-D-glucose-4,6-dehydratase [Yersinia pestis KIM 10]
 gi|45442935|ref|NP_994474.1| dTDP-D-glucose-4,6-dehydratase [Yersinia pestis biovar Microtus
           str. 91001]
 gi|108806154|ref|YP_650070.1| dTDP-D-glucose-4,6-dehydratase [Yersinia pestis Antiqua]
 gi|108810267|ref|YP_646034.1| dTDP-D-glucose-4,6-dehydratase [Yersinia pestis Nepal516]
 gi|145600730|ref|YP_001164806.1| dTDP-D-glucose-4,6-dehydratase [Yersinia pestis Pestoides F]
 gi|167469845|ref|ZP_02334549.1| dTDP-D-glucose-4,6-dehydratase [Yersinia pestis FV-1]
 gi|21957051|gb|AAM83955.1|AE013637_5 dTDP-glucose 4,6-dehydratase [Yersinia pestis KIM 10]
 gi|45437802|gb|AAS63351.1| dTDP-glucose 4,6-dehydratase [Yersinia pestis biovar Microtus str.
           91001]
 gi|108773915|gb|ABG16434.1| dTDP-glucose 4,6-dehydratase [Yersinia pestis Nepal516]
 gi|108778067|gb|ABG12125.1| dTDP-glucose 4,6-dehydratase [Yersinia pestis Antiqua]
 gi|145212426|gb|ABP41833.1| dTDP-glucose 4,6-dehydratase [Yersinia pestis Pestoides F]
          Length = 357

 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 192/337 (56%), Positives = 245/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R++VTGGAGFIGSA+ R++++     V+V+DKLTYAGNL SL  ++ S  ++F QVDICD
Sbjct: 5   RILVTGGAGFIGSAVVRHIIDGTSDSVVVVDKLTYAGNLESLSVVAGSERYAFEQVDICD 64

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
              +     ++QP+ +++ AAESHVDRSI G   FI TN++GT+ LLE  R +W  LS +
Sbjct: 65  SSELDRVFAQYQPNVVMHLAAESHVDRSIDGPAAFIETNVVGTYTLLEAARHYWQQLSVE 124

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            K  FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 125 AKQAFRFHHISTDEVYGDLHGTDDLFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 184

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+G  VRDWLYVEDH RALY V+ +
Sbjct: 185 LVTNCSNNYGPYHFPEKLIPLVILNALAGKPLPVYGNGAQVRDWLYVEDHARALYQVVTE 244

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NERKNI++V  I  LLD L+P   +    + +LI +++DRPGHD RYA
Sbjct: 245 GVVGETYNIGGHNERKNIEVVETICALLDELVPAKPAGIAHYRDLITYVKDRPGHDMRYA 304

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+ KI+ E+GW PQE  ESG+ KTV WYL+N  WWR
Sbjct: 305 IDAGKIERELGWRPQETFESGIRKTVLWYLNNESWWR 341


>gi|209696410|ref|YP_002264341.1| dTDP-glucose 4,6 dehydratase [Aliivibrio salmonicida LFI1238]
 gi|208010364|emb|CAQ80702.1| dTDP-glucose 4,6-dehydratase [Aliivibrio salmonicida LFI1238]
          Length = 371

 Score =  405 bits (1040), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 188/346 (54%), Positives = 248/346 (71%), Gaps = 16/346 (4%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL  I  +  + F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVINVDKLTYAGNLESLASIESNERYVFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     + +PDA+++ AAESHVDRSI G  +FI TNI+GT+ LLE TR +W+ LS+
Sbjct: 61  DRAELDRVFAQCKPDAVMHLAAESHVDRSITGPADFIQTNIVGTYTLLEATRAYWNTLSE 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------------DKGLFSEDMPYNPSSPYSATKASS 164
           D K  FRF  ISTDEVYG L                +  LF+E   Y PSSPYSA+KASS
Sbjct: 121 DAKKAFRFHHISTDEVYGDLPHPDDIEDGTEPSANKELPLFTETTSYEPSSPYSASKASS 180

Query: 165 DYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWL 224
           D+LV AW  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWL
Sbjct: 181 DHLVRAWLRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPIYGKGDQIRDWL 240

Query: 225 YVEDHVRALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFI 284
           +VEDH RALY V+ +G++GE YNIGG+NE++N+++V  I  +LD+L+PK   + E I ++
Sbjct: 241 FVEDHARALYKVVTEGKVGETYNIGGHNEKQNLEVVQTICAILDSLVPKESKYQEQITYV 300

Query: 285 EDRPGHDRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
            DRPGHDRRYAIDSSK++ E+ W P E  E+GL KT+ WYL+N  W
Sbjct: 301 TDRPGHDRRYAIDSSKMQRELSWTPLETFETGLKKTIEWYLNNQEW 346


>gi|89094082|ref|ZP_01167025.1| dTDP-D-glucose 4;6-dehydratase [Oceanospirillum sp. MED92]
 gi|89081557|gb|EAR60786.1| dTDP-D-glucose 4;6-dehydratase [Oceanospirillum sp. MED92]
          Length = 350

 Score =  405 bits (1040), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 190/337 (56%), Positives = 255/337 (75%), Gaps = 5/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+L+VTGGAGFIGSAL RY++N    +++ +D LTYAGNL+SL   S+ + ++F QVDIC
Sbjct: 1   MKLLVTGGAGFIGSALVRYILNATDDEIVNVDCLTYAGNLDSLPCASEFDRYAFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D + +     + QPDA+++ AAESHVDRSI G  +FI TNI+GTF LL+ +R ++  LS+
Sbjct: 61  DHQSLTKVFAKHQPDAVMHLAAESHVDRSIEGPAQFIQTNIVGTFNLLDVSRRYYENLSE 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG-LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           +K+  FRF  ISTDEVYG LD+G  F+E+ PY PSSPYSA+KASSD+LV AWG TY +PV
Sbjct: 121 EKRSIFRFHHISTDEVYGDLDEGGFFTEETPYAPSSPYSASKASSDHLVRAWGRTYNLPV 180

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIP  I   + G  + +YGDGQ +RDWLYVEDH +ALY V+ +
Sbjct: 181 VITNCSNNYGPYHFPEKLIPHMILNALSGKELPIYGDGQQIRDWLYVEDHAKALYTVVTQ 240

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG NE+ N+++V +I  LL+ L+P+  S    + +LI +++DRPGHD RYA
Sbjct: 241 GGLGETYNIGGYNEKTNLEVVHKICELLEELVPEKPSGVKHYVDLITYVKDRPGHDLRYA 300

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI +E+GW P+E+ +SG+ KTV WYL N  WW 
Sbjct: 301 IDASKITAELGWKPEESFDSGIRKTVQWYLQNESWWE 337


>gi|271499222|ref|YP_003332247.1| dTDP-glucose 4,6-dehydratase [Dickeya dadantii Ech586]
 gi|270342777|gb|ACZ75542.1| dTDP-glucose 4,6-dehydratase [Dickeya dadantii Ech586]
          Length = 355

 Score =  405 bits (1040), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 188/337 (55%), Positives = 247/337 (73%), Gaps = 6/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ +    V+ +DKLTYAGNL SL ++S    + F  +DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIIKNTADSVINVDKLTYAGNLESLADVSSHGRYEFKHIDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   ++S  +  QPDA+++ AAESHVDRSI G   FI TNI+GT+ LLE  R++WS L  
Sbjct: 61  DAVALKSVFETCQPDAVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARVYWSNLEP 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K  FRF  ISTDEVYG L+    LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 TQKSAFRFHHISTDEVYGDLEGTDSLFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYGPYHFPEKLIPL I   +EG  + +YGDG  +RDWL+VEDH RALY V+ 
Sbjct: 181 TIVTNCSNNYGPYHFPEKLIPLMILNALEGKALPVYGDGMQIRDWLFVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY----SHTELIRFIEDRPGHDRRY 294
           +G++GE YNIGG+NE+ N+D+V  I  LL+ L+P+      ++ +LI +++DRPGHD RY
Sbjct: 241 EGQVGETYNIGGHNEKANVDVVKTICTLLEELVPQKPAGIDAYQDLITYVKDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           AID+ KI  E+GW PQE  ESG+ KTV WYL+N  WW
Sbjct: 301 AIDAGKIGRELGWKPQETFESGIRKTVEWYLNNRSWW 337


>gi|330012105|ref|ZP_08307271.1| dTDP-glucose 4,6-dehydratase [Klebsiella sp. MS 92-3]
 gi|328533965|gb|EGF60620.1| dTDP-glucose 4,6-dehydratase [Klebsiella sp. MS 92-3]
          Length = 357

 Score =  405 bits (1040), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 195/336 (58%), Positives = 239/336 (71%), Gaps = 6/336 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIGSA+ R ++     +V+V+DKLTYAGNL SL  ++Q   F+F QVDICDR
Sbjct: 6   ILVTGGAGFIGSAVVREIIQHTADRVVVVDKLTYAGNLMSLAPVAQDARFAFEQVDICDR 65

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             +    ++ QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R WW+ L+  +
Sbjct: 66  AELDRIFRQHQPDTVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARSWWNTLAMAQ 125

Query: 123 KDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           K  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P L
Sbjct: 126 KSAFRFHHISTDEVYGDLHGSDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPTL 185

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           ++NCSNNYGPYHFPEKLIPL I     G  + +YG+GQ +RDWLYVEDH RALYLV  +G
Sbjct: 186 ITNCSNNYGPYHFPEKLIPLTILTARAGKPLPVYGNGQQIRDWLYVEDHARALYLVATRG 245

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALI---PKSYSH-TELIRFIEDRPGHDRRYAI 296
             GE YNIGG+NERKNI++V  I  LL+ L    P+  +H  +LI F+ DRPGHD RYAI
Sbjct: 246 EPGETYNIGGHNERKNIEVVETICQLLEELAPDKPQGVAHYRDLIAFVADRPGHDLRYAI 305

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           D+SKI  E+GW P E   SG+ KTV WYL N  WWR
Sbjct: 306 DASKIARELGWTPAETFTSGMRKTVAWYLANEAWWR 341


>gi|307130154|ref|YP_003882170.1| dTDP-glucose 4,6-dehydratase [Dickeya dadantii 3937]
 gi|306527683|gb|ADM97613.1| dTDP-glucose 4,6-dehydratase [Dickeya dadantii 3937]
          Length = 354

 Score =  405 bits (1040), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 196/338 (57%), Positives = 241/338 (71%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M ++VTGGAGFIGSA+ R+++   + +V+V+D LTYAGNL SLKE++    F F +V+IC
Sbjct: 1   MNILVTGGAGFIGSAVVRHIIQHTQDRVMVVDCLTYAGNLASLKEVASDPRFLFEKVNIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +      FQPDA+++ AAESHVDRSI G   FI TNI GT+ LLE  R +WS L +
Sbjct: 61  DRAGLDRVFATFQPDAVMHLAAESHVDRSIDGPSAFIETNITGTYTLLEAARQYWSALPE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
             +  FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KA+SD+LV AW  TYG+P
Sbjct: 121 ASRAAFRFHHISTDEVYGDLHGTDDLFTETTPYAPSSPYSASKAASDHLVRAWLRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            L++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH RALY V+ 
Sbjct: 181 TLVTNCSNNYGPYHFPEKLIPLMILNALEGKPLPVYGQGNQIRDWLYVEDHARALYTVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
            G +GE YNIGG+NERKNI++V  I  LLD L P+  +    + ELI  + DRPGHD RY
Sbjct: 241 TGEVGETYNIGGHNERKNIEVVKTICALLDELRPEKPAGIRHYDELITHVTDRPGHDLRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID+SKI  E+GW PQE  ESG+ KTV WYL N  WWR
Sbjct: 301 AIDASKIYRELGWKPQETFESGIRKTVEWYLANEAWWR 338


>gi|290477129|ref|YP_003470044.1| dTDP-glucose 4,6-dehydratase [Xenorhabdus bovienii SS-2004]
 gi|289176477|emb|CBJ83286.1| dTDP-glucose 4,6-dehydratase [Xenorhabdus bovienii SS-2004]
          Length = 356

 Score =  405 bits (1040), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 190/337 (56%), Positives = 246/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R+++TGGAGFIGSA+ R+++N  +  V+V+D LTYAGNL SL  +     ++F QVDIC 
Sbjct: 3   RILITGGAGFIGSAVVRHIINHTEDSVVVVDSLTYAGNLESLASVVDHPRYAFEQVDICQ 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R+ +    +++QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE +R +W  L Q+
Sbjct: 63  RDALDRVFQQYQPDAVMHLAAESHVDRSIDGPAAFIETNIMGTYVLLEASRAFWQQLDQE 122

Query: 122 KKDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           K+  FRF  ISTDEVYG L  D+G F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KQAAFRFHHISTDEVYGDLHGDEGFFTETTPYAPSSPYSASKASSDHLVRAWRRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I   + G  + +YG G+ +RDWLYVEDH RAL+LV   
Sbjct: 183 VITNCSNNYGPYHFPEKLIPLIILNALAGKPLPVYGKGEQIRDWLYVEDHARALHLVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
              GE YNIGG+NER+NID+V  I  LL+ L P   +    + +LI  + DRPGHD RYA
Sbjct: 243 AEPGENYNIGGHNERRNIDVVETICELLEELRPVKPAGIVCYRDLITHVADRPGHDMRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID++KI+ E+GW PQE  ESG+ KTV WYL+N  WWR
Sbjct: 303 IDAAKIERELGWTPQETFESGIRKTVQWYLENENWWR 339


>gi|37528475|ref|NP_931820.1| dTDP-glucose 4,6-dehydratase [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36787913|emb|CAE17030.1| dTDP-glucose 4,6-dehydratase [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 356

 Score =  405 bits (1040), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 188/337 (55%), Positives = 250/337 (74%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R+++TGGAGFIGSA+ R+++N+ +  V+V+D LTYAGNL SL  ++ S  ++F QVDIC 
Sbjct: 3   RILITGGAGFIGSAVVRHIINNTEDSVVVVDSLTYAGNLASLAPVADSPRYAFEQVDICQ 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +    +++QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W  L+++
Sbjct: 63  RGALDRVFEQYQPDCVMHLAAESHVDRSIDGPTAFIETNIVGTYTLLEAARAFWQKLNEE 122

Query: 122 KKDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           K+  FRF  ISTDEVYG L  ++G F+E  PY PSSPYSA+KASSD+LV AW  TYG+PV
Sbjct: 123 KQAVFRFHHISTDEVYGDLHGEEGFFTETTPYAPSSPYSASKASSDHLVRAWHRTYGLPV 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I   + G  + +YG+G+ +RDWLYVEDH RALYLV+ +
Sbjct: 183 IITNCSNNYGPYHFPEKLIPLMILNALAGKSLPVYGEGKQIRDWLYVEDHARALYLVVTE 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
              G+ YNIGG+NERKNID+V  I  LL+   P+       + +LI ++ DRPGHD RYA
Sbjct: 243 AEPGKTYNIGGHNERKNIDVVCAICELLEEFCPEKPVGIAYYRDLITYVADRPGHDMRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID++K++ E+GW PQE  ESG+ KTV WYL+N  WWR
Sbjct: 303 IDAAKVERELGWRPQETFESGIRKTVQWYLENENWWR 339


>gi|296103688|ref|YP_003613834.1| dTDP-glucose 4,6-dehydratase [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295058147|gb|ADF62885.1| dTDP-glucose 4,6-dehydratase [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 362

 Score =  405 bits (1040), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 190/340 (55%), Positives = 244/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL+E+S S+ + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVIRHIINNTQDCVVNVDKLTYAGNLESLREVSDSDRYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D+  +       QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE +R +WS L +
Sbjct: 61  DKIAMEKIFAAHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLETSRAYWSALDE 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
             K  FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 RAKSTFRFHHISTDEVYGDLPHPDEHHSSSSLPLFTEKTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGP+HFPEKLIPL I   +E   + +YG G  +RDWLYVEDH 
Sbjct: 181 WIRTYGLPGIVTNCSNNYGPFHFPEKLIPLVILNALENKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY VL  G+ GE YNIGG NE+KNI++V  I  LLD ++PK+ S+ + I ++ DRPGH
Sbjct: 241 RALYAVLTTGKTGETYNIGGYNEKKNIEVVHTICDLLDEIVPKTTSYRDQITYVTDRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI +E+GW PQE  ESG+ KTV WYL+N  W
Sbjct: 301 DRRYAIDARKITAELGWKPQETFESGIRKTVEWYLNNQEW 340


>gi|153997082|ref|ZP_02022215.1| dTDP-D-glucose-4,6-dehydratase [Yersinia pestis CA88-4125]
 gi|162418754|ref|YP_001605113.1| dTDP-D-glucose-4,6-dehydratase [Yersinia pestis Angola]
 gi|165926287|ref|ZP_02222119.1| dTDP-glucose 4,6-dehydratase [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165939693|ref|ZP_02228236.1| dTDP-glucose 4,6-dehydratase [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|166009628|ref|ZP_02230526.1| dTDP-glucose 4,6-dehydratase [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166213636|ref|ZP_02239671.1| dTDP-glucose 4,6-dehydratase [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167402080|ref|ZP_02307559.1| dTDP-glucose 4,6-dehydratase [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167420831|ref|ZP_02312584.1| dTDP-glucose 4,6-dehydratase [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167425992|ref|ZP_02317745.1| dTDP-glucose 4,6-dehydratase [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|218930865|ref|YP_002348740.1| dTDP-D-glucose-4,6-dehydratase [Yersinia pestis CO92]
 gi|229837195|ref|ZP_04457360.1| dTDP-D-glucose-4,6-dehydratase [Yersinia pestis Pestoides A]
 gi|229839555|ref|ZP_04459714.1| dTDP-D-glucose-4,6-dehydratase [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229900118|ref|ZP_04515255.1| dTDP-D-glucose-4,6-dehydratase [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229900435|ref|ZP_04515564.1| dTDP-D-glucose-4,6-dehydratase [Yersinia pestis Nepal516]
 gi|270488791|ref|ZP_06205865.1| dTDP-glucose 4,6-dehydratase [Yersinia pestis KIM D27]
 gi|294505525|ref|YP_003569587.1| dTDP-D-glucose-4,6-dehydratase [Yersinia pestis Z176003]
 gi|115349476|emb|CAL22449.1| dTDP-D-glucose-4,6-dehydratase [Yersinia pestis CO92]
 gi|149289388|gb|EDM39466.1| dTDP-D-glucose-4,6-dehydratase [Yersinia pestis CA88-4125]
 gi|162351569|gb|ABX85517.1| dTDP-glucose 4,6-dehydratase [Yersinia pestis Angola]
 gi|165912383|gb|EDR31017.1| dTDP-glucose 4,6-dehydratase [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|165921811|gb|EDR39008.1| dTDP-glucose 4,6-dehydratase [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165991550|gb|EDR43851.1| dTDP-glucose 4,6-dehydratase [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166205309|gb|EDR49789.1| dTDP-glucose 4,6-dehydratase [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166960960|gb|EDR56981.1| dTDP-glucose 4,6-dehydratase [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167048554|gb|EDR59962.1| dTDP-glucose 4,6-dehydratase [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167055140|gb|EDR64939.1| dTDP-glucose 4,6-dehydratase [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|229682454|gb|EEO78541.1| dTDP-D-glucose-4,6-dehydratase [Yersinia pestis Nepal516]
 gi|229686898|gb|EEO78977.1| dTDP-D-glucose-4,6-dehydratase [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229695921|gb|EEO85968.1| dTDP-D-glucose-4,6-dehydratase [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229706138|gb|EEO92147.1| dTDP-D-glucose-4,6-dehydratase [Yersinia pestis Pestoides A]
 gi|262363591|gb|ACY60312.1| dTDP-D-glucose-4,6-dehydratase [Yersinia pestis D106004]
 gi|262367519|gb|ACY64076.1| dTDP-D-glucose-4,6-dehydratase [Yersinia pestis D182038]
 gi|270337295|gb|EFA48072.1| dTDP-glucose 4,6-dehydratase [Yersinia pestis KIM D27]
 gi|294355984|gb|ADE66325.1| dTDP-D-glucose-4,6-dehydratase [Yersinia pestis Z176003]
 gi|320013537|gb|ADV97108.1| dTDP-D-glucose-4,6-dehydratase [Yersinia pestis biovar Medievalis
           str. Harbin 35]
          Length = 355

 Score =  405 bits (1040), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 192/337 (56%), Positives = 245/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R++VTGGAGFIGSA+ R++++     V+V+DKLTYAGNL SL  ++ S  ++F QVDICD
Sbjct: 3   RILVTGGAGFIGSAVVRHIIDGTSDSVVVVDKLTYAGNLESLSVVAGSERYAFEQVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
              +     ++QP+ +++ AAESHVDRSI G   FI TN++GT+ LLE  R +W  LS +
Sbjct: 63  SSELDRVFAQYQPNVVMHLAAESHVDRSIDGPAAFIETNVVGTYTLLEAARHYWQQLSVE 122

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            K  FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 AKQAFRFHHISTDEVYGDLHGTDDLFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+G  VRDWLYVEDH RALY V+ +
Sbjct: 183 LVTNCSNNYGPYHFPEKLIPLVILNALAGKPLPVYGNGAQVRDWLYVEDHARALYQVVTE 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NERKNI++V  I  LLD L+P   +    + +LI +++DRPGHD RYA
Sbjct: 243 GVVGETYNIGGHNERKNIEVVETICALLDELVPAKPAGIAHYRDLITYVKDRPGHDMRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+ KI+ E+GW PQE  ESG+ KTV WYL+N  WWR
Sbjct: 303 IDAGKIERELGWRPQETFESGIRKTVLWYLNNESWWR 339


>gi|91794014|ref|YP_563665.1| dTDP-glucose 4,6 dehydratase [Shewanella denitrificans OS217]
 gi|91716016|gb|ABE55942.1| dTDP-glucose 4,6-dehydratase [Shewanella denitrificans OS217]
          Length = 362

 Score =  405 bits (1040), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 192/346 (55%), Positives = 243/346 (70%), Gaps = 16/346 (4%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGS++ RY++N+ K  V+ +DKLTYAGNL SL  I     + F QVDIC
Sbjct: 1   MKILVTGGAGFIGSSVVRYIINNTKDTVINLDKLTYAGNLESLVSIENDERYIFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +   +    KE QPDA+++ AAESHVDRSI G  +FI TNI+GT+ LLE  R +W+ L+ 
Sbjct: 61  NLVDLVRVFKEHQPDAVMHLAAESHVDRSITGPSDFIQTNIVGTYTLLEAARAYWNTLAD 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------------LFSEDMPYNPSSPYSATKASS 164
           D K  FRF  ISTDEVYG L                   LF+E   Y PSSPYSA+KASS
Sbjct: 121 DAKKAFRFHHISTDEVYGDLPHPDDIEDSIESSPNKKLPLFTETTSYEPSSPYSASKASS 180

Query: 165 DYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWL 224
           D+LV AW  TYG+P L++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWL
Sbjct: 181 DHLVRAWHRTYGLPTLVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPIYGKGDQIRDWL 240

Query: 225 YVEDHVRALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFI 284
           YVEDH RALY V+ +G++GE YNIGG+NE++NI++V  I  +LD L+PKS  + E I F+
Sbjct: 241 YVEDHARALYKVVTEGKVGETYNIGGHNEKQNIEVVNTICSILDTLVPKSTPYAEQITFV 300

Query: 285 EDRPGHDRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
            DRPGHDRRYAID++KI  E+ W P+E  E+GL KT+ WYL N  W
Sbjct: 301 ADRPGHDRRYAIDATKIHKELNWLPEETFETGLRKTIEWYLANQNW 346


>gi|157161536|ref|YP_001458854.1| dTDP-glucose 4,6-dehydratase [Escherichia coli HS]
 gi|300946363|ref|ZP_07160641.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 116-1]
 gi|157067216|gb|ABV06471.1| dTDP-glucose 4,6-dehydratase [Escherichia coli HS]
 gi|300453955|gb|EFK17575.1| dTDP-glucose 4,6-dehydratase [Escherichia coli MS 116-1]
          Length = 354

 Score =  404 bits (1039), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 191/338 (56%), Positives = 247/338 (73%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ + + +V V+D LTYAGNL SL  ++ S  +SF Q DI 
Sbjct: 1   MKILVTGGAGFIGSAVVRHIIENTRDEVRVMDCLTYAGNLESLAPVAGSERYSFSQTDIT 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   + +   EF+PD +++ AAESHVDRSI G   FI TN+IGTF LLE  R +WS L  
Sbjct: 61  DAAAVAAQFSEFRPDIVMHLAAESHVDRSIDGPAAFIQTNVIGTFTLLEAARHYWSGLGD 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K  FRF  ISTDEVYG L     LF+E+ PY PSSPYSA+KA SD+LV AW  TYG+P
Sbjct: 121 AQKQAFRFHHISTDEVYGDLHGTDDLFTEETPYAPSSPYSASKAGSDHLVRAWNRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+++NCSNNYGPYHFPEKLIPL I   + G  + +YG+G+ +RDWLYVEDH RALY V  
Sbjct: 181 VVVTNCSNNYGPYHFPEKLIPLTILNALAGKPLPVYGNGEQIRDWLYVEDHARALYKVAT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALI---PKSYSH-TELIRFIEDRPGHDRRY 294
           +G+ GE YNIGG+NERKNID+V  I  +LD ++   P + +H  +LI F+ DRPGHD RY
Sbjct: 241 EGKSGETYNIGGHNERKNIDVVRTICAILDKVVAQKPGNIAHFADLITFVTDRPGHDLRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID++KI+ ++GW PQE  ESG+ KTV WYL+N  WW+
Sbjct: 301 AIDAAKIQRDLGWVPQETFESGIEKTVHWYLNNQTWWQ 338


>gi|297520837|ref|ZP_06939223.1| dTDP-glucose 4,6-dehydratase [Escherichia coli OP50]
          Length = 327

 Score =  404 bits (1039), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 191/325 (58%), Positives = 238/325 (73%), Gaps = 6/325 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS  F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNALTED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V   
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKSLPVYGNGQQIRDWLYVEDHARALYCVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+D+V  I  LL+ L P        +++LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLDVVETICELLEELAPNKPHGVVHYSDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKT 320
           ID+SKI  E+GW PQE  ESG+ KT
Sbjct: 303 IDASKIARELGWLPQETFESGMRKT 327


>gi|330954840|gb|EGH55100.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae Cit 7]
          Length = 360

 Score =  404 bits (1039), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 196/338 (57%), Positives = 249/338 (73%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSAL R+L+N+ + +VL  DKLTYAGNL SL+ I+    + F+Q DIC
Sbjct: 1   MRILVTGGAGFIGSALIRHLINNTEHEVLNFDKLTYAGNLESLQSIATDTRYEFVQADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D+  + + L+ F P AI++ AAESHVDRSI G  EFI TNI+GT+ LLE TR WW  L +
Sbjct: 61  DQARVSAVLERFAPQAIMHLAAESHVDRSIDGPAEFIQTNIVGTYSLLEATRAWWLKLPE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            ++  FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KA+SD+LV AW  TYG+P
Sbjct: 121 AQRQAFRFHHISTDEVYGDLHGVDDLFTETTPYAPSSPYSASKAASDHLVRAWHRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+++NCSNNYGP+HFPEKLIPL I   + G  + +YG+G  VRDWLYVEDH RAL  V+ 
Sbjct: 181 VVVTNCSNNYGPFHFPEKLIPLVILNALAGKPLPVYGNGLQVRDWLYVEDHARALLKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G +GE YNIGG+NE+KNID+V  I  LLD L P+  +    +++LI ++ DRPGHD+RY
Sbjct: 241 EGEVGETYNIGGHNEQKNIDVVRGICALLDELAPQHPAGVAQYSDLITYVVDRPGHDQRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID+SKI  E+ W P+E  ESGL KTV WYL+N  W R
Sbjct: 301 AIDASKIDKELDWTPEETFESGLRKTVQWYLNNLDWCR 338


>gi|146312297|ref|YP_001177371.1| dTDP-glucose 4,6-dehydratase [Enterobacter sp. 638]
 gi|145319173|gb|ABP61320.1| dTDP-glucose 4,6-dehydratase [Enterobacter sp. 638]
          Length = 360

 Score =  404 bits (1039), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 190/340 (55%), Positives = 245/340 (72%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSAL RY++N+    V+ +DKLTYAGNL SL EI +S+ ++F+Q DIC
Sbjct: 1   MKILVTGGAGFIGSALIRYIINETTDSVINVDKLTYAGNLQSLGEIDKSDRYTFVQADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D + +       QPD++++ AAESHVDRSI G   FI TNI+GT++LLE  R +W  L  
Sbjct: 61  DAQTLERIFDTHQPDSVMHLAAESHVDRSISGPAAFIETNIVGTYVLLEAARKYWLGLQA 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           +KK+ FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 EKKENFRFHHISTDEVYGDLPHPDECEDDASLPLFTEKTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TY +PV+++NCSNNYGPYHFPEKLIPL I   ++G  + +YG G  +RDWLYVEDH 
Sbjct: 181 WHRTYHLPVIVTNCSNNYGPYHFPEKLIPLVILNALQGKPLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+  G++GE YNIGG NE+KNI++V  I  +LD + P++  + +LI F+ DRPGH
Sbjct: 241 RALYAVVNNGKVGETYNIGGYNEKKNIEVVQTICQILDEIKPQATPYDKLITFVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW P+E  ESG+ KTV WYL+N  W
Sbjct: 301 DRRYAIDAGKITRELGWKPEETFESGIKKTVTWYLNNLEW 340


>gi|330966029|gb|EGH66289.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. actinidiae
           str. M302091]
          Length = 360

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 197/338 (58%), Positives = 248/338 (73%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSAL R+L+N+ K  VL  DKLTYAGNL SL+ I+    + F+Q DIC
Sbjct: 1   MRILVTGGAGFIGSALIRHLINNTKHDVLNFDKLTYAGNLESLQSIASKTRYEFVQADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D+  + + L+ F P AI++ AAESHVDRSI G  EF+ TNI+GT+ LLE TR +W  L  
Sbjct: 61  DQAKVSAVLERFAPQAIMHLAAESHVDRSIDGPAEFVQTNIVGTYSLLEATRAYWLKLPD 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            ++  FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KA+SD+LV AW  TYG+P
Sbjct: 121 VERQAFRFHHISTDEVYGDLHGVDDLFTETTPYAPSSPYSASKAASDHLVRAWHRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+++NCSNNYGP+HFPEKLIPL I   + G  + +YG+G  VRDWLYVEDH RAL  V+ 
Sbjct: 181 VVVTNCSNNYGPFHFPEKLIPLVILNALAGKPLPVYGNGLQVRDWLYVEDHARALLKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRY 294
           +G +GE YNIGG+NE+KNID+V  I  LLD L P+       +++LI ++ DRPGHD+RY
Sbjct: 241 EGDVGETYNIGGHNEQKNIDVVRGICSLLDELAPQHPDGVQHYSDLITYVVDRPGHDQRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID+SKI +E+GW P+E  ESGL KTV WYLDN  W R
Sbjct: 301 AIDASKIDNELGWTPEETFESGLRKTVQWYLDNLDWCR 338


>gi|119475334|ref|ZP_01615687.1| dTDP-glucose 4,6-dehydratase [marine gamma proteobacterium
           HTCC2143]
 gi|119451537|gb|EAW32770.1| dTDP-glucose 4,6-dehydratase [marine gamma proteobacterium
           HTCC2143]
          Length = 365

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 194/345 (56%), Positives = 251/345 (72%), Gaps = 11/345 (3%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ +    V+ +DKLTYAGNL+SL  I  S+ +SF + DIC
Sbjct: 5   MKILVTGGAGFIGSAVVRHIIENTHDSVINVDKLTYAGNLSSLVSIDTSDRYSFYRADIC 64

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +R  + +     +PDA+++ AAESHVDRSI G  +FI TN++GTFILLE  R +W  L  
Sbjct: 65  NRGALEAIFDAEEPDAVMHLAAESHVDRSIDGPSDFIQTNMVGTFILLEVARTYWQSLGD 124

Query: 121 DKKDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           ++K  FRF  ISTDEVYG L  D  LF E  PY PSSPYSA+KA SD+LV AW  TYG+P
Sbjct: 125 ERKQGFRFHHISTDEVYGDLEGDDDLFLETTPYAPSSPYSASKAGSDHLVRAWCRTYGLP 184

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           VLL+NCSNNYGP+HFPEKLIP  I   ++G  + +YGDGQ +RDWLYVEDH RALY V+ 
Sbjct: 185 VLLTNCSNNYGPFHFPEKLIPHIILNALDGKALPIYGDGQQIRDWLYVEDHARALYKVVT 244

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIP-KSYSHTE--------LIRFIEDRPG 289
           +G IGE YNIGG+NE+KNID+V  I  +L+ L P  SYS           LI +++DRPG
Sbjct: 245 EGAIGETYNIGGHNEKKNIDVVKVICKILENLAPDNSYSRASGNTGGFEALITYVKDRPG 304

Query: 290 HDRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           HDRRYAID+ KI+ ++GW P+E  E+G+ KTV WYL+N+ WWR +
Sbjct: 305 HDRRYAIDAKKIERDLGWVPEETFETGMKKTVQWYLNNHPWWRAV 349


>gi|261379147|ref|ZP_05983720.1| dTDP-glucose 4,6-dehydratase [Neisseria cinerea ATCC 14685]
 gi|269144372|gb|EEZ70790.1| dTDP-glucose 4,6-dehydratase [Neisseria cinerea ATCC 14685]
          Length = 360

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 190/336 (56%), Positives = 249/336 (74%), Gaps = 6/336 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL +I+ +  ++F QVDICDR
Sbjct: 9   ILVTGGAGFIGSAVVRHIIQNTQDSVVNLDKLTYAGNLESLTDIANNPRYAFEQVDICDR 68

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             +     + QPDA+++ AAESHVDRSI  A EFI TNI+GTF LLE  R +W  +  +K
Sbjct: 69  AELNRVFAQHQPDAVMHLAAESHVDRSIDSAGEFIQTNIVGTFNLLEAARAYWQQMPSEK 128

Query: 123 KDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           ++ FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P +
Sbjct: 129 RETFRFHHISTDEVYGDLHGTDDLFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPTI 188

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           +SNCSNNYGPYHFPEKLIPL I   ++G  + +YGDG  +RDWL+VEDH RALY V+ +G
Sbjct: 189 VSNCSNNYGPYHFPEKLIPLMILNALDGKPLPVYGDGMQIRDWLFVEDHARALYQVVTEG 248

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYAI 296
            +GE YNIGG+NE+ NI++V  I  LL+ L+P+  +    + +LI F++DRPGHD RYAI
Sbjct: 249 VVGETYNIGGHNEKANIEVVKTICALLEELVPEKPAGVARYEDLITFVQDRPGHDVRYAI 308

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           D++KI  E+GW PQE  ESG+ KTV WYL+N  WW+
Sbjct: 309 DAAKIGRELGWKPQETFESGIRKTVQWYLNNKTWWQ 344


>gi|94499405|ref|ZP_01305942.1| dTDP-glucose 4,6-dehydratase [Oceanobacter sp. RED65]
 gi|94428159|gb|EAT13132.1| dTDP-glucose 4,6-dehydratase [Oceanobacter sp. RED65]
          Length = 361

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 196/340 (57%), Positives = 249/340 (73%), Gaps = 11/340 (3%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           +++VTGGAGFIGSA+ R+++ND    V+ +DKLTYAGNL SL EI+ S  ++F QVDICD
Sbjct: 4   KILVTGGAGFIGSAVVRHILNDTHDSVVNLDKLTYAGNLESLNEIAGSERYAFEQVDICD 63

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E +PDAI++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L + 
Sbjct: 64  RPALERVFAEHKPDAIMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEVARAYWNGLPEK 123

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           +K+ FRF  ISTDEVYG L+  + LF+E+  Y PSSPYSA+KASSD+LV AW  TYG P 
Sbjct: 124 QKNSFRFHHISTDEVYGDLENPEDLFTEETAYAPSSPYSASKASSDHLVRAWKRTYGFPT 183

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  VRDWLYVEDH RALY V+ +
Sbjct: 184 IITNCSNNYGPYHFPEKLIPLVILNALEGKELPIYGKGDQVRDWLYVEDHARALYKVVTE 243

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPK-SYSH--------TELIRFIEDRPGH 290
           G+IGE YNIGG+NE++NI++V  I  LL+ L+P+ +YS           LI ++EDRPGH
Sbjct: 244 GQIGETYNIGGHNEKQNIEVVQTICELLEELVPENAYSRMGGNPSGFKGLIAYVEDRPGH 303

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           D RYAID+SKI+ E+GW P E  ESG+ KTV WYL N  W
Sbjct: 304 DLRYAIDASKIQKELGWTPLETFESGIRKTVEWYLSNKEW 343


>gi|28896996|ref|NP_796601.1| dTDP-glucose 4,6 dehydratase [Vibrio parahaemolyticus RIMD 2210633]
 gi|260897625|ref|ZP_05906121.1| dTDP-glucose 4,6-dehydratase [Vibrio parahaemolyticus Peru-466]
 gi|28805204|dbj|BAC58485.1| dTDP-D-glucose 4,6-dehydratase [Vibrio parahaemolyticus RIMD
           2210633]
 gi|308087483|gb|EFO37178.1| dTDP-glucose 4,6-dehydratase [Vibrio parahaemolyticus Peru-466]
          Length = 362

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 188/342 (54%), Positives = 247/342 (72%), Gaps = 10/342 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSAL R+++ +    V+ +D LTYAGNL SL  + QS  + F QV+IC
Sbjct: 1   MKILVTGGAGFIGSALVRHIIKNTSDSVVNVDCLTYAGNLESLGSVIQSERYVFEQVNIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +    +  +PDA+++ AAESHVDRSI G   FI TN++GT+ +LE TR +WS L  
Sbjct: 61  DRAELNRVFEAHKPDAVMHLAAESHVDRSITGPAAFIETNVVGTYTMLEATREYWSKLDD 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           + K  FRF  ISTDEVYG L          +  +F E  PY PSSPYSA+KASSD+LV A
Sbjct: 121 NAKAAFRFHHISTDEVYGDLPHPDEVSDGKELPMFLETTPYEPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWL+VEDH 
Sbjct: 181 WLRTYGLPTMVTNCSNNYGPYHFPEKLIPLVILNALEGKDLPIYGKGDQIRDWLFVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G++GE YNIGG+NE+KNI++V  I  +LD L+PK  +++E I +++DRPGH
Sbjct: 241 RALYKVITEGKVGETYNIGGHNEKKNIEVVNTICEILDTLVPKQTAYSEQITYVQDRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           DRRYAIDSSK++ E+ W P+E  E+GL KTV WYLDN  W +
Sbjct: 301 DRRYAIDSSKMQRELNWTPEETFETGLRKTVQWYLDNPTWCK 342


>gi|153839165|ref|ZP_01991832.1| dTDP-glucose 4,6-dehydratase [Vibrio parahaemolyticus AQ3810]
 gi|149747337|gb|EDM58315.1| dTDP-glucose 4,6-dehydratase [Vibrio parahaemolyticus AQ3810]
          Length = 362

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 188/342 (54%), Positives = 247/342 (72%), Gaps = 10/342 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSAL R+++ +    V+ +D LTYAGNL SL  + QS  + F QV+IC
Sbjct: 1   MKILVTGGAGFIGSALVRHIIKNTSDSVVNVDCLTYAGNLESLGSVIQSERYVFEQVNIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +    +  +PDA+++ AAESHVDRSI G   FI TN++GT+ +LE TR +WS L  
Sbjct: 61  DRAELNRVFETHKPDAVMHLAAESHVDRSITGPAAFIETNVVGTYTMLEATREYWSKLDD 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           + K  FRF  ISTDEVYG L          +  +F E  PY PSSPYSA+KASSD+LV A
Sbjct: 121 NAKAAFRFHHISTDEVYGDLPHPDEVSDGKELPMFLETTPYEPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWL+VEDH 
Sbjct: 181 WLRTYGLPTMVTNCSNNYGPYHFPEKLIPLVILNALEGKDLPIYGKGDQIRDWLFVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G++GE YNIGG+NE+KNI++V  I  +LD L+PK  +++E I +++DRPGH
Sbjct: 241 RALYKVITEGKVGETYNIGGHNEKKNIEVVNTICEILDTLVPKQTAYSEQITYVQDRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           DRRYAIDSSK++ E+ W P+E  E+GL KTV WYLDN  W +
Sbjct: 301 DRRYAIDSSKMQRELNWTPEETFETGLRKTVQWYLDNPTWCK 342


>gi|254506456|ref|ZP_05118598.1| dTDP-glucose 4,6-dehydratase [Vibrio parahaemolyticus 16]
 gi|219550630|gb|EED27613.1| dTDP-glucose 4,6-dehydratase [Vibrio parahaemolyticus 16]
          Length = 352

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 195/337 (57%), Positives = 245/337 (72%), Gaps = 6/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL E+  S  + F  VDIC
Sbjct: 1   MKILVTGGAGFIGSAVIRHIINETQDSVVNLDKLTYAGNLESLHEVESSARYQFECVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     E QPD +++ AAESHVDRSI G   FI TNIIGT+ LLE  R +W  L  
Sbjct: 61  DRSRLERVFDEHQPDIVMHLAAESHVDRSIDGPAAFIETNIIGTYTLLETARRYWQSLPL 120

Query: 121 DKKDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           +KK  FRF  ISTDEVYG L   + LF+E  PY PSSPYSA+KASSD+LV AW  T+G P
Sbjct: 121 EKKRGFRFHHISTDEVYGDLVDAESLFTELTPYAPSSPYSASKASSDHLVRAWLRTFGFP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            L++NCSNNYGPYHFPEKLIPL I   +EG  + +YGDG+ +RDWLYVEDH RALY+V  
Sbjct: 181 TLVTNCSNNYGPYHFPEKLIPLMILNALEGKALPVYGDGKQIRDWLYVEDHARALYMVAT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY----SHTELIRFIEDRPGHDRRY 294
           KG +GE YNIGG+NE  N+++V +I  L++ L P       +++ELI F+EDRPGHD RY
Sbjct: 241 KGEVGETYNIGGHNELTNLEVVHKICELMEELCPDKPKGVGAYSELIAFVEDRPGHDIRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           AID+SKI+ E+GW P+E  ESG+ KTV WYL N  WW
Sbjct: 301 AIDASKIERELGWKPEETFESGIRKTVRWYLSNRVWW 337


>gi|260899556|ref|ZP_05907951.1| dTDP-glucose 4,6-dehydratase [Vibrio parahaemolyticus AQ4037]
 gi|308108803|gb|EFO46343.1| dTDP-glucose 4,6-dehydratase [Vibrio parahaemolyticus AQ4037]
          Length = 371

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 188/342 (54%), Positives = 247/342 (72%), Gaps = 10/342 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSAL R+++ +    V+ +D LTYAGNL SL  + QS  + F QV+IC
Sbjct: 10  MKILVTGGAGFIGSALVRHIIKNTSDSVVNVDCLTYAGNLESLGSVIQSERYVFEQVNIC 69

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +    +  +PDA+++ AAESHVDRSI G   FI TN++GT+ +LE TR +WS L  
Sbjct: 70  DRAELNRVFEAHKPDAVMHLAAESHVDRSITGPAAFIETNVVGTYTMLEATREYWSKLDD 129

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           + K  FRF  ISTDEVYG L          +  +F E  PY PSSPYSA+KASSD+LV A
Sbjct: 130 NAKAAFRFHHISTDEVYGDLPHPDEVSDGKELPMFLETTPYEPSSPYSASKASSDHLVRA 189

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWL+VEDH 
Sbjct: 190 WLRTYGLPTMVTNCSNNYGPYHFPEKLIPLVILNALEGKDLPIYGKGDQIRDWLFVEDHA 249

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G++GE YNIGG+NE+KNI++V  I  +LD L+PK  +++E I +++DRPGH
Sbjct: 250 RALYKVITEGKVGETYNIGGHNEKKNIEVVNTICEILDTLVPKQTAYSEQITYVQDRPGH 309

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           DRRYAIDSSK++ E+ W P+E  E+GL KTV WYLDN  W +
Sbjct: 310 DRRYAIDSSKMQRELNWTPEETFETGLRKTVQWYLDNPTWCK 351


>gi|212550143|gb|ACJ26794.1| dTDP-D-glucose-4,6-dehydratase [Salmonella enterica subsp.
           diarizonae]
          Length = 356

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 189/342 (55%), Positives = 248/342 (72%), Gaps = 10/342 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++++TGGAGFIGSA+ R+++ + +  V+ IDKLTYAGNL SL E+S+++ + F   DIC
Sbjct: 1   MKILITGGAGFIGSAVVRHIIKNTQDTVVNIDKLTYAGNLESLAEVSENSRYYFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D+  +       +PDA+++ AAESHVDRSI G  +FI TNI+GT++LLE  R +W+ L+ 
Sbjct: 61  DKAAMEHIFAAHKPDAVMHLAAESHVDRSITGPADFIETNIVGTYVLLEAARGYWNELNA 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK  FRF  ISTDEVYG L             LF+E+  Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKLAFRFHHISTDEVYGDLPHPDEVQAGSTLPLFTENTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WLRTYGFPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGRGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ KG +GE YNIGG+NE+KN+D+V  I  LLD ++PK  S+ + + ++ DRPGH
Sbjct: 241 RALYTVVTKGVVGETYNIGGHNEKKNLDVVHTICDLLDEIVPKEGSYRDQLTYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           DRRYAID++KI  E+GW PQE  ESG+ KT+ WYL+N  W R
Sbjct: 301 DRRYAIDAAKISDELGWKPQETFESGIRKTIDWYLNNIEWCR 342


>gi|297380786|gb|ADI39336.1| dTDP-D-glucose 4,6-dehydratase [Salmonella enterica]
          Length = 357

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 190/340 (55%), Positives = 246/340 (72%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++++TGGAGFIGSA+ R+++ + +  V+ IDKLTYAGNL SL +IS+SN ++F   DIC
Sbjct: 1   MKILITGGAGFIGSAVVRHIIKNTQDTVVNIDKLTYAGNLESLSDISESNRYNFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D+  +       +PDA+++ AAESHVDRSI G  +FI TNI+GT++LLE  R +W+ L+ 
Sbjct: 61  DKAAMEHIFAAHKPDAVMHLAAESHVDRSITGPADFIETNIVGTYVLLEAARGYWNELNA 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK  FRF  ISTDEVYG L             LF+E+  Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKLAFRFHHISTDEVYGDLPHPDEVQAGSTLPLFTENTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WLRTYGFPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGRGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ KG +GE YNIGG+NE+KN+D+V  I  LLD ++PK  S+ + + ++ DRPGH
Sbjct: 241 RALYTVVTKGVVGETYNIGGHNEKKNLDVVHTICDLLDEIVPKEGSYRDQLTYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW P E  ESG+ KTV WYL+N  W
Sbjct: 301 DRRYAIDADKISRELGWKPLETFESGIRKTVEWYLNNRAW 340


>gi|66048159|ref|YP_238000.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. syringae
           B728a]
 gi|63258866|gb|AAY39962.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. syringae
           B728a]
          Length = 360

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 196/338 (57%), Positives = 247/338 (73%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSAL R+L+N+   +VL  DKLTYAGNL SL+ I+    + F+Q DIC
Sbjct: 1   MRILVTGGAGFIGSALIRHLINNTDHEVLNFDKLTYAGNLESLQSIATDTRYEFVQADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D+  + + L+ F P AI++ AAESHVDRSI G  EFI TNI+GT+ LLE TR WW  L +
Sbjct: 61  DQARVSAVLERFAPQAIMHLAAESHVDRSIDGPAEFIQTNIVGTYSLLEATRAWWLKLPE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            ++  FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KA+SD+LV AW  TYG+P
Sbjct: 121 AQRQAFRFHHISTDEVYGDLHGVDDLFTETTPYAPSSPYSASKAASDHLVRAWHRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+++NCSNNYGP+HFPEKLIPL I   + G  + +YG+G  VRDWLYVEDH RAL  V+ 
Sbjct: 181 VVVTNCSNNYGPFHFPEKLIPLVILNALAGKPLPVYGNGLQVRDWLYVEDHARALLKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G +GE YNIGG+NE+KNID+V  I  LLD L P+  +    +++LI ++ DRPGHD+RY
Sbjct: 241 EGEVGETYNIGGHNEQKNIDVVRGICALLDELAPQHPAGVAQYSDLITYVVDRPGHDQRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID+ KI  E+ W P+E  ESGL KTV WYLDN  W R
Sbjct: 301 AIDAGKIDKELDWTPEETFESGLRKTVQWYLDNLDWCR 338


>gi|260162545|dbj|BAI43787.1| dTDP-D-glucose 4,6-dehydratase [Klebsiella pneumoniae]
          Length = 354

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 190/338 (56%), Positives = 248/338 (73%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ + + +V V+D LTYAGNL SL  ++ S  +SF Q DI 
Sbjct: 1   MKILVTGGAGFIGSAVVRHIIENTRDEVRVLDCLTYAGNLESLAPVAGSERYSFSQTDIT 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   + +   EF+PD +++ AAESHVDRSI G   FI TN+IGTF LLE  R +WS L +
Sbjct: 61  DAAAVAAQFSEFRPDIVMHLAAESHVDRSIDGPAAFIQTNVIGTFTLLEAARHYWSGLGE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K  FRF  ISTDEVYG L     LF+E+ PY PSSPYSA+KA SD+LV AW  TYG+P
Sbjct: 121 AQKQAFRFHHISTDEVYGDLHGTDDLFTEETPYAPSSPYSASKAGSDHLVRAWNRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+++NCSNNYGPYHFPEKLIPL I   + G  + +YG+G+ +RDWLYVEDH RALY V  
Sbjct: 181 VVVTNCSNNYGPYHFPEKLIPLTILNALAGKPLPVYGNGEQIRDWLYVEDHARALYKVAT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALI---PKSYSH-TELIRFIEDRPGHDRRY 294
           +G+ GE YNIGG+NERKNID+V  I  +LD ++   P + +H  +LI F+ DRPGHD RY
Sbjct: 241 EGKSGETYNIGGHNERKNIDVVRTICAILDKVVAQKPGNITHFADLITFVTDRPGHDLRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AI+++KI+ ++GW PQE  ESG+ KTV WYL+N  WW+
Sbjct: 301 AINAAKIQRDLGWVPQETFESGIEKTVHWYLNNQTWWQ 338


>gi|312172861|emb|CBX81117.1| dTDP-glucose 4,6-dehydratase [Erwinia amylovora ATCC BAA-2158]
          Length = 383

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 192/338 (56%), Positives = 248/338 (73%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+    VL IDKLTYAGNL SL+EIS +  + F + DIC
Sbjct: 26  MKILVTGGAGFIGSAVIRHIINNTDDTVLNIDKLTYAGNLESLQEISDNPRYHFSKTDIC 85

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D E ++ A  +F+PD +++ AAESHVDRSI G   FI TNIIGT++LLE  R++W  L  
Sbjct: 86  DSESLKRAFNDFEPDVVMHLAAESHVDRSIDGPAAFIETNIIGTYVLLEAARMYWLGLPV 145

Query: 121 DKKDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           ++K+ FRF  ISTDEV+G L   + LF+E   Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 146 ERKEAFRFHHISTDEVFGDLHGTEDLFTEQTAYAPSSPYSASKASSDHLVRAWQRTYGLP 205

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           VL++NCSNNYGPYHFPEKLIPL I   + G  + +YG+G+ VRDWLYVEDH RALY V  
Sbjct: 206 VLVTNCSNNYGPYHFPEKLIPLTILNALAGKPLPIYGNGKQVRDWLYVEDHARALYRVAT 265

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRY 294
            G +GE YNIGG+NER+NI++V  I  +L+ L+            LI F++DRPGHD RY
Sbjct: 266 TGVVGETYNIGGHNERQNIEVVNTICSILNRLVVDKPCGIADFATLITFVQDRPGHDLRY 325

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID++KI+ E+GW P+E  E+GL KTV WYL N  WW+
Sbjct: 326 AIDATKIEKELGWLPEETFETGLEKTVQWYLKNTEWWQ 363


>gi|59710773|ref|YP_203549.1| dTDP-glucose 4,6-dehydratase [Vibrio fischeri ES114]
 gi|59478874|gb|AAW84661.1| dTDP-glucose 4,6-dehydratase [Vibrio fischeri ES114]
          Length = 364

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 191/337 (56%), Positives = 246/337 (72%), Gaps = 6/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++     + F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVINLDKLTYAGNLESLSDVDSDERYVFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     E +PDA+++ AAESHVDRSI G   FI TNI+GT+ LLE TR +W+ LS 
Sbjct: 61  DGAELDRVFSEHKPDAVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEATRSYWNTLSD 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           DKK  FRF  ISTDEVYG L+    LF+E   Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 DKKQAFRFHHISTDEVYGDLEGTDDLFTETTSYEPSSPYSASKASSDHLVRAWLRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYGPYHFPEKLIPL I   ++G  + +YG+G  +RDWL+VEDH RALY V+ 
Sbjct: 181 TIVTNCSNNYGPYHFPEKLIPLMILNALDGKSLPIYGNGMQIRDWLFVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRY 294
           +G +GE YNIGG+NE+ NID+V  I  LL+ L+P        + +LI ++ DRPGHD RY
Sbjct: 241 EGVVGETYNIGGHNEKANIDVVKTICSLLEELVPNKPEGVAQYLDLITYVTDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           AID+SKI+ E+GW P+E  ESG+ KTV WYLDN  WW
Sbjct: 301 AIDASKIERELGWKPEETFESGIRKTVEWYLDNKQWW 337


>gi|296531722|ref|ZP_06894551.1| dTDP-glucose 4,6-dehydratase [Roseomonas cervicalis ATCC 49957]
 gi|296267954|gb|EFH13752.1| dTDP-glucose 4,6-dehydratase [Roseomonas cervicalis ATCC 49957]
          Length = 360

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 197/341 (57%), Positives = 252/341 (73%), Gaps = 3/341 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQ-VLVIDKLTYAGNLNSLKEISQSNLFSFLQVDI 59
           MR++VTGGAGFIGSAL R LV + +++ VLV+DKLTYAG   SL++      F FLQ DI
Sbjct: 1   MRILVTGGAGFIGSALVRRLVLEEQVEAVLVVDKLTYAGERRSLRDCEGRPGFGFLQADI 60

Query: 60  CDRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLS 119
            D   +  A  EF+PDA+++ AAESHVDRSI GA  FI TNI+GTF LLE  R +W+ L 
Sbjct: 61  ADAAAMAQAFAEFRPDAVMHLAAESHVDRSIAGAAPFIHTNIVGTFTLLEAARAYWNALD 120

Query: 120 QDKKDQFRFLQISTDEVYGSLD-KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K+  FRFL ISTDEV+GSL   G F+E  PY P SPYSA+KA SD+LV AW  TYG+P
Sbjct: 121 AEKRAAFRFLHISTDEVFGSLGPTGYFTETTPYAPRSPYSASKAGSDHLVAAWHETYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            L++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G+NVRDWL+V+DHVRAL  VL+
Sbjct: 181 TLMTNCSNNYGPYHFPEKLIPLTILNALEGKTLPVYGKGENVRDWLFVDDHVRALITVLR 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIP-KSYSHTELIRFIEDRPGHDRRYAID 297
           +G++G+ YN+GGN+ER+NI++V  I   LD L P  +     L+ F+ DRPGHD RYAID
Sbjct: 241 QGKVGQTYNVGGNSERQNIEVVHAICDTLDRLRPDPAGPRRRLVSFVADRPGHDARYAID 300

Query: 298 SSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKEL 338
           +SK+K E+GW P E+ E+GL KT+ WYL+N WWW+PL + +
Sbjct: 301 ASKLKRELGWEPSESFETGLEKTIAWYLENAWWWQPLRERV 341


>gi|237802170|ref|ZP_04590631.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. oryzae str.
           1_6]
 gi|331025027|gb|EGI05083.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. oryzae str.
           1_6]
          Length = 360

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 195/338 (57%), Positives = 249/338 (73%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSAL R+L+N+    VL  DKLTYAGNL SL+ I+    + F+Q DIC
Sbjct: 1   MRILVTGGAGFIGSALIRHLINNTAHDVLNFDKLTYAGNLESLQPIATDTRYEFVQADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D+  + + L+ F P AI++ AAESHVDRSI G  EF+ TNI+GT+ LLE TR +W  L +
Sbjct: 61  DQSRVSAVLERFAPQAIMHLAAESHVDRSIDGPAEFVQTNIVGTYSLLEATRAYWLKLPE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            ++  FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KA+SD+LV AW  TYG+P
Sbjct: 121 AERQAFRFHHISTDEVYGDLHGVDDLFTETTPYAPSSPYSASKAASDHLVRAWHRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+++NCSNNYGP+HFPEKLIPL I   + G  + +YG+G  VRDWLYVEDH RAL  V+ 
Sbjct: 181 VVVTNCSNNYGPFHFPEKLIPLVILNALAGKPLPVYGNGLQVRDWLYVEDHARALLKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRY 294
           +G++GE YNIGG+NE+KNID+V  I  LLD L P+       +++LI ++ DRPGHD+RY
Sbjct: 241 EGKVGETYNIGGHNEQKNIDVVRGICTLLDELAPQHPDGVQQYSDLITYVTDRPGHDQRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AI++SKI +E+GW P+E  ESGL KTV WYLDN  W R
Sbjct: 301 AINASKIDNELGWTPEETFESGLRKTVQWYLDNLDWCR 338


>gi|71734785|ref|YP_272459.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|71555338|gb|AAZ34549.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. phaseolicola
           1448A]
          Length = 360

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 196/338 (57%), Positives = 251/338 (74%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSAL R+L+N+ + +VL  DKLTYAGNL SL+ I+ +  + F+Q DIC
Sbjct: 1   MRILVTGGAGFIGSALIRHLINNTEHEVLNFDKLTYAGNLESLQSIATNTRYEFVQADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D+  + + L+ F P AI++ AAESHVDRSI G  EFI TNI+GT+ LLE TR +W  L +
Sbjct: 61  DQASVSAVLERFAPQAIMHLAAESHVDRSIDGPAEFIQTNIVGTYSLLEATRDYWLKLPE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            ++  FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KA+SD+LV AW  TYG+P
Sbjct: 121 AERQAFRFHHISTDEVYGDLHGVDDLFTETTPYAPSSPYSASKAASDHLVRAWHRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+++NCSNNYGP+HFPEKLIPL I   + G  + +YG+G  VRDWLYVEDH RAL  V+ 
Sbjct: 181 VVVTNCSNNYGPFHFPEKLIPLVILNALAGKPLPVYGNGLQVRDWLYVEDHARALLKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G++GE YNIGG+NE+KNID+V  I  LLD L P+  +    +  LI ++ DRPGHD+RY
Sbjct: 241 EGKVGETYNIGGHNEQKNIDVVRGICALLDELAPQHPAGIAQYNYLITYVVDRPGHDQRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID+SKI +++GW P+E  ESGL KTV WYLDN  W R
Sbjct: 301 AIDASKIDNDLGWTPEETFESGLRKTVQWYLDNLDWCR 338


>gi|261856085|ref|YP_003263368.1| dTDP-glucose 4,6-dehydratase [Halothiobacillus neapolitanus c2]
 gi|261836554|gb|ACX96321.1| dTDP-glucose 4,6-dehydratase [Halothiobacillus neapolitanus c2]
          Length = 355

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 193/336 (57%), Positives = 248/336 (73%), Gaps = 5/336 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           +L+VTGGAGFIGSA+ R+L+ +    V+ ID LTYAGNL S+  ++ S  + F Q DI +
Sbjct: 12  KLMVTGGAGFIGSAVVRHLIENTDHIVVNIDALTYAGNLESIAAVASSPRYHFEQADITN 71

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
            + + +   + QPD I++ AAESHVDRSI G   F+ TNIIGT+ LLE  R +WS LS  
Sbjct: 72  ADAMTALFNKHQPDGILHLAAESHVDRSIDGPSAFMQTNIIGTYTLLEAARAYWSDLSDA 131

Query: 122 KKDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           +K  FRF  ISTDEVYGSL + GLF+E+  Y P+SPYSA+KA+SD+LV AW HTYG+PV+
Sbjct: 132 RKTAFRFQHISTDEVYGSLGETGLFTEETAYQPNSPYSASKAASDHLVRAWHHTYGLPVI 191

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
            +NCSNNYGPYHFPEKLIPL I   IEG  + +YG G  +RDWLYVEDH RAL LV ++G
Sbjct: 192 TTNCSNNYGPYHFPEKLIPLVILNAIEGKPLPVYGKGNQIRDWLYVEDHARALVLVHEQG 251

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYAI 296
            IGE YNIGG+NE++NI++V  I  LL+ L P+      ++ +LI F++DRPGHD+RYAI
Sbjct: 252 AIGEVYNIGGHNEQRNIEVVQTICDLLEELKPEKPAGVAAYRDLITFVQDRPGHDQRYAI 311

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           D+SKI+ E+GW P E  ESGL KTV WYLDN+ WW+
Sbjct: 312 DASKIQRELGWTPMETFESGLKKTVQWYLDNSSWWQ 347


>gi|294669021|ref|ZP_06734107.1| dTDP-glucose 4,6-dehydratase [Neisseria elongata subsp. glycolytica
           ATCC 29315]
 gi|291309013|gb|EFE50256.1| dTDP-glucose 4,6-dehydratase [Neisseria elongata subsp. glycolytica
           ATCC 29315]
          Length = 354

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 190/338 (56%), Positives = 250/338 (73%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL ++S    ++F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIIQNTEDSVINLDKLTYAGNLESLTDVSDDPRYAFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     + +PDA+++ AAESHVDRSI  A EFI TNI+GTF LLE  R +W  +S 
Sbjct: 61  DRTELDRVFAQHRPDAVMHLAAESHVDRSIDSAGEFIQTNIVGTFNLLEAARAYWQQMSP 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           +K + FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 EKHEAFRFHHISTDEVYGDLHGTDDLFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYGPYHFPEKLIPL I   ++G  + +YGDG  +RDWL+VEDH RALY V+ 
Sbjct: 181 TIVTNCSNNYGPYHFPEKLIPLMILNALDGKPLPVYGDGMQIRDWLFVEDHARALYQVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G +GE YNIGG+NE+ NI++V  I  LL+ L+P+  +    + +LI F++DRPGHD RY
Sbjct: 241 EGVVGETYNIGGHNEKANIEVVKTICALLEELVPEKPAGVARYEDLITFVQDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AI+++KI  E+GW PQE  ESG+ KTV WYLDN  WW+
Sbjct: 301 AINAAKIGRELGWKPQETFESGIRKTVQWYLDNKTWWQ 338


>gi|56476269|ref|YP_157858.1| dTDP-glucose 4,6-dehydratase [Aromatoleum aromaticum EbN1]
 gi|56312312|emb|CAI06957.1| DTDP-glucose 4,6-dehydratase [Aromatoleum aromaticum EbN1]
          Length = 338

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 189/334 (56%), Positives = 245/334 (73%), Gaps = 7/334 (2%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R++VTGGAGFIGSA+ R+L +     V  +DKLTYAGNL SL  ++ S+ + F QVDIC+
Sbjct: 4   RILVTGGAGFIGSAVVRHLTDSTTHHVANLDKLTYAGNLESLNSVANSSRYQFYQVDICN 63

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
              +     EF+P A+++  AESHVDRSI G  EFI TN++GT+ LLE  R +W+ L+ D
Sbjct: 64  AAALDKVFAEFRPTAVMHLVAESHVDRSIDGPAEFIQTNMVGTYTLLEAARRYWNALADD 123

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            K  FRF  ISTDEVYG L+    LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 124 AKAAFRFHHISTDEVYGDLEGTDDLFTESTPYAPSSPYSASKASSDHLVRAWQRTYGLPT 183

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIP  I   + G  + +YGDG  +RDWLYVEDH RAL  V+ +
Sbjct: 184 LVTNCSNNYGPYHFPEKLIPHMILNALAGKPLPVYGDGSQIRDWLYVEDHARALVEVVTR 243

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIP-----KSYSHTELIRFIEDRPGHDRRY 294
           G++GE YNIGG+NE++N+++V  I  LLD ++P     ++ S+ ELI F++DRPGHDRRY
Sbjct: 244 GKVGETYNIGGHNEKRNLEVVETICDLLDEMVPWVVRGQACSYRELITFVKDRPGHDRRY 303

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNN 328
           AID+SKI+ E+GW PQE  ESG+ KTV WYL+N+
Sbjct: 304 AIDASKIERELGWMPQETFESGIRKTVRWYLENH 337


>gi|302186965|ref|ZP_07263638.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. syringae
           642]
          Length = 360

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 196/338 (57%), Positives = 247/338 (73%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSAL R+L+N+ + +VL  DKLTYAGNL SL+ I+    + F+Q DIC
Sbjct: 1   MRILVTGGAGFIGSALIRHLINNTEHEVLNFDKLTYAGNLESLQSIATDTRYEFVQADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D+  I + L+ F P AI++ AAESHVDRSI G  EFI TNI+GT+ LLE TR WW  L +
Sbjct: 61  DQARISAVLERFAPQAIMHLAAESHVDRSIDGPAEFIQTNIVGTYSLLEATRAWWLKLPE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            ++  FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KA+SD+LV AW  TYG+P
Sbjct: 121 AERQAFRFHHISTDEVYGDLHGVDDLFTETTPYAPSSPYSASKAASDHLVRAWHRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+++NCSNNYGP+HFPEKLIPL I   + G  + +YG+G  VRDWL+VEDH RAL  V+ 
Sbjct: 181 VVVTNCSNNYGPFHFPEKLIPLVILNALAGKPLPVYGNGLQVRDWLFVEDHARALLKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G +GE YNIGG+NE+KNID+V  I  LLD L P+  +    +++LI ++ DRPGHD+RY
Sbjct: 241 EGEVGETYNIGGHNEQKNIDVVRGICALLDELAPQHPAGVAQYSDLITYVVDRPGHDQRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID+ KI   +GW P E  ESGL KTV WYLDN  W R
Sbjct: 301 AIDAGKIDKALGWTPAETFESGLRKTVQWYLDNLDWCR 338


>gi|238892392|ref|YP_002917126.1| dTDP-glucose 4,6-dehydratase [Klebsiella pneumoniae NTUH-K2044]
 gi|238544708|dbj|BAH61059.1| dTDP-glucose 4,6-dehydratase [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
          Length = 355

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 195/336 (58%), Positives = 239/336 (71%), Gaps = 6/336 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIGSA+ R ++     +V+V+DKLTYAGNL SL  ++Q   F+F QVDICDR
Sbjct: 4   ILVTGGAGFIGSAVVREIIQHTADRVVVVDKLTYAGNLMSLAPVAQDARFAFEQVDICDR 63

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             +    ++ QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R WW+ L+  +
Sbjct: 64  AELDRIFRQHQPDTVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARSWWNTLATAQ 123

Query: 123 KDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           K  FRF  ISTDEVYG L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P L
Sbjct: 124 KSAFRFHHISTDEVYGDLHGSDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPTL 183

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           ++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALYLV   G
Sbjct: 184 ITNCSNNYGPYHFPEKLIPLTILNALAGKPLPVYGNGQQIRDWLYVEDHARALYLVATCG 243

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALI---PKSYSH-TELIRFIEDRPGHDRRYAI 296
             GE YNIGG+NERKNI++V  I  LL+ L    P+  +H  +LI F+ DRPGHD RYAI
Sbjct: 244 EPGETYNIGGHNERKNIEVVETICQLLEELAPDKPQGVAHYRDLIAFVADRPGHDLRYAI 303

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           D+SKI  E+GW P E   SG+ KTV WYL N  WWR
Sbjct: 304 DASKIARELGWTPAETFTSGMRKTVAWYLANEAWWR 339


>gi|292488710|ref|YP_003531597.1| dTDP-glucose 4,6-dehydratase [Erwinia amylovora CFBP1430]
 gi|291554144|emb|CBA21331.1| dTDP-glucose 4,6-dehydratase [Erwinia amylovora CFBP1430]
          Length = 383

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 192/338 (56%), Positives = 248/338 (73%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+    VL IDKLTYAGNL SL+EIS +  + F + DIC
Sbjct: 26  MKILVTGGAGFIGSAVIRHIINNTDDTVLNIDKLTYAGNLESLQEISDNPRYHFSKTDIC 85

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D E ++ A  +F+PD +++ AAESHVDRSI G   FI TNIIGT++LLE  R++W  L  
Sbjct: 86  DSESLKRAFNDFEPDVVMHLAAESHVDRSIDGPAAFIETNIIGTYVLLEAARMYWLGLPV 145

Query: 121 DKKDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           ++K+ FRF  ISTDEV+G L   + LF+E   Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 146 ERKEAFRFHHISTDEVFGDLHGTEDLFTEQTAYAPSSPYSASKASSDHLVRAWQRTYGLP 205

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           VL++NCSNNYGPYHFPEKLIPL I   + G  + +YG+G+ VRDWLYVEDH RALY V  
Sbjct: 206 VLVTNCSNNYGPYHFPEKLIPLTILNALAGKPLPIYGNGRQVRDWLYVEDHARALYRVAT 265

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRY 294
            G +GE YNIGG+NER+NI++V  I  +L+ L+            LI F++DRPGHD RY
Sbjct: 266 TGVVGETYNIGGHNERQNIEVVNTICSILNRLVVDKPCGIADFATLITFVQDRPGHDLRY 325

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID++KI+ E+GW P+E  E+GL KTV WYL N  WW+
Sbjct: 326 AIDATKIEKELGWLPEETFETGLEKTVQWYLKNTEWWQ 363


>gi|157961225|ref|YP_001501259.1| dTDP-glucose 4,6 dehydratase [Shewanella pealeana ATCC 700345]
 gi|157846225|gb|ABV86724.1| dTDP-glucose 4,6-dehydratase [Shewanella pealeana ATCC 700345]
          Length = 365

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 188/340 (55%), Positives = 246/340 (72%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL  I  +  + F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVINVDKLTYAGNLESLSSIESNERYVFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     + QP+A+++ AAESHVDRSI G  +FI TNI+GT+ LLE TR +W+ LS+
Sbjct: 61  DRAELDRVFAQCQPNAVMHLAAESHVDRSITGPADFIQTNIVGTYTLLEATRAYWNTLSK 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
             K  FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 GAKQAFRFHHISTDEVYGDLPHPDEVESGKELPLFTETTAYEPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WLRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G +GE YNIGG+NE++N+++V  I  +LD L+PK   +++ I ++ DRPGH
Sbjct: 241 RALYKVVTEGLVGETYNIGGHNEKQNLEVVQTICSILDFLVPKETKYSQQITYVTDRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAIDSSK++ E+GW P E  E+GL KT+ WYL N  W
Sbjct: 301 DRRYAIDSSKMQRELGWTPVETFETGLRKTIEWYLTNKEW 340


>gi|261345263|ref|ZP_05972907.1| dTDP-glucose 4,6-dehydratase [Providencia rustigianii DSM 4541]
 gi|282566961|gb|EFB72496.1| dTDP-glucose 4,6-dehydratase [Providencia rustigianii DSM 4541]
          Length = 357

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 188/337 (55%), Positives = 245/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R+++TGGAGFIGSA+ R+++ +     +V+D LTYAGNL SL E++ +  ++F  V+ICD
Sbjct: 5   RILITGGAGFIGSAVVRHVIENTNDSAVVVDCLTYAGNLESLAEVANNERYAFEHVNICD 64

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E+QPD +++ AAESHVDRSI G  EFI TNI+GT+ LLE  R +WS L + 
Sbjct: 65  RAALDRVFAEYQPDVVMHLAAESHVDRSIDGPAEFIETNIVGTYTLLEAARHYWSALDES 124

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG LD   G F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 125 KKLAFRFHHISTDEVYGDLDGPDGFFTETTPYAPSSPYSASKASSDHLVRAWQRTYGLPT 184

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I   I G  + +YG G+ +RDWL+VEDH RAL+LV  +
Sbjct: 185 MITNCSNNYGPYHFPEKLIPLIILNAISGKPLPVYGKGEQIRDWLFVEDHARALHLVATQ 244

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
            + G  YNIGG+NER+NI++V  I  LL+ L P+       + +LI +++DRPGHD RYA
Sbjct: 245 AQPGSTYNIGGHNERRNIEVVETICELLEELYPQKPQGVAHYRDLITYVKDRPGHDMRYA 304

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID++KI+ E+GW PQE  ESG+ KTV WYL+N  WWR
Sbjct: 305 IDAAKIERELGWTPQETFESGIRKTVQWYLNNETWWR 341


>gi|152971030|ref|YP_001336139.1| dTDP-D-glucose 4,6-dehydratase [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|150955879|gb|ABR77909.1| dTDP-D-glucose 4,6-dehydratase [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
          Length = 354

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 190/338 (56%), Positives = 247/338 (73%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ + + +V V+D LTYAGNL SL  ++ S  +SF Q DI 
Sbjct: 1   MKILVTGGAGFIGSAVVRHIIENTRDEVRVMDCLTYAGNLESLAPVAGSERYSFSQTDIT 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   + +   EF+PD +++ AAESHVDRSI G   FI TN+IGTF +LE  R +WS L  
Sbjct: 61  DAAAVAAQFSEFRPDIVMHLAAESHVDRSIDGPAAFIQTNVIGTFTMLEAARHYWSGLGD 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K  FRF  ISTDEVYG L     LF+E+ PY PSSPYSA+KA SD+LV AW  TYG+P
Sbjct: 121 VQKQAFRFHHISTDEVYGDLHGTDDLFTEETPYAPSSPYSASKAGSDHLVRAWNRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+++NCSNNYGPYHFPEKLIPL I   + G  + +YG+G+ +RDWLYVEDH RALY V  
Sbjct: 181 VVVTNCSNNYGPYHFPEKLIPLTILNALAGKPLPVYGNGEQIRDWLYVEDHARALYKVAT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALI---PKSYSH-TELIRFIEDRPGHDRRY 294
           +G+ GE YNIGG+NERKNID+V  I  +LD ++   P + +H  +LI F+ DRPGHD RY
Sbjct: 241 EGKSGETYNIGGHNERKNIDVVRTICAILDKVVAQKPGNITHFADLITFVTDRPGHDLRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID++KI+ ++GW PQE  ESG+ KTV WYL+N  WW+
Sbjct: 301 AIDAAKIQRDLGWVPQETFESGIEKTVHWYLNNQTWWQ 338


>gi|197334246|ref|YP_002154928.1| dTDP-glucose 4,6-dehydratase [Vibrio fischeri MJ11]
 gi|197315736|gb|ACH65183.1| dTDP-glucose 4,6-dehydratase [Vibrio fischeri MJ11]
          Length = 364

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 190/337 (56%), Positives = 247/337 (73%), Gaps = 6/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++++ +  V+ +DKLTYAGNL SL ++     + F Q+DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIISNTQDSVINLDKLTYAGNLESLSDVDSHERYVFEQIDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     E +PDA+++ AAESHVDRSI G   FI TNI+GT+ LLE TR +W+ LS 
Sbjct: 61  DRAELDRIFSEHKPDAVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEATRSYWNTLSD 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           DKK  FRF  ISTDEVYG L+    LF+E   Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 DKKQAFRFHHISTDEVYGDLEGTDDLFTETTSYEPSSPYSASKASSDHLVRAWLRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYGPYHFPEKLIPL I   ++G  + +YG+G  +RDWL+VEDH RALY V+ 
Sbjct: 181 TIVTNCSNNYGPYHFPEKLIPLMILNALDGKPLPVYGNGMQIRDWLFVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRY 294
           +G +GE YNIGG+NE+ NID+V  I  LL+ L+P        + +LI ++ DRPGHD RY
Sbjct: 241 EGVVGETYNIGGHNEKANIDVVKTICSLLEELVPNKPEGVAQYLDLITYVTDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           AID+SKI+ E+GW P+E  ESG+ KTV WYLDN  WW
Sbjct: 301 AIDASKIERELGWKPEETFESGIRKTVEWYLDNKQWW 337


>gi|330446540|ref|ZP_08310192.1| dTDP-glucose 4,6-dehydratase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328490731|dbj|GAA04689.1| dTDP-glucose 4,6-dehydratase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 360

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 191/337 (56%), Positives = 248/337 (73%), Gaps = 6/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ + +V+ IDKLTYAGNL SL+EI  S  + F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVIRHIINNTQDEVVNIDKLTYAGNLESLQEIEGSQRYKFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +    ++++PDA+++ AAESHVDRSI G   FI TNIIGT+ +LE  R +W+ L  
Sbjct: 61  DRAELDRVFEQYKPDAVMHLAAESHVDRSIDGPAAFIETNIIGTYTMLEAARQYWNRLEV 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K  FRF  ISTDEVYG L+    LF+E   Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 SRKSAFRFHHISTDEVYGDLEGTDDLFTETTSYEPSSPYSASKASSDHLVRAWLRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYGPYHFPEKLIPL I   ++G ++ +YGDG  +RDWLYVEDH  ALY V+ 
Sbjct: 181 TIVTNCSNNYGPYHFPEKLIPLMILNALDGKNLPVYGDGMQIRDWLYVEDHASALYTVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTE----LIRFIEDRPGHDRRY 294
           KG +GE YNIGG+NE+ NI++V  I  LL+ L+P    + E    LI ++ DRPGHD RY
Sbjct: 241 KGEVGETYNIGGHNEKANIEVVKTICSLLEELVPNKPDNVEKYQDLITYVSDRPGHDIRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           AID+SKI+ E+GW P E  ESG+ K+V WYL+N  WW
Sbjct: 301 AIDASKIERELGWKPAETFESGIRKSVEWYLNNKTWW 337


>gi|104779537|ref|YP_606035.1| dTDP-D-glucose-4,6-dehydratase [Pseudomonas entomophila L48]
 gi|95108524|emb|CAK13218.1| dTDP-D-glucose-4,6-dehydratase [Pseudomonas entomophila L48]
          Length = 361

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 195/339 (57%), Positives = 249/339 (73%), Gaps = 7/339 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSAL R+L+++ + +VL +DKLTYAGNL SL+ I+ ++ + F+Q DI 
Sbjct: 1   MRILVTGGAGFIGSALVRHLIDNTEHEVLNLDKLTYAGNLESLQGIASNSRYEFVQADIA 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D+  + + L+ FQP AI++ AAESHVDRSI G   FI TNI+GT+ LLE TR WWS L  
Sbjct: 61  DQPTVSALLERFQPQAIMHLAAESHVDRSIDGPAAFIQTNIVGTYALLEATRAWWSRLPA 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           D +  FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KA+SD+LV AW  TYG+P
Sbjct: 121 DARTAFRFHHISTDEVYGDLHGVDDLFTETTPYAPSSPYSASKAASDHLVRAWHRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           VL++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ VRDWLYVEDH RAL  V+ 
Sbjct: 181 VLITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQVRDWLYVEDHARALLTVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS-----HTELIRFIEDRPGHDRR 293
            G++GE YNIGG+NE+KN+D+V  +  LL+ L P+        + +LI F++DRPGHD R
Sbjct: 241 TGKVGETYNIGGHNEQKNLDVVHTLCDLLEELAPECRPAGVARYKDLITFVQDRPGHDLR 300

Query: 294 YAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           YAID+SKI+ E+GW P E   +GL KTV WYL N  W +
Sbjct: 301 YAIDASKIEHELGWKPDETFFTGLRKTVQWYLANLDWCK 339


>gi|213970796|ref|ZP_03398920.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. tomato T1]
 gi|301383030|ref|ZP_07231448.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. tomato
           Max13]
 gi|302063435|ref|ZP_07254976.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. tomato K40]
 gi|302130651|ref|ZP_07256641.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. tomato NCPPB
           1108]
 gi|213924468|gb|EEB58039.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. tomato T1]
          Length = 360

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 196/338 (57%), Positives = 249/338 (73%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSAL R+L+N+ +  VL  DKLTYAGNL SL+ I+ +  + F+Q DIC
Sbjct: 1   MRILVTGGAGFIGSALIRHLINNTEHNVLNFDKLTYAGNLESLQSIASNTRYEFVQADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D+  + + L+ F P AI++ AAESHVDRSI G  EF+ TNI+GT+ LLE TR +W  L  
Sbjct: 61  DQAKVSAVLERFAPQAIMHLAAESHVDRSIDGPAEFVQTNIVGTYSLLEATRAYWLKLPD 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            ++  FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KA+SD+LV AW  TYG+P
Sbjct: 121 VERQAFRFHHISTDEVYGDLHGVDDLFTETTPYAPSSPYSASKAASDHLVRAWHRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+++NCSNNYGP+HFPEKLIPL I   + G  + +YG+G  VRDWLYVEDH RAL  V+ 
Sbjct: 181 VVVTNCSNNYGPFHFPEKLIPLVILNALAGKPLPVYGNGLQVRDWLYVEDHARALLKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRY 294
           +G +GE YNIGG+NE+KNID+V  I  LLD L P+       +++LI ++ DRPGHD+RY
Sbjct: 241 EGDVGETYNIGGHNEQKNIDVVRGICSLLDELAPQHPDGVQHYSDLITYVVDRPGHDQRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID+SKI +E+GW P+E  ESGL KTV WYLDN  W R
Sbjct: 301 AIDASKIDNELGWTPEETFESGLRKTVQWYLDNLEWCR 338


>gi|217972651|ref|YP_002357402.1| dTDP-glucose 4,6 dehydratase [Shewanella baltica OS223]
 gi|217497786|gb|ACK45979.1| dTDP-glucose 4,6-dehydratase [Shewanella baltica OS223]
          Length = 356

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 189/340 (55%), Positives = 249/340 (73%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ + +V+ +DKLTYAGNL SL  + ++  + F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDRVINVDKLTYAGNLESLVSVDKNERYVFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     + QPDA+++ AAESHVDRSI G  +FI TNIIGT+ LLE TR +W+ LS 
Sbjct: 61  DRAELDRVFAQHQPDAVMHLAAESHVDRSITGPSDFIQTNIIGTYTLLEATRAYWNELSA 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           + K  FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 EAKKAFRFHHISTDEVYGDLPHPDEVALDTELPLFTETTSYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G+ +RDWLYVEDH 
Sbjct: 181 WLRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKLLPIYGKGEQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+IG+ YNIGG+NE++N+++V  I  +LDAL+PK   + + I ++ DRPGH
Sbjct: 241 RALYKVVTEGKIGDTYNIGGHNEKQNLEVVKTICSILDALVPKDTPYADQIIYVSDRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI +E+ W P+E  E+GL KTV WYL N  W
Sbjct: 301 DRRYAIDAVKISNELNWQPEETFETGLRKTVEWYLTNQEW 340


>gi|294635547|ref|ZP_06714027.1| dTDP-glucose 4,6-dehydratase [Edwardsiella tarda ATCC 23685]
 gi|291091116|gb|EFE23677.1| dTDP-glucose 4,6-dehydratase [Edwardsiella tarda ATCC 23685]
          Length = 362

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 191/341 (56%), Positives = 244/341 (71%), Gaps = 11/341 (3%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++     +V+ +DKLTYAGNL SL E+++++ + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVIRHIIKQTDDEVVNVDKLTYAGNLESLAEVAENSRYCFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D+  +     E QPDAI++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS LS 
Sbjct: 61  DKAAMVRIFSEHQPDAIMHLAAESHVDRSISGPAAFIETNIVGTYVLLEACRQYWSSLSA 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           +KK  FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 EKKAAFRFHHISTDEVYGDLPHPDEMASETVLPLFTEQTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WMRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIP-KSYSHTELIRFIEDRPG 289
           RALY V+ +G+ GE YNIGG+NE++N+D+V  I  LLD ++P K  S+ + I ++ DRPG
Sbjct: 241 RALYTVVTQGKAGETYNIGGHNEKQNLDVVHTICDLLDEIVPKKGGSYRDQITYVADRPG 300

Query: 290 HDRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           HDRRYAID+ KI  E+GW P E  ESG+ KTV WYLDN  W
Sbjct: 301 HDRRYAIDAQKISVELGWKPAETFESGIRKTVQWYLDNLQW 341


>gi|56459650|ref|YP_154931.1| dTDP-D-glucose 4,6-dehydratase [Idiomarina loihiensis L2TR]
 gi|56178660|gb|AAV81382.1| DTDP-D-glucose 4,6-dehydratase [Idiomarina loihiensis L2TR]
          Length = 352

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 195/339 (57%), Positives = 252/339 (74%), Gaps = 5/339 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+L+ +    V+ IDKLTYAGN+ SL  +S S  + F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVIRHLIKNTSHIVINIDKLTYAGNVESLLPVSDSENYVFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +   ++    E +PDA+++ AAESHVDRSI G  EFI TNI+GT+ LLE TR +WS LS+
Sbjct: 61  NAPEVKRVYIEHKPDAVMHLAAESHVDRSIEGPSEFIQTNIVGTYTLLEATRSYWSNLSE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           + K  FRF  ISTDEVYG L     LF+E   Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 EMKSTFRFHHISTDEVYGDLGDPTELFTETTAYAPSSPYSASKASSDHLVRAWHRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+++NCSNNYGPYHFPEKLIP  I   + G  + +YGDG+ +RDWLYVEDH RAL  V+ 
Sbjct: 181 VIITNCSNNYGPYHFPEKLIPHIILNALSGKELPVYGDGKQIRDWLYVEDHARALVKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS--HTELIRFIEDRPGHDRRYAI 296
           +G++GE YN+GG+NE++NI++V  I  LLD L P +    + E I F++DRPGHD+RYAI
Sbjct: 241 EGKVGETYNVGGHNEKQNIEVVNTICELLDELKPSASGKPYKEQITFVKDRPGHDKRYAI 300

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDN-NWWWRPL 334
           D+SKI+ E+GW P+E+ E+GL KTV WYL+N NWW R L
Sbjct: 301 DASKIEDELGWTPEESFETGLRKTVEWYLNNKNWWQRVL 339


>gi|223041543|ref|ZP_03611744.1| dTDP-glucose 4,6-dehydratase [Actinobacillus minor 202]
 gi|223017638|gb|EEF16048.1| dTDP-glucose 4,6-dehydratase [Actinobacillus minor 202]
          Length = 351

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 192/348 (55%), Positives = 257/348 (73%), Gaps = 10/348 (2%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           +L+VTGGAGFIGSAL RY++++ +  V+ +DKLTYAGNL SL+ +  +  ++F QVDICD
Sbjct: 3   KLLVTGGAGFIGSALIRYIISNTQDSVINVDKLTYAGNLESLEAVENNPRYAFEQVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           +  +     ++QPDA+++ AAESHVDRSI  A  FI TNI+GT+ LLE  R +W+ LS++
Sbjct: 63  KVALERVFNQYQPDAVMHLAAESHVDRSIDNAATFIETNIVGTYTLLEVARGYWNGLSEE 122

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           +K  FRF+ ISTDEVYG L+  +  F ED PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 RKSTFRFVHISTDEVYGDLEESQSPFREDSPYLPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           ++SNCSNNYGP+HFPEKLIPL I   +EG  + +YG+G+ +RDW++VEDHVRALY +L K
Sbjct: 183 IVSNCSNNYGPFHFPEKLIPLMILNALEGKPLPIYGNGKQIRDWIFVEDHVRALYQILSK 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G IG  Y+IGG NE+ NID+V +I  LL+ L P        + +LI ++ DRPGHD RYA
Sbjct: 243 GSIGSSYSIGGTNEKANIDVVRDICSLLEDLAPNKPIGVARYEDLIVYVADRPGHDNRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL----YKELK 339
           +D+SKI+ E+GW P E  E+GL KTV WYLD+  WW+ +    YK++K
Sbjct: 303 LDTSKIRKELGWKPLETFETGLRKTVEWYLDHKTWWQNIIDGSYKKIK 350


>gi|332142154|ref|YP_004427892.1| dTDP-glucose 4,6 dehydratase [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327552176|gb|AEA98894.1| dTDP-glucose 4,6 dehydratase [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 360

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 193/342 (56%), Positives = 243/342 (71%), Gaps = 10/342 (2%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIGSA+ R+L+ND    V+ +DKLTYAGNL SL  +S S+ +SF QVDICD 
Sbjct: 5   ILVTGGAGFIGSAVVRHLINDTDHTVVNLDKLTYAGNLESLTPVSSSDRYSFEQVDICDA 64

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
           E ++      +PD I++ AAESHVDRSI G  EFI TN++GT+ LLE+ R +WS L  DK
Sbjct: 65  EKVKRVFNTHRPDIIMHLAAESHVDRSIDGPGEFIQTNVVGTYTLLEQARAYWSELEGDK 124

Query: 123 KDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLAWG 172
           K  F+F  ISTDEVYG L          +  LF+E  PY PSSPYSA+KASSD LV +W 
Sbjct: 125 KAGFKFHHISTDEVYGDLPHPDEVEPGTELPLFTETTPYAPSSPYSASKASSDQLVRSWL 184

Query: 173 HTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRA 232
            TY +P L++NCSNNYGPYHFPEKLIPL I   + G  + +YG G  +RDWLYVEDH RA
Sbjct: 185 RTYKLPTLVTNCSNNYGPYHFPEKLIPLVILNALAGKPLPVYGKGNQIRDWLYVEDHARA 244

Query: 233 LYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDR 292
           L +V   G IGE YNIGG+NE++NI++V  I  +LD + PK   + E I +++DRPGHD 
Sbjct: 245 LVVVALNGEIGETYNIGGHNEKQNIEVVQTICTILDEVKPKESKYAEQITYVQDRPGHDM 304

Query: 293 RYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           RYAID+SKI+ E+GW PQE  ESG+ KTV WYL N  WW+ +
Sbjct: 305 RYAIDASKIERELGWKPQETFESGIRKTVEWYLANEGWWKAV 346


>gi|29725994|gb|AAO88925.1| dTDP-D-glucose-4,6-dehydratase [Vibrio cholerae]
          Length = 354

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 189/337 (56%), Positives = 248/337 (73%), Gaps = 6/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL  ++ S  ++F Q+DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHVIQNTQDSVVNLDKLTYAGNLESLASVAGSERYAFEQIDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     E QPDA+++ AAESHVDRSI G   FI TNIIGT+ LLE  R +WS L  
Sbjct: 61  DRAELDRVFAEHQPDAVMHLAAESHVDRSIDGPAAFIETNIIGTYTLLEAARHYWSHLES 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K  FRF  ISTDEVYG L+    LF+E   Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 KRKAAFRFHHISTDEVYGDLEGTDDLFTETTAYEPSSPYSASKASSDHLVRAWLRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYGPYHFPEKLIPL I   +EG  + +YGDG  +RDWL+VEDH RALY V+ 
Sbjct: 181 TIVTNCSNNYGPYHFPEKLIPLMILNALEGKALPVYGDGMQIRDWLFVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G++GE YNIGG+NE+ NI++V  +  LL+ L+P   +    + +LI +++DRPGHD RY
Sbjct: 241 EGQVGETYNIGGHNEKANIEVVNTLCALLEELVPNKPAGVAHYADLITYVKDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           AID+SKI+ E+GW P+E  ESG+ KTV WYL N+ WW
Sbjct: 301 AIDASKIERELGWKPEETFESGIRKTVEWYLHNHEWW 337


>gi|254492644|ref|ZP_05105815.1| dTDP-glucose 4,6-dehydratase [Methylophaga thiooxidans DMS010]
 gi|224462165|gb|EEF78443.1| dTDP-glucose 4,6-dehydratase [Methylophaga thiooxydans DMS010]
          Length = 355

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 191/331 (57%), Positives = 240/331 (72%), Gaps = 3/331 (0%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           LI+TGGAGFIGSAL R L+     Q++ +DKLTYAGNL SLK I     + F+Q DICD 
Sbjct: 6   LIITGGAGFIGSALIRRLITQSNYQIINVDKLTYAGNLESLKSIESHPNYIFVQADICDA 65

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             +      +QP A+++ AAESHVDRSI G  +F+ TN++GT+ +LE  R +W+ L  ++
Sbjct: 66  GKMAEVFSFYQPSAVMHLAAESHVDRSIDGPADFVQTNLVGTYTILEAARAYWNKLPSER 125

Query: 123 KDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLL 181
            D FRF  ISTDEV+GSL + GLF E  PY P+SPYSATKA SD+LV AW HTYG+PVL+
Sbjct: 126 ADNFRFHHISTDEVFGSLGEHGLFEETTPYQPNSPYSATKAGSDHLVRAWQHTYGLPVLM 185

Query: 182 SNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKGR 241
           SNCSNNYGP+ FPEKLIPL I   + G  + +YG G N+RDWLYVEDHV AL LVL+KG 
Sbjct: 186 SNCSNNYGPFQFPEKLIPLMINNAVSGKALPIYGRGDNIRDWLYVEDHVEALQLVLEKGT 245

Query: 242 IGERYNIGGNNERKNIDIVFEIGFLLDALIPKS--YSHTELIRFIEDRPGHDRRYAIDSS 299
           +GE YNIGG NE  NID+V  +  +LD LIP S    H +LI F+ DRPGHD+RYAID++
Sbjct: 246 VGESYNIGGFNEHTNIDVVETLCGILDELIPDSDFVPHKKLIEFVTDRPGHDQRYAIDAT 305

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           KI+ E+GW P+E   +GL KTV WYL+N+ W
Sbjct: 306 KIQQELGWRPRETFATGLQKTVQWYLENHEW 336


>gi|260162571|dbj|BAI43812.1| dTDP-D-glucose 4,6-dehydratase [Klebsiella pneumoniae]
          Length = 354

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 191/338 (56%), Positives = 246/338 (72%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ +   +V V+D LTYAGNL SL  ++ S  +SF Q DI 
Sbjct: 1   MKILVTGGAGFIGSAVVRHIIENTLDEVRVVDCLTYAGNLESLAPVAGSERYSFSQTDIT 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     EF+PD +++ AAESHVDRSI G   FI TN+IGTF LLE  R +WS L +
Sbjct: 61  DAAAVAVQFSEFRPDIVMHLAAESHVDRSIDGPAAFIQTNVIGTFTLLEAARHYWSGLGE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K  FRF  ISTDEVYG L     LF+E+ PY PSSPYSA+KA SD+LV AW  TYG+P
Sbjct: 121 AQKQAFRFHHISTDEVYGDLHGTDDLFTEETPYAPSSPYSASKAGSDHLVRAWNRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+++NCSNNYGPYHFPEKLIPL I   + G  + +YG+G+ +RDWLYVEDH RALY V  
Sbjct: 181 VVVTNCSNNYGPYHFPEKLIPLTILNALAGKPLPVYGNGEQIRDWLYVEDHARALYKVAT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALI---PKSYSH-TELIRFIEDRPGHDRRY 294
           +G+ GE YNIGG+NERKNID+V  I  +LD ++   P + +H  +LI F+ DRPGHD RY
Sbjct: 241 EGKSGETYNIGGHNERKNIDVVRTICAILDKVVAQKPGNITHFADLITFVTDRPGHDLRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID++KI+ ++GW PQE  ESG+ KTV WYL+N  WW+
Sbjct: 301 AIDAAKIQRDLGWVPQETFESGIEKTVHWYLNNQTWWQ 338


>gi|292899866|ref|YP_003539235.1| dTDP-D-glucose-4,6-dehydratase [Erwinia amylovora ATCC 49946]
 gi|291199714|emb|CBJ46834.1| dTDP-D-glucose-4,6-dehydratase [Erwinia amylovora ATCC 49946]
          Length = 358

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 192/338 (56%), Positives = 248/338 (73%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+    VL IDKLTYAGNL SL+EIS +  + F + DIC
Sbjct: 1   MKILVTGGAGFIGSAVIRHIINNTDDTVLNIDKLTYAGNLESLQEISDNPRYHFSKTDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D E ++ A  +F+PD +++ AAESHVDRSI G   FI TNIIGT++LLE  R++W  L  
Sbjct: 61  DSESLKRAFNDFEPDVVMHLAAESHVDRSIDGPAAFIETNIIGTYVLLEAARMYWLGLPV 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           ++K+ FRF  ISTDEV+G L   + LF+E   Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 ERKEAFRFHHISTDEVFGDLHGTEDLFTEQTAYAPSSPYSASKASSDHLVRAWQRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           VL++NCSNNYGPYHFPEKLIPL I   + G  + +YG+G+ VRDWLYVEDH RALY V  
Sbjct: 181 VLVTNCSNNYGPYHFPEKLIPLTILNALAGKPLPIYGNGRQVRDWLYVEDHARALYRVAT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRY 294
            G +GE YNIGG+NER+NI++V  I  +L+ L+            LI F++DRPGHD RY
Sbjct: 241 TGVVGETYNIGGHNERQNIEVVNTICSILNRLVVDKPCGIADFATLITFVQDRPGHDLRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID++KI+ E+GW P+E  E+GL KTV WYL N  WW+
Sbjct: 301 AIDATKIEKELGWLPEETFETGLEKTVQWYLKNTEWWQ 338


>gi|284006580|emb|CBA71841.1| dTDP-D-glucose-4,6-dehydratase [Arsenophonus nasoniae]
          Length = 355

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 194/337 (57%), Positives = 243/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R++VTGGAGFIGSA+ R+++      VLV+D LTYAGNL SL  +  +  ++F Q++I D
Sbjct: 3   RILVTGGAGFIGSAVVRHIIEHTNDNVLVVDSLTYAGNLESLASVVDNPRYTFTQINIAD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     ++QPDA+++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L Q 
Sbjct: 63  RPAMDKIFAQYQPDAVMHLAAESHVDRSIDGPAAFIETNIVGTYHLLEAARNYWNHLDQQ 122

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L   +GLF+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKPLFRFHHISTDEVYGDLHTTEGLFTETTPYAPSSPYSASKASSDHLVRAWQRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   I G  + +YG G+ +RDWLYVEDH RAL+LV+ +
Sbjct: 183 LVTNCSNNYGPYHFPEKLIPLIILNAIAGKSLPVYGQGEQIRDWLYVEDHARALHLVISQ 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDAL---IPKSYSH-TELIRFIEDRPGHDRRYA 295
              G+ YNIGG+NERKNID+V  I  LL+ L    P   +H  +LI ++ DRPGHD RYA
Sbjct: 243 ADAGKTYNIGGHNERKNIDVVKTICDLLEELRPVKPNGVTHYRDLITYVTDRPGHDMRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI+ E+GW PQE  ESG+ KTV WYL N  WWR
Sbjct: 303 IDASKIEQELGWKPQETFESGMRKTVEWYLSNETWWR 339


>gi|32034492|ref|ZP_00134664.1| COG1088: dTDP-D-glucose 4,6-dehydratase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126208936|ref|YP_001054161.1| dTDP-glucose 4,6-dehydratase [Actinobacillus pleuropneumoniae L20]
 gi|307257541|ref|ZP_07539305.1| dTDP-glucose 4,6-dehydratase [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|126097728|gb|ABN74556.1| dTDP-glucose 4,6-dehydratase [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
 gi|306863977|gb|EFM95896.1| dTDP-glucose 4,6-dehydratase [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
          Length = 357

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 198/338 (58%), Positives = 248/338 (73%), Gaps = 6/338 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           + +TGGAGFIGSAL RY++       + IDKLTYAGNL SL  +S S+ + F QVDICD 
Sbjct: 4   IFITGGAGFIGSALIRYVIKHTDCIAVNIDKLTYAGNLASLASVSNSSRYYFEQVDICDS 63

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             I     ++QPDA+++ AAESHVDRSI G   F+ TNIIGT+ LLE +R +W  LS++K
Sbjct: 64  GRISQLFCKYQPDAVMHLAAESHVDRSIDGPAAFMQTNIIGTYTLLEASRRYWLDLSREK 123

Query: 123 KDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           K  FRF  ISTDEVYG L  DKGLF+E  PY PSSPYSA+KASSD+LV AW  TYG+P L
Sbjct: 124 KQDFRFHHISTDEVYGDLGHDKGLFTETSPYAPSSPYSASKASSDHLVRAWFRTYGLPTL 183

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           ++NCSNNYGPY FPEKLIPL I   +EG  + +YG+G  +RDWL+VEDHVRALY VL  G
Sbjct: 184 VTNCSNNYGPYQFPEKLIPLMILNALEGKSLPVYGNGLQIRDWLFVEDHVRALYKVLCDG 243

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYAI 296
           ++GE YNIGG+NE+ NI++V  I  +LD L+P   +    + ELI +++DRPGHD RYAI
Sbjct: 244 KVGETYNIGGHNEKTNIEVVRAICRILDELVPNKRNGINKYEELITYVKDRPGHDVRYAI 303

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           D+SKI +++GW PQE  ESGL KTV WYL N  WW+ +
Sbjct: 304 DASKICTDLGWQPQETFESGLRKTVEWYLSNKDWWQSI 341


>gi|148556920|ref|YP_001264502.1| dTDP-glucose 4,6-dehydratase [Sphingomonas wittichii RW1]
 gi|148502110|gb|ABQ70364.1| dTDP-glucose 4,6-dehydratase [Sphingomonas wittichii RW1]
          Length = 352

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 191/334 (57%), Positives = 244/334 (73%), Gaps = 3/334 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSAL R+L+ +   +VL +DKLTYAG L+SL  +  S  + F++ DIC
Sbjct: 1   MRILVTGGAGFIGSALIRHLIGETDHEVLNLDKLTYAGVLSSLDPVGDSPRYRFVRGDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D E +   L EF+PD I + AAESHVDRSI G   FI TN++GT+ LL E   +W  L  
Sbjct: 61  DGELVGRLLGEFRPDVIAHLAAESHVDRSIDGPGAFIQTNLVGTYTLLAEALAYWRGLDG 120

Query: 121 DKKDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           D++D FRF  ISTDEV+GSL + G F+E   Y+P SPYSA+KA SD+LV AWGHTYG+PV
Sbjct: 121 DRRDAFRFHHISTDEVFGSLGEDGYFTEATAYDPRSPYSASKAGSDHLVRAWGHTYGLPV 180

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I R + G  + +YGDG NVRDWL+VEDH RAL  V ++
Sbjct: 181 LVTNCSNNYGPYHFPEKLIPLIIIRALAGEPLPVYGDGSNVRDWLFVEDHARALRAVFER 240

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS--YSHTELIRFIEDRPGHDRRYAID 297
           G  GE YN+GG++ER+N+++V  I   LD L P++   ++   I F+ DRPGHD RYAID
Sbjct: 241 GVPGETYNVGGDSERRNLEVVQAICATLDRLAPRADGRAYAGQIGFVADRPGHDHRYAID 300

Query: 298 SSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           +SKIK+E+GW PQ   E G+ +TV WYLDN  WW
Sbjct: 301 ASKIKAELGWAPQVGFEEGIERTVRWYLDNRGWW 334


>gi|330900905|gb|EGH32324.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. japonica
           str. M301072PT]
          Length = 360

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 196/338 (57%), Positives = 248/338 (73%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSAL R+L+N+ + +VL  DKLTYAGNL SL+ I+    + F+Q DIC
Sbjct: 1   MRILVTGGAGFIGSALIRHLINNTEHEVLNFDKLTYAGNLESLQSIATDTRYEFVQADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D+  + + L+ F P AI++ AAES VDRSI G  EFI TNI+GT+ LLE TR WW  L +
Sbjct: 61  DQARVSAVLERFAPQAIMHLAAESPVDRSIDGPAEFIQTNIVGTYSLLEATRAWWLKLPE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            ++  FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KA+SD+LV AW  TYG+P
Sbjct: 121 AQRQAFRFHHISTDEVYGDLHGVDDLFTETTPYAPSSPYSASKAASDHLVRAWHRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+++NCSNNYGP+HFPEKLIPL I   + G  + +YG+G  VRDWLYVEDH RAL  V+ 
Sbjct: 181 VVVTNCSNNYGPFHFPEKLIPLVILNALAGKPLPVYGNGLQVRDWLYVEDHARALLKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G +GE YNIGG+NE+KNID+V  I  LLD L P+  +    +++LI ++ DRPGHD+RY
Sbjct: 241 EGEVGETYNIGGHNEQKNIDVVRGICALLDELAPQHPAGVAQYSDLITYVVDRPGHDQRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID+SKI  E+ W P+E  ESGL KTV WYLDN  W R
Sbjct: 301 AIDASKIDKELDWTPEETFESGLRKTVQWYLDNLDWCR 338


>gi|331018759|gb|EGH98815.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. lachrymans
           str. M302278PT]
          Length = 360

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 196/338 (57%), Positives = 249/338 (73%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSAL R+L+N+ +  VL  DKLTYAGNL SL+ I+ +  + F+Q DIC
Sbjct: 1   MRILVTGGAGFIGSALIRHLINNTEHDVLNFDKLTYAGNLESLQSIASNTRYEFVQADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D+  + + L+ F P AI++ AAESHVDRSI G  EF+ TNI+GT+ LLE TR +W  L  
Sbjct: 61  DQAKVSAVLERFTPQAIMHLAAESHVDRSIDGPAEFVQTNIVGTYSLLEATRAYWLKLPD 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            ++  FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KA+SD+LV AW  TYG+P
Sbjct: 121 VERQAFRFHHISTDEVYGDLHGVDDLFTETTPYAPSSPYSASKAASDHLVRAWHRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+++NCSNNYGP+HFPEKLIPL I   + G  + +YG+G  VRDWLYVEDH RAL  V+ 
Sbjct: 181 VVVTNCSNNYGPFHFPEKLIPLVILNALAGKPLPVYGNGLQVRDWLYVEDHARALLKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRY 294
           +G +GE YNIGG+NE+KNID+V  I  LLD L P+       +++LI ++ DRPGHD+RY
Sbjct: 241 EGDVGETYNIGGHNEQKNIDVVRGICSLLDELAPQHPDGVQHYSDLITYVVDRPGHDQRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID+SKI +E+GW P+E  ESGL KTV WYLDN  W R
Sbjct: 301 AIDASKIDNELGWTPEETFESGLRKTVQWYLDNLDWCR 338


>gi|163803296|ref|ZP_02197175.1| dTDP-D-glucose 4,6-dehydratase [Vibrio sp. AND4]
 gi|159172933|gb|EDP57771.1| dTDP-D-glucose 4,6-dehydratase [Vibrio sp. AND4]
          Length = 362

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 189/340 (55%), Positives = 246/340 (72%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ +    V+ +DKLTYAGNL SL E+  S  ++F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVIRHIIKNTSDSVINVDKLTYAGNLESLVEVDSSERYTFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +R  +     + +PDA+++ AAESHVDRSI G   FI TNI+GT+ LLE TR +W+ L  
Sbjct: 61  NRSELDRVFADHKPDAVMHLAAESHVDRSITGPAAFIETNIVGTYTLLEATREYWNTLEG 120

Query: 121 DKKDQFRFLQISTDEVYGSL--------DKGL--FSEDMPYNPSSPYSATKASSDYLVLA 170
             K +FRF  ISTDEVYG L        D  L  F E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 SAKVEFRFHHISTDEVYGDLPHPDEVKSDTALPMFLETTSYEPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWL+VEDH 
Sbjct: 181 WLRTYGLPTMVTNCSNNYGPYHFPEKLIPLVILNALEGKDLPIYGKGDQIRDWLFVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G++GE YNIGG+NE+KN+++V  I  +LD L+PK   + E I +++DRPGH
Sbjct: 241 RALYKVVTEGQVGETYNIGGHNEKKNLEVVNTICDILDTLVPKDTKYAEQITYVQDRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAIDSSK++ E+ W P+E  E+GL KTV WYLDN+ W
Sbjct: 301 DRRYAIDSSKMQRELNWTPEETFETGLKKTVQWYLDNSTW 340


>gi|254286306|ref|ZP_04961265.1| dTDP-glucose 4,6-dehydratase [Vibrio cholerae AM-19226]
 gi|150423721|gb|EDN15663.1| dTDP-glucose 4,6-dehydratase [Vibrio cholerae AM-19226]
          Length = 354

 Score =  402 bits (1033), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 189/337 (56%), Positives = 248/337 (73%), Gaps = 6/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++   +  V+ +DKLTYAGNL SL  ++ S  ++F Q+DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIIQSTQDSVVNLDKLTYAGNLESLASVAGSERYAFEQIDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     E QPDA+++ AAESHVDRSI G   FI TNIIGT+ LLE  R +WS L  
Sbjct: 61  DRVELDRVFAEHQPDAVMHLAAESHVDRSIDGPAAFIETNIIGTYTLLEAARHYWSHLES 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           ++K  FRF  ISTDEVYG L+    LF+E   Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 ERKAAFRFHHISTDEVYGDLEGTDDLFTETTAYEPSSPYSASKASSDHLVRAWLRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYGPYHFPEKLIPL I   +EG  + +YGDG  +RDWL+VEDH RALY V+ 
Sbjct: 181 TIVTNCSNNYGPYHFPEKLIPLMILNALEGKALPVYGDGMQIRDWLFVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G++GE YNIGG+NE+ NI++V  +  LL+ L+P   +    + +LI +++DRPGHD RY
Sbjct: 241 EGQVGETYNIGGHNEKANIEVVNTLCALLEELVPNKPAGVAHYADLITYVKDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           AID+SKI+ E+GW P+E  ESG+ KTV WYL N+ WW
Sbjct: 301 AIDASKIERELGWKPEETFESGIRKTVEWYLHNHEWW 337


>gi|254295499|ref|YP_003061521.1| dTDP-glucose 4,6-dehydratase [Hirschia baltica ATCC 49814]
 gi|254044030|gb|ACT60824.1| dTDP-glucose 4,6-dehydratase [Hirschia baltica ATCC 49814]
          Length = 347

 Score =  402 bits (1033), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 194/336 (57%), Positives = 244/336 (72%), Gaps = 3/336 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+CR+L+ D  + V+ +DKLTYA NL SLKEI  +  ++F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVCRHLIKDKGVSVVNLDKLTYAANLESLKEIQDNPNYAFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DRE + + LK+   DAI++ AAESHVDRSI G   F+ TNIIGT+ +LE  R +W   + 
Sbjct: 61  DREAVLAVLKKHSVDAIMHLAAESHVDRSIDGPSAFMETNIIGTYSMLEAARHYWKD-TL 119

Query: 121 DKKDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           +  D+FRF  ISTDEV+G L  D  LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 120 NSSDKFRFHHISTDEVFGDLPFDDSLFTETTPYAPSSPYSASKASSDHLVRAWERTYGLP 179

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+++NCSNNYGP+HFPEKLIPL     +EG  + +YG G NVRDWLYVEDH  AL  VL+
Sbjct: 180 VVMTNCSNNYGPFHFPEKLIPLVTLNALEGKTLPVYGKGDNVRDWLYVEDHAVALATVLE 239

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDS 298
           KG++GE YNIGGN ER N+ +V  I  +LD          ELI F+ DRPGHD RYAID+
Sbjct: 240 KGKLGESYNIGGNCERTNLGVVESICDILDERGRIDKPRRELIEFVTDRPGHDMRYAIDA 299

Query: 299 SKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           SKIK+++GW P    E GL KT+ WYL N WWW+P+
Sbjct: 300 SKIKNDLGWEPSVTFEEGLTKTIDWYLANEWWWKPI 335


>gi|309274609|gb|ADO64233.1| RmlB [Vibrio vulnificus]
          Length = 353

 Score =  402 bits (1033), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 190/337 (56%), Positives = 247/337 (73%), Gaps = 6/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ND +  V+ +DKLTYAGNL SL  ++ S+ ++F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINDTQDSVVNLDKLTYAGNLESLASVAYSDRYAFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +       QPDA+++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L  
Sbjct: 61  DRAGLERVFAVHQPDAVMHLAAESHVDRSIDGPSAFIETNIVGTYTLLEAARSYWNSLPC 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           ++K  FRF  ISTDEVYG L+    LF+E   Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 ERKAAFRFHHISTDEVYGDLEGTDDLFTETTSYAPSSPYSASKASSDHLVRAWLRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYGPYHFPEKLIPL I   +EG  + +YGDG  +RDWL+VEDH RALY V+ 
Sbjct: 181 TVVTNCSNNYGPYHFPEKLIPLIILNALEGKALPVYGDGMQIRDWLFVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRY 294
           +G +GE YNIGG+NE+ NI++V  I  LL+ ++P        +  LI +++DRPGHD RY
Sbjct: 241 EGVVGETYNIGGHNEKANIEVVKTICSLLEEMVPNKPQGVVQYQNLITYVKDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           AID+SKI+ E+GW PQE  ESG+ KTV WYL+N  WW
Sbjct: 301 AIDASKIERELGWKPQETFESGIRKTVEWYLNNQEWW 337


>gi|70733811|ref|YP_257451.1| dTDP-glucose 4,6-dehydratase [Pseudomonas fluorescens Pf-5]
 gi|68348110|gb|AAY95716.1| dTDP-glucose 4,6-dehydratase [Pseudomonas fluorescens Pf-5]
          Length = 360

 Score =  402 bits (1033), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 193/338 (57%), Positives = 247/338 (73%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSAL R+L+   + +VL +DKLTYAGNL SL  I+ ++ + F++ DI 
Sbjct: 1   MRILVTGGAGFIGSALVRHLLQHTEHEVLNLDKLTYAGNLESLHSIASNSRYEFVKADIV 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D+  + + L  FQP AI++ AAESHVDRSI G  +FI TNI+GT+ LLE TR +W  L +
Sbjct: 61  DQATVSAVLARFQPHAIMHLAAESHVDRSIDGPSDFIQTNIVGTYSLLEATRAYWHALPE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K  FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KA+SD+LV AW  TYG+P
Sbjct: 121 AEKAAFRFHHISTDEVYGDLHGVDDLFTETTPYAPSSPYSASKAASDHLVRAWQRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           VL++NCSNNYGP+HFPEKLIPL I   + G  + +YG+G  VRDWLYVEDH RAL+ V+ 
Sbjct: 181 VLITNCSNNYGPFHFPEKLIPLVILNALAGKPLPVYGNGLQVRDWLYVEDHARALFKVMT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRY 294
           +G +GE YNIGG+NE+KNID+V  I  LL+ L P+       + +LI F++DRPGHD RY
Sbjct: 241 EGAVGETYNIGGHNEQKNIDVVRGICSLLEELAPQKPQGVAHYADLITFVQDRPGHDLRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID+ KI+ E+GW P+E   SGL KTV WYL+N  W R
Sbjct: 301 AIDAGKIERELGWVPEETFTSGLRKTVQWYLENLEWCR 338


>gi|259908059|ref|YP_002648415.1| DTDP-glucose 4,6-dehydratase [Erwinia pyrifoliae Ep1/96]
 gi|224963681|emb|CAX55178.1| DTDP-glucose 4,6-dehydratase [Erwinia pyrifoliae Ep1/96]
 gi|283477957|emb|CAY73873.1| dTDP-glucose 4,6-dehydratase [Erwinia pyrifoliae DSM 12163]
          Length = 356

 Score =  402 bits (1033), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 193/338 (57%), Positives = 250/338 (73%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+    VL +DKLTYAGNL SL+ IS S+ + F + DIC
Sbjct: 1   MKILVTGGAGFIGSAVIRHIINNTDDVVLNVDKLTYAGNLESLQGISDSSRYHFSKTDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D E +  A  +F+PD +++ AAESHVDRSI G   FI TNIIGT++LLE  R +W  L  
Sbjct: 61  DPESLNHAFNDFEPDVVMHLAAESHVDRSINGPAAFIETNIIGTYVLLEAARRYWLGLPV 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           ++K+ FRF  ISTDEV+G L     LF+E   Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 ERKEAFRFHHISTDEVFGDLHGTDDLFTEQTAYAPSSPYSASKASSDHLVRAWQRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            L++NCSNNYGPYHFPEKLIPL I   + G  + +YGDG+ VRDWLYVEDH RALY V  
Sbjct: 181 ALITNCSNNYGPYHFPEKLIPLTILNALAGKPLPVYGDGKQVRDWLYVEDHARALYRVAT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALI---PKSYS-HTELIRFIEDRPGHDRRY 294
            G +GE YNIGG+NER+NID+V  I  +L+ L+   P+  + ++ LI F++DRPGHD RY
Sbjct: 241 AGIVGETYNIGGHNERQNIDVVNTICRVLNRLVVDKPRGITDYSVLITFVQDRPGHDLRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID++KI+ E+GW P+E  E+GL KTV WYL+N  WW+
Sbjct: 301 AIDATKIEKELGWLPEETFETGLEKTVRWYLENTEWWK 338


>gi|312882941|ref|ZP_07742673.1| dTDP-glucose 4,6 dehydratase [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309369460|gb|EFP96980.1| dTDP-glucose 4,6 dehydratase [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 357

 Score =  402 bits (1033), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 190/340 (55%), Positives = 244/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++      V+ +D LTYAGNL SL  +  +  + F QV+IC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIIESTNDSVVNVDCLTYAGNLESLASVENNERYVFEQVNIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     E+ PDA+++ AAESHVDRSI G   FI TN++GT+ LLE TR +W+ LS 
Sbjct: 61  DRAELDRVFSEYNPDAVMHLAAESHVDRSITGPAAFIETNVVGTYTLLEATRAYWNDLSL 120

Query: 121 DKKDQFRFLQISTDEVYGSL------DKG----LFSEDMPYNPSSPYSATKASSDYLVLA 170
           D K  FRF  ISTDEVYG L      D G    +F E  PY PSSPYSA+KASSD+LV A
Sbjct: 121 DAKQSFRFHHISTDEVYGDLPHPDEFDAGTELPMFLETTPYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWL+VEDH 
Sbjct: 181 WLRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKELPIYGKGDQIRDWLFVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G IGE YNIGG+NE++N+++V  I  +LD L+PK   + E I +++DRPGH
Sbjct: 241 RALYKVVTEGGIGETYNIGGHNEKRNLEVVETICSILDVLVPKDSPYAEQITYVQDRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAIDSSK++ E+GW P E  E+GL KTV WYLDN+ W
Sbjct: 301 DRRYAIDSSKMQQELGWTPIETFETGLKKTVQWYLDNHKW 340


>gi|153829576|ref|ZP_01982243.1| dTDP-glucose 4,6-dehydratase [Vibrio cholerae 623-39]
 gi|148874972|gb|EDL73107.1| dTDP-glucose 4,6-dehydratase [Vibrio cholerae 623-39]
          Length = 354

 Score =  402 bits (1033), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 188/337 (55%), Positives = 248/337 (73%), Gaps = 6/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++   +  V+ +DKLTYAGNL SL  ++ S  ++F Q+DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIIQSTQDSVVNLDKLTYAGNLESLASVAGSERYAFEQIDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     E QPDA+++ AAESHVDRSI G   FI TNIIGT+ LLE  R +WS L  
Sbjct: 61  DRVELDRVFAEHQPDAVMHLAAESHVDRSIDGPTAFIETNIIGTYTLLEAARHYWSHLES 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           ++K  FRF  ISTDEVYG L+    LF+E   Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 ERKAAFRFHHISTDEVYGDLEGTDDLFTETTAYEPSSPYSASKASSDHLVRAWLRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYGPYHFPEKLIPL I   +EG  + +YGDG  +RDWL+VEDH RALY V+ 
Sbjct: 181 TIVTNCSNNYGPYHFPEKLIPLMILNALEGKALPVYGDGMQIRDWLFVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G++GE YNIGG+NE+ NI++V  +  LL+ L+P   +    + +LI +++DRPGHD RY
Sbjct: 241 EGQVGETYNIGGHNEKANIEVVNTLCALLEELVPNKPAGVAHYADLITYVKDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           AID+SK++ E+GW P+E  ESG+ KTV WYL N+ WW
Sbjct: 301 AIDASKVERELGWKPEETFESGIRKTVEWYLHNHEWW 337


>gi|153826348|ref|ZP_01979015.1| dTDP-glucose 4,6-dehydratase [Vibrio cholerae MZO-2]
 gi|149739917|gb|EDM54104.1| dTDP-glucose 4,6-dehydratase [Vibrio cholerae MZO-2]
          Length = 354

 Score =  402 bits (1033), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 189/337 (56%), Positives = 248/337 (73%), Gaps = 6/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++   +  V+ +DKLTYAGNL SL  ++ S  ++F Q+DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHVIQSTQDSVVNLDKLTYAGNLESLASVAGSERYAFEQIDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     E QPDA+++ AAESHVDRSI G   FI TNIIGT+ LLE  R +WS L  
Sbjct: 61  DRVELDRVFAEHQPDAVMHLAAESHVDRSIDGPAAFIETNIIGTYTLLEAARHYWSHLES 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           ++K  FRF  ISTDEVYG L+    LF+E   Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 ERKAAFRFHHISTDEVYGDLEGTDDLFTETTAYEPSSPYSASKASSDHLVRAWLRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYGPYHFPEKLIPL I   +EG  + +YGDG  +RDWL+VEDH RALY V+ 
Sbjct: 181 TIVTNCSNNYGPYHFPEKLIPLMILNALEGKALPVYGDGMQIRDWLFVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G++GE YNIGG+NE+ NI++V  +  LL+ L+P   +    + +LI +++DRPGHD RY
Sbjct: 241 EGQVGETYNIGGHNEKANIEVVNTLCALLEELVPNKPAGVAHYADLITYVKDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           AID+SKI+ E+GW P+E  ESG+ KTV WYL N+ WW
Sbjct: 301 AIDASKIERELGWKPEETFESGIRKTVEWYLHNHEWW 337


>gi|83582780|ref|YP_425086.1| dTDP-glucose 4,6-dehydratase [Rhodospirillum rubrum ATCC 11170]
 gi|83578096|gb|ABC24646.1| dTDP-glucose 4,6-dehydratase [Rhodospirillum rubrum ATCC 11170]
          Length = 351

 Score =  402 bits (1032), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 188/339 (55%), Positives = 243/339 (71%), Gaps = 1/339 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+  +L++     V+ +D LTYA NL SL E++ S+ + F + DI 
Sbjct: 1   MKILVTGGAGFIGSAVVHHLMSATDASVVNVDALTYAANLASLAEVAGSSRYQFEKADIR 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +       QPDA+++ AAESHVDRSI G   FI TN++GT+ LLE  R +WS LS 
Sbjct: 61  DAAALDRLFATHQPDAVMHLAAESHVDRSIDGPAAFIETNLLGTYTLLEAARRYWSALSA 120

Query: 121 DKKDQFRFLQISTDEVYGSLDK-GLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           ++K  FRF  ISTDEVYGSL + G F+E  PY+P+SPYSA+KA SD+LV AW HTYG+P 
Sbjct: 121 ERKAAFRFHHISTDEVYGSLGEIGAFTEATPYSPNSPYSASKAGSDHLVNAWHHTYGLPT 180

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           ++SNCSNNYGP  FPEKLIPL I   +EG  + +YG GQN+RDWL+VEDH RAL+ VL K
Sbjct: 181 VISNCSNNYGPRQFPEKLIPLMILNGLEGKPLPVYGQGQNIRDWLHVEDHARALWAVLTK 240

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSS 299
           G+ GE YN+GG  ER+NIDIV  +  LLD L+P       LI +++DRPGHD RYAID+S
Sbjct: 241 GQPGESYNVGGAAERRNIDIVTTVCDLLDELVPAEKPRRALITYVQDRPGHDFRYAIDAS 300

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKEL 338
           +I  E+GW P E  E+G+ KT+ WYLDN  WWRPL  ++
Sbjct: 301 RIHGELGWQPVETFETGIRKTIQWYLDNEAWWRPLRDQV 339


>gi|119469060|ref|ZP_01612044.1| dTDP-glucose 4,6 dehydratase, NAD(P)-binding [Alteromonadales
           bacterium TW-7]
 gi|119447312|gb|EAW28580.1| dTDP-glucose 4,6 dehydratase, NAD(P)-binding [Alteromonadales
           bacterium TW-7]
          Length = 362

 Score =  402 bits (1032), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 189/338 (55%), Positives = 248/338 (73%), Gaps = 8/338 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++++ +  V+ +DKLTYAGNL SLK +  ++ + F +VDIC
Sbjct: 1   MKILVTGGAGFIGSAVIRHIIDNTQDLVVNLDKLTYAGNLESLKSVDSNDRYKFERVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR+ I     + +PDA+++ AAESHVDRSI G  EFI TNI+GT+ LLE  R +W+ L++
Sbjct: 61  DRKAIDRVFAQHKPDAVMHLAAESHVDRSITGPAEFIQTNIVGTYNLLEAAREYWNTLNE 120

Query: 121 DKKDQFRFLQISTDEVYGSL--------DKGLFSEDMPYNPSSPYSATKASSDYLVLAWG 172
             K  FRF  ISTDEVYG L        +  LF+E+  Y PSSPYSA+KASSD+LV AW 
Sbjct: 121 GDKKSFRFHHISTDEVYGDLPHPDEREGELPLFTEETSYAPSSPYSASKASSDHLVRAWL 180

Query: 173 HTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRA 232
            TYG P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH RA
Sbjct: 181 RTYGFPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKDLPIYGKGDQIRDWLYVEDHARA 240

Query: 233 LYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDR 292
           LY V+ +G +GE YNIGG+NE++NI++V  I  +LD L+PK   ++E I F+ DRPGHDR
Sbjct: 241 LYKVVTEGIVGETYNIGGHNEKQNIEVVKSICSILDILVPKDSLYSEQITFVADRPGHDR 300

Query: 293 RYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           RYAIDSSK+ +++ W P E  E+GL KTV WYLDN  W
Sbjct: 301 RYAIDSSKMSAKLNWTPVETFETGLRKTVQWYLDNQTW 338


>gi|119947067|ref|YP_944747.1| dTDP-glucose 4,6-dehydratase [Psychromonas ingrahamii 37]
 gi|119865671|gb|ABM05148.1| dTDP-glucose 4,6-dehydratase [Psychromonas ingrahamii 37]
          Length = 360

 Score =  402 bits (1032), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 194/337 (57%), Positives = 247/337 (73%), Gaps = 6/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R ++++ K  V+ +DKLTYAGNL SL EI  S  +SF QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVIRNIISNTKDSVINVDKLTYAGNLESLSEIEASERYSFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +R  +    K+ QPDA+++ AAESHVDRSI G   FI TNI+GT+ LLE +R +W+ L  
Sbjct: 61  NRTELDGVFKKHQPDAVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEASRQYWNQLKA 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K+ FRF  ISTDEVYG L+    LF+E   Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 SRKEAFRFHHISTDEVYGDLEGTDDLFTETTSYEPSSPYSASKASSDHLVRAWQRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            L++NCSNNYGP+HFPEKLIPL I   ++G  + +YG+G  +RDWLYVEDH  ALY V+ 
Sbjct: 181 TLITNCSNNYGPFHFPEKLIPLIILNALDGKPLPVYGNGMQIRDWLYVEDHASALYTVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALI---PKSYSHTE-LIRFIEDRPGHDRRY 294
           KG IGE YNIGG+NE+ NI++V  I  LL+ L+   P + +  E LI ++ DRPGHD RY
Sbjct: 241 KGEIGETYNIGGHNEKANIEVVTTICSLLEELVANKPANVTKYEDLITYVTDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           AID+SKI+ E+GW P E  ESGL KTV WYL+N  WW
Sbjct: 301 AIDASKIERELGWAPAETFESGLRKTVEWYLNNKKWW 337


>gi|115279741|gb|ABI85357.1| dTDP-D-glucose-4,6-dehydratase [Vibrio cholerae]
          Length = 354

 Score =  402 bits (1032), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 189/337 (56%), Positives = 247/337 (73%), Gaps = 6/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++   +  V+ +DKLTYAGNL SL  ++ S  ++F Q+DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHVIQSTQDSVVNLDKLTYAGNLESLASVAGSERYAFEQIDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     E QPDA+++ AAESHVDRSI G   FI TNIIGT+ LLE  R +WS L  
Sbjct: 61  DRAELDRVFAEHQPDAVMHLAAESHVDRSIDGPTAFIETNIIGTYTLLEAARHYWSHLES 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K  FRF  ISTDEVYG L+    LF+E   Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 GRKAAFRFHHISTDEVYGDLEGTDDLFTETTAYAPSSPYSASKASSDHLVRAWLRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYGPYHFPEKLIPL I   +EG  + +YGDG  +RDWL+VEDH RALY V+ 
Sbjct: 181 TIVTNCSNNYGPYHFPEKLIPLMILNALEGKALPVYGDGMQIRDWLFVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G++GE YNIGG+NE+ NI++V  +  LL+ L+P   +    + +LI +++DRPGHD RY
Sbjct: 241 EGQVGETYNIGGHNEKANIEVVNTLCALLEELVPNKPAGVAHYADLITYVKDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           AID+SKI+ E+GW P+E  ESG+ KTV WYL N+ WW
Sbjct: 301 AIDASKIERELGWKPEETFESGIRKTVEWYLHNHEWW 337


>gi|325138754|gb|EGC61306.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis ES14902]
          Length = 355

 Score =  402 bits (1032), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 187/337 (55%), Positives = 246/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           +++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL+ +S    ++F QVDICD
Sbjct: 3   KILVTGGAGFIGSAVVRHIIRNTQDSVVNLDKLTYAGNLESLEPVSHHPRYAFEQVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     + QPDA+++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W  +  +
Sbjct: 63  RAALDRVFAQHQPDAVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWHDMPSE 122

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKAAFRFHHISTDEVYGDLSGTDDLFTETTPYAPSSPYSASKASSDHLVRAWQRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I   ++G  + +YGDG  +RDWL+VEDH RALY V+ +
Sbjct: 183 IVTNCSNNYGPYHFPEKLIPLMILNALDGKPLPVYGDGMQIRDWLFVEDHARALYQVVTE 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NE+ NI++V  I  LL+ L P+  +    + +LI F++DRPGHD RYA
Sbjct: 243 GVVGETYNIGGHNEKANIEVVKTICALLEELAPEKPAGVARYEDLITFVQDRPGHDVRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           +D++KI+ ++GW P E  ESGL KTV WYLDN  WW+
Sbjct: 303 VDAAKIRRDLGWLPLETFESGLRKTVQWYLDNKTWWQ 339


>gi|29725989|gb|AAO88921.1| dTDP-D-glucose-4,6-dehydratase [Vibrio cholerae]
          Length = 354

 Score =  402 bits (1032), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 189/337 (56%), Positives = 247/337 (73%), Gaps = 6/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++   +  V+ +DKLTYAGNL SL  ++ S  ++F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHVIQSTQDSVVNLDKLTYAGNLESLASVAGSERYAFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     E QPDA+++ AAESHVDRSI G   FI TNIIGT+ LLE  R +WS L  
Sbjct: 61  DRAELDRVFAEHQPDAVMHLAAESHVDRSIDGPTAFIETNIIGTYTLLEAARHYWSHLES 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           ++K  FRF  ISTDEVYG L+    LF+E   Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 ERKAAFRFHHISTDEVYGDLEGTDDLFTETTAYEPSSPYSASKASSDHLVRAWLRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYGPYHFPEKLIPL I   +EG  + +YGDG  +RDWL+VEDH RALY V+ 
Sbjct: 181 TIVTNCSNNYGPYHFPEKLIPLMILNALEGKALPVYGDGMQIRDWLFVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G++GE YNIGG+NE+ NI++V  +  LL+ L+P   +    + +LI +++DRPGHD RY
Sbjct: 241 EGQVGETYNIGGHNEKANIEVVNTLCALLEELVPNKPAGVAHYADLITYVKDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           AID+SKI+ E+GW P+E  ESG+ KTV WYL +  WW
Sbjct: 301 AIDASKIERELGWKPEETFESGIRKTVEWYLHHREWW 337


>gi|3033515|gb|AAC12869.1| dTDP-D-glucose-4,6-dehydratase [Pectobacterium atrosepticum
           SCRI1043]
          Length = 357

 Score =  401 bits (1031), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 188/339 (55%), Positives = 246/339 (72%), Gaps = 6/339 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R+++TGGAGFIGSAL RY++ + +  V+V+DKLTYAGNL+SL  ++ S+ F+F QVDICD
Sbjct: 5   RILITGGAGFIGSALVRYILAETQDSVVVVDKLTYAGNLSSLAPVADSSRFAFEQVDICD 64

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +      +QP  +++ AAESHVDRSI G   FI TNI+GT+ +LE  R +W  L+  
Sbjct: 65  RAELDRVFTAYQPALVMHLAAESHVDRSIDGPAAFIETNIVGTYTMLEAARHYWQNLADA 124

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            K+ FRF  ISTDEV+G L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG P 
Sbjct: 125 DKNAFRFHHISTDEVFGDLHGTDDLFTETTPYAPSSPYSASKASSDHLVRAWLRTYGFPT 184

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I   + G  + +YGDG  +RDWL+VEDH RALY V+ +
Sbjct: 185 VITNCSNNYGPYHFPEKLIPLVILNAVAGKPLPVYGDGAQIRDWLFVEDHARALYKVVTE 244

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NERKNI++V  I  LL+ L P   +    + +LI +++DRPGHD RYA
Sbjct: 245 GEVGETYNIGGHNERKNIEVVQTICALLEELAPNKPAGVAHYRDLITYVKDRPGHDMRYA 304

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           ID+ KI+ E+GW P+E  E+G+ KTV WYL+N  WWR +
Sbjct: 305 IDAGKIERELGWRPEETFETGMKKTVSWYLNNEKWWRSV 343


>gi|50123126|ref|YP_052293.1| dTDP-glucose 4,6-dehydratase [Pectobacterium atrosepticum SCRI1043]
 gi|49613652|emb|CAG77103.1| dTDP-glucose 4,6-dehydratase [Pectobacterium atrosepticum SCRI1043]
          Length = 355

 Score =  401 bits (1031), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 188/339 (55%), Positives = 246/339 (72%), Gaps = 6/339 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R+++TGGAGFIGSAL RY++ + +  V+V+DKLTYAGNL+SL  ++ S+ F+F QVDICD
Sbjct: 3   RILITGGAGFIGSALVRYILAETQDSVVVVDKLTYAGNLSSLAPVADSSRFAFEQVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +      +QP  +++ AAESHVDRSI G   FI TNI+GT+ +LE  R +W  L+  
Sbjct: 63  RAELDRVFTAYQPALVMHLAAESHVDRSIDGPAAFIETNIVGTYTMLEAARHYWQNLADA 122

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            K+ FRF  ISTDEV+G L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG P 
Sbjct: 123 DKNAFRFHHISTDEVFGDLHGTDDLFTETTPYAPSSPYSASKASSDHLVRAWLRTYGFPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I   + G  + +YGDG  +RDWL+VEDH RALY V+ +
Sbjct: 183 VITNCSNNYGPYHFPEKLIPLVILNAVAGKPLPVYGDGAQIRDWLFVEDHARALYKVVTE 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NERKNI++V  I  LL+ L P   +    + +LI +++DRPGHD RYA
Sbjct: 243 GEVGETYNIGGHNERKNIEVVQTICALLEELAPNKPAGVAHYRDLITYVKDRPGHDMRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           ID+ KI+ E+GW P+E  E+G+ KTV WYL+N  WWR +
Sbjct: 303 IDAGKIERELGWRPEETFETGMKKTVSWYLNNEKWWRSV 341


>gi|29726022|gb|AAO88948.1| dTDP-D-glucose-4,6-dehydratase [Vibrio cholerae]
          Length = 353

 Score =  401 bits (1031), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 189/336 (56%), Positives = 248/336 (73%), Gaps = 6/336 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++   +  V+ +DKLTYAGNL SL  ++ S  ++F Q+DIC
Sbjct: 1   MKILVTGGAGFIGSAVIRHIIQSTQDSVVNLDKLTYAGNLESLASVTGSERYAFEQIDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     E QPDA+++ AAESHVDRSI G   FI TNIIGT+ LLE  R +WS L  
Sbjct: 61  DRAELDRVFAEHQPDAVMHLAAESHVDRSIDGPAAFIETNIIGTYTLLEAARHYWSQLES 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           ++K  FRF  ISTDEVYG L+    LF+E   Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 ERKAAFRFHHISTDEVYGDLEGTDDLFTETTAYEPSSPYSASKASSDHLVRAWLRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYGPYHFPEKLIPL I   +EG  + +YGDG  +RDWL+VEDH RALY V+ 
Sbjct: 181 TIVTNCSNNYGPYHFPEKLIPLMILNALEGKALPVYGDGMQIRDWLFVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G++GE YNIGG+NE+ NI++V  +  LL+ L+P   +    +T+LI +++DRPGHD RY
Sbjct: 241 EGQVGETYNIGGHNEKANIEVVNTLCALLEELVPNKPAGIAHYTDLITYVKDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           AID+SKI+ E+GW PQE  ESG+ KTV WYL++  W
Sbjct: 301 AIDASKIERELGWKPQETFESGIRKTVEWYLNHRVW 336


>gi|95929371|ref|ZP_01312114.1| dTDP-glucose 4,6-dehydratase [Desulfuromonas acetoxidans DSM 684]
 gi|95134487|gb|EAT16143.1| dTDP-glucose 4,6-dehydratase [Desulfuromonas acetoxidans DSM 684]
          Length = 358

 Score =  401 bits (1031), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 189/340 (55%), Positives = 246/340 (72%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+L++TGGAGFIGSA+ R++++     ++ +DKLTYAGNL SL+E+  +  + F QVDIC
Sbjct: 1   MKLLITGGAGFIGSAVIRHIIHSTHDHIVNVDKLTYAGNLESLREVDGNERYQFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR+ +     + QPDA+++ AAESHVDRSI G   FI TNI+GT+ LLE +R +W+ L  
Sbjct: 61  DRKELDRVFHQHQPDAVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEASRAYWNKLDP 120

Query: 121 DKKDQFRFLQISTDEVYGSL---------DKGLFSEDMPYNPSSPYSATKASSDYLVLAW 171
           + K  FRF  ISTDEVYG L         +K LF+E   Y PSSPYSA+KASSD+LV AW
Sbjct: 121 EHKKNFRFHHISTDEVYGDLPHPSQDPEAEKHLFTEKASYAPSSPYSASKASSDHLVRAW 180

Query: 172 GHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVR 231
             TYG+P L++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH R
Sbjct: 181 LRTYGLPTLVTNCSNNYGPYHFPEKLIPLMILNALEGKSLPVYGQGDQIRDWLYVEDHAR 240

Query: 232 ALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS-HTELIRFIEDRPGH 290
           ALY ++ +G+IGE YNIGG+NE++NI++V  I  LLD L P  +S +  LI  ++DRPGH
Sbjct: 241 ALYKIITQGKIGETYNIGGHNEQQNIEVVTLICDLLDELAPSKHSPYRSLITHVQDRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           D+RYAID+ KI+ E+GW PQE   SG+ KT+ WYLDN  W
Sbjct: 301 DKRYAIDAGKIERELGWKPQETFASGIRKTIQWYLDNQAW 340


>gi|29726010|gb|AAO88938.1| dTDP-D-glucose-4,6-dehydratase [Vibrio cholerae]
          Length = 354

 Score =  401 bits (1031), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 188/337 (55%), Positives = 249/337 (73%), Gaps = 6/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL  ++ S  ++F Q+DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHVIQNTQDSVVNLDKLTYAGNLESLASVAGSERYAFEQIDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     E+QPDA+++ AAESHVDRSI G   FI TNIIGT+ LLE  R +WS L  
Sbjct: 61  DRAELDRIFAEYQPDAVMHLAAESHVDRSIDGPAAFIETNIIGTYTLLEAARHYWSNLES 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           ++K  FRF  ISTDEVYG L+    LF+E   Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 ERKAAFRFHHISTDEVYGDLEGTDDLFTETTAYEPSSPYSASKASSDHLVRAWLRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYGPYHFPEK IPL I   +EG  + +YGDG  +RDWL+VEDH RALY V+ 
Sbjct: 181 TIVTNCSNNYGPYHFPEKPIPLMILNALEGKALPVYGDGMQIRDWLFVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G++GE YNIGG+NE+ NI++V  +  LL+ L+P   +    + +LI +++DRPGHD RY
Sbjct: 241 EGQVGETYNIGGHNEKANIEVVNTLCALLEELVPNKPAGVAHYADLITYVKDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           AID+SKI+ E+GW P+E  ESG+ KTV WYL N+ WW
Sbjct: 301 AIDASKIERELGWKPEETFESGIRKTVEWYLHNHEWW 337


>gi|227325828|ref|ZP_03829852.1| dTDP-glucose 4,6-dehydratase [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 357

 Score =  401 bits (1030), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 189/339 (55%), Positives = 245/339 (72%), Gaps = 6/339 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R+++TGGAGFIGSAL RY++ + +  V+V+DKLTYAGNL+SL  ++ S+ F+F QVDICD
Sbjct: 5   RILITGGAGFIGSALVRYILTETQDSVVVVDKLTYAGNLSSLAPVADSSRFAFEQVDICD 64

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +      +QP  +++ AAESHVDRSI G   FI TNI+GT+ +LE  R +W  L+  
Sbjct: 65  RAELDRVFTAYQPALVMHLAAESHVDRSIDGPAAFIETNIVGTYTMLEAARHYWQNLADA 124

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            K  FRF  ISTDEV+G L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG P 
Sbjct: 125 DKRAFRFHHISTDEVFGDLHGTDDLFTETTPYAPSSPYSASKASSDHLVRAWLRTYGFPT 184

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I   + G  + +YGDG  +RDWL+VEDH RALY V+ +
Sbjct: 185 VITNCSNNYGPYHFPEKLIPLVILNAVAGKPLPVYGDGAQIRDWLFVEDHARALYKVVTE 244

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
           G IGE YNIGG+NERKNI++V  I  LL+ L P   +    + +LI +++DRPGHD RYA
Sbjct: 245 GEIGETYNIGGHNERKNIEVVQTICALLEELAPNKPAGVAHYRDLITYVKDRPGHDMRYA 304

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           ID+ KI+ E+GW P+E  E+G+ KTV WYL+N  WWR +
Sbjct: 305 IDAGKIERELGWRPEETFETGMRKTVSWYLNNEKWWRSV 343


>gi|261210466|ref|ZP_05924760.1| dTDP-glucose 4,6-dehydratase [Vibrio sp. RC341]
 gi|260840524|gb|EEX67090.1| dTDP-glucose 4,6-dehydratase [Vibrio sp. RC341]
          Length = 354

 Score =  401 bits (1030), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 188/337 (55%), Positives = 248/337 (73%), Gaps = 6/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL  ++ S  ++F Q+DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHVIQNTQDSVVNLDKLTYAGNLESLASVAGSERYAFEQIDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     E QPDA+++ AAESHVDRSI G   FI TNIIGT+ LLE  R +WS L  
Sbjct: 61  DRAELDRVFAEHQPDAVMHLAAESHVDRSIDGPAAFIETNIIGTYTLLEAARHYWSHLES 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           ++K  FRF  ISTDEVYG L+    LF+E   Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 ERKAAFRFHHISTDEVYGDLEGTDDLFTETTAYEPSSPYSASKASSDHLVRAWLRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYGPYHFPEKLIPL I   +EG  + +YGDG  +RDWL+VEDH RALY V+ 
Sbjct: 181 TIVTNCSNNYGPYHFPEKLIPLMILNALEGKALPVYGDGMQIRDWLFVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G++GE YNIGG+NE+ NI++V  +  LL+ L+P   +    + +LI +++DRPGHD RY
Sbjct: 241 EGQVGETYNIGGHNEKANIEVVNTLCALLEELVPNKPAGVAHYADLITYVKDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           AID+SKI+ E+GW P+E  ESG+ KTV WYL +  WW
Sbjct: 301 AIDASKIERELGWKPEETFESGIRKTVEWYLHHREWW 337


>gi|182680402|ref|YP_001834548.1| dTDP-glucose 4,6-dehydratase [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182636285|gb|ACB97059.1| dTDP-glucose 4,6-dehydratase [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 363

 Score =  401 bits (1030), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 188/334 (56%), Positives = 242/334 (72%), Gaps = 3/334 (0%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R +VTGGAGFIGSA+ R+L+ D   +V V+DKLTYAGNL++L+ ++++  + F QVDICD
Sbjct: 4   RFLVTGGAGFIGSAVVRHLIEDTPHEVCVLDKLTYAGNLDNLEPVAKNPRYRFKQVDICD 63

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  + + +  +QP  I++ AAESHVDRSI G   FI TN++GTF LLE  R +W  L  +
Sbjct: 64  RAAVATLIASYQPRIIMHLAAESHVDRSIDGPAAFIETNLVGTFTLLEAARCFWQDLPGE 123

Query: 122 KKDQFRFLQISTDEVYGSLDK-GLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           +K  FRF  +STDEV+GSL   G F E   Y P+SPYSA+KA SD+LV AWGHTYG+P +
Sbjct: 124 EKAAFRFHHVSTDEVFGSLGADGFFQETTAYQPNSPYSASKAGSDHLVRAWGHTYGLPTV 183

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
            SNCSNNYGPYHFPEKLIPL I   +EG  + +YG+GQN+RDWLYVEDH RAL  +   G
Sbjct: 184 TSNCSNNYGPYHFPEKLIPLMILNALEGKPLPVYGNGQNIRDWLYVEDHARALVAIALAG 243

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY--SHTELIRFIEDRPGHDRRYAIDS 298
           R GE YN+GG NER NID+V  +  L+D + P +      +LI F+ DRPGHD RYAID+
Sbjct: 244 RPGESYNVGGWNERANIDVVQAVCALVDEMAPDAAIGPREKLITFVTDRPGHDARYAIDA 303

Query: 299 SKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           +KIK ++GW P+E  E+GL KTV WYLD+  WW+
Sbjct: 304 TKIKQDLGWTPRETFETGLRKTVRWYLDHPEWWQ 337


>gi|153834837|ref|ZP_01987504.1| dTDP-glucose 4,6-dehydratase [Vibrio harveyi HY01]
 gi|148868708|gb|EDL67785.1| dTDP-glucose 4,6-dehydratase [Vibrio harveyi HY01]
          Length = 353

 Score =  401 bits (1030), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 192/337 (56%), Positives = 245/337 (72%), Gaps = 6/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ D    V+ +DKLTYAGNL SLKE+S +  + F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIIEDTSNVVINLDKLTYAGNLESLKEVSTNERYYFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     E QPD +++ AAESHVDRSI G   FI TN+IGT+ LLE  R +WS L +
Sbjct: 61  DRNELDRVFNEHQPDLVMHLAAESHVDRSIDGPAAFIETNVIGTYHLLESARQYWSALEE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           ++KD FRF  ISTDEVYG L+  + LF+E   Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 NRKDTFRFHHISTDEVYGDLEGTEDLFTETTSYAPSSPYSASKASSDHLVRAWQRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYGPYHFPEKLIPL I   ++G  + +YGDG  +RDWL+VEDH RALY V+ 
Sbjct: 181 TVVTNCSNNYGPYHFPEKLIPLMILNALDGKPLPVYGDGMQIRDWLFVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRY 294
           +G IGE YNIGG+NE+ NI++V  I  LL+   P       S+  LI +++DRPGHD RY
Sbjct: 241 EGEIGETYNIGGHNEKANIEVVKTICALLEEFRPNKPEGVNSYESLITYVKDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           AID+SKI  E+ W P+E  ESG+ KTV WYL+N  WW
Sbjct: 301 AIDASKIARELNWTPEETFESGIRKTVEWYLNNKDWW 337


>gi|153214722|ref|ZP_01949567.1| dTDP-glucose 4,6-dehydratase [Vibrio cholerae 1587]
 gi|124115158|gb|EAY33978.1| dTDP-glucose 4,6-dehydratase [Vibrio cholerae 1587]
          Length = 354

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 188/337 (55%), Positives = 247/337 (73%), Gaps = 6/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++   +  V+ +DKLTYAGNL SL  ++ S  ++F Q+DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHVIQSTQDSVVNLDKLTYAGNLESLASVAGSERYAFEQIDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     E QPD +++ AAESHVDRSI G   FI TNIIGT+ LLE  R +WS L  
Sbjct: 61  DRAELDRVFAEHQPDVVMHLAAESHVDRSIDGPAAFIETNIIGTYTLLEAARHYWSHLES 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           ++K  FRF  ISTDEVYG L+    LF+E   Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 ERKAAFRFHHISTDEVYGDLEGTDDLFTETTAYEPSSPYSASKASSDHLVRAWLRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYGPYHFPEKLIPL I   +EG  + +YGDG  +RDWL+VEDH RALY V+ 
Sbjct: 181 TIVTNCSNNYGPYHFPEKLIPLMILNALEGKALPVYGDGMQIRDWLFVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G++GE YNIGG+NE+ NI++V  +  LL+ L+P   +    + +LI +++DRPGHD RY
Sbjct: 241 EGQVGETYNIGGHNEKANIEVVNTLCALLEELVPNKPAGVAHYADLITYVKDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           AID+SKI+ E+GW P+E  ESG+ KTV WYL N+ WW
Sbjct: 301 AIDASKIERELGWKPEETFESGIRKTVEWYLHNHEWW 337


>gi|331677947|ref|ZP_08378622.1| dTDP-glucose 4,6-dehydratase [Escherichia coli H591]
 gi|331074407|gb|EGI45727.1| dTDP-glucose 4,6-dehydratase [Escherichia coli H591]
          Length = 360

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 190/340 (55%), Positives = 243/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSAL RY++N     V+ +DKLTYAGNL+SLK+I   + + F+  DIC
Sbjct: 1   MKILVTGGAGFIGSALTRYIINSTNDSVVNVDKLTYAGNLHSLKDIDNCDRYVFVHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D + + + L   +PDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +W  L  
Sbjct: 61  DAKALDAILSTHKPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARKYWQTLEG 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           +KK  FRF  ISTDEVYG L             LF+E+  Y PSSPYSA+KASSD+LV A
Sbjct: 121 EKKQGFRFHHISTDEVYGDLPHPDDWDNKNSPPLFTENTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TY +P +++NCSNNYGPYHFPEKLIPL I   ++   + +YG G  +RDWLYVEDH 
Sbjct: 181 WHRTYNLPTIVTNCSNNYGPYHFPEKLIPLVILNALQDKSLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ KG +GE YNIGG NE+KNI++V  I  +LD + PK+ S+ E I ++ DRPGH
Sbjct: 241 RALYTVITKGIVGETYNIGGYNEKKNIEVVETICDILDEIKPKNTSYREQIIYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+SKI  ++GW PQE  ESG+ KT+ WYLDN  W
Sbjct: 301 DRRYAIDASKITLDLGWKPQETFESGIKKTIHWYLDNQEW 340


>gi|29726033|gb|AAO88957.1| dTDP-D-glucose-4,6-dehydratase [Vibrio cholerae]
          Length = 356

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 191/342 (55%), Positives = 248/342 (72%), Gaps = 8/342 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+L+VTGGAGFIGSA+ R+++ +    V+ +DKLTYAGNLNS+  I+Q + + F Q DIC
Sbjct: 1   MKLLVTGGAGFIGSAVVRHIIKNTNNSVVNVDKLTYAGNLNSVVNIAQDSRYVFEQADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           + E I +   + QPDA+++ AAESHVDRSI G   FI TNIIGT+ LLE  R +W  L +
Sbjct: 61  NAEAIVALFAKHQPDAVMHLAAESHVDRSIDGPAAFIETNIIGTYTLLEAARNYWKFLPE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K  FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 TRKQAFRFHHISTDEVYGDLHGTDNLFTETTPYAPSSPYSASKASSDHLVRAWQRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+++NCSNNYGPYHFPEKLIPL I   + G  + +YG G  +RDWLYVEDH RALY V+ 
Sbjct: 181 VIVTNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGKGNQIRDWLYVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS------HTELIRFIEDRPGHDR 292
           +G +GE YNIGG+NE++NID+V  +  +L+ L P + S      +  LI +++DRPGHD 
Sbjct: 241 EGVVGETYNIGGHNEKQNIDVVKTLCAILEELAPIANSTLNIPNYESLITYVQDRPGHDL 300

Query: 293 RYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           RYAID+SKI+ E+GW P+E  E+GL KTV WYL+N  WW+ +
Sbjct: 301 RYAIDASKIERELGWKPEETFETGLRKTVQWYLNNKDWWQAV 342


>gi|110833771|ref|YP_692630.1| dTDP-glucose 4,6-dehydratase [Alcanivorax borkumensis SK2]
 gi|110646882|emb|CAL16358.1| dTDP-glucose 4,6-dehydratase [Alcanivorax borkumensis SK2]
          Length = 360

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 191/336 (56%), Positives = 244/336 (72%), Gaps = 6/336 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++++    V+ +DKLTYAGNL SL  +S S  ++F +VDIC
Sbjct: 1   MKILVTGGAGFIGSAVIRHIISNTDDSVVNVDKLTYAGNLESLLSVSDSPRYTFEKVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +   L+  QPD I++ AAESHVDRSI G   F+ TNIIGT+ LLE  R +W+ L  
Sbjct: 61  DRHTLDGVLQRHQPDVIMHLAAESHVDRSIDGPAAFMETNIIGTYTLLEAARQYWNSLDD 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
             +  FRF  ISTDEVYG LD  + LF+E  PY PSSPYSA+KASSD+LV AW  TYG P
Sbjct: 121 TAQQAFRFHHISTDEVYGDLDGPEDLFTETTPYAPSSPYSASKASSDHLVRAWLRTYGFP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            L++NCSNNYGP+HFPEKLIPL I   +EG  + +YG G  VRDWLYVEDH RALY V  
Sbjct: 181 TLITNCSNNYGPFHFPEKLIPLMILNALEGKPLPVYGQGTQVRDWLYVEDHARALYKVAT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRY 294
           +G++GE YNIGG+NE++NID+V  +  LL+ L+P        + +LI  + DRPGHD RY
Sbjct: 241 EGKVGETYNIGGHNEKQNIDVVHTLCDLLEELVPSKPEGISQYRDLITHVRDRPGHDLRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           AID+SKI+ E+GW PQE  E+G+ KTV WYLDN+ W
Sbjct: 301 AIDASKIERELGWTPQETFETGIRKTVLWYLDNSEW 336


>gi|77456929|ref|YP_346434.1| dTDP-glucose 4,6-dehydratase [Pseudomonas fluorescens Pf0-1]
 gi|77380932|gb|ABA72445.1| dTDP-glucose 4,6-dehydratase [Pseudomonas fluorescens Pf0-1]
          Length = 360

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 187/337 (55%), Positives = 244/337 (72%), Gaps = 6/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+L+ + + +V+ +DKLTYAGNL SL E+S S  + F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVVRFLIEETECEVINVDKLTYAGNLESLAEVSDSPRYRFCQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +       QPDA+++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L  
Sbjct: 61  DRPALDELFARLQPDAVMHLAAESHVDRSIDGPQAFIETNIVGTYTLLEAARGYWNRLDA 120

Query: 121 DKKDQFRFLQISTDEVYGSLDK--GLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            ++  FRF  ISTDEVYG L+     F+E  PY PSSPYSATKA SD+LV AW  T+G+P
Sbjct: 121 ARQAAFRFHHISTDEVYGDLEPEDPAFTERTPYAPSSPYSATKAGSDHLVRAWHRTFGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V++SNCSNNYGPYHFPEKLIP  I   ++G  + +YGDG  +RDWL+VEDH RALY V+ 
Sbjct: 181 VVMSNCSNNYGPYHFPEKLIPHVILNALQGKLLPVYGDGAQIRDWLFVEDHARALYAVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDAL---IPKSYSH-TELIRFIEDRPGHDRRY 294
           +G +G+ YNIGG+NE+ N+++V  +  LL+A     P   +H  +LI F++DRPGHD+RY
Sbjct: 241 RGEVGQTYNIGGHNEKTNLEVVHTLCDLLEARGAEKPAGVAHFRDLITFVKDRPGHDKRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           A+D+ KI + +GW PQE  ESG+ KTV WYLDN  WW
Sbjct: 301 AVDAGKIHATLGWTPQETFESGMQKTVDWYLDNRAWW 337


>gi|28872504|ref|NP_795123.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|28855759|gb|AAO58818.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. tomato str.
           DC3000]
          Length = 360

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 195/338 (57%), Positives = 248/338 (73%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSAL R+L+N+ +  VL  DKLTYAGNL SL+ I+ +  + F+  DIC
Sbjct: 1   MRILVTGGAGFIGSALIRHLINNTEHDVLNFDKLTYAGNLESLQSIASNTRYEFVHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D+  + + L+ F P AI++ AAESHVDRSI G  EF+ TNI+GT+ LLE TR +W  L  
Sbjct: 61  DQAKVSAVLERFAPQAIMHLAAESHVDRSIDGPAEFVQTNIVGTYSLLEATRAYWLKLPD 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            ++  FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KA+SD+LV AW  TYG+P
Sbjct: 121 VERQAFRFHHISTDEVYGDLHGVDDLFTETTPYAPSSPYSASKAASDHLVRAWHRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+++NCSNNYGP+HFPEKLIPL I   + G  + +YG+G  VRDWLYVEDH RAL  V+ 
Sbjct: 181 VVVTNCSNNYGPFHFPEKLIPLVILNALAGKPLPVYGNGLQVRDWLYVEDHARALLKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRY 294
           +G +GE YNIGG+NE+KNID+V  I  LLD L P+       +++LI ++ DRPGHD+RY
Sbjct: 241 EGDVGETYNIGGHNEQKNIDVVRGICSLLDELAPQHPDGVQHYSDLITYVVDRPGHDQRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID+SKI +E+GW P+E  ESGL KTV WYLDN  W R
Sbjct: 301 AIDASKIDNELGWTPEETFESGLRKTVQWYLDNLDWCR 338


>gi|229512769|ref|ZP_04402237.1| dTDP-glucose 4,6-dehydratase [Vibrio cholerae TMA 21]
 gi|229350279|gb|EEO15231.1| dTDP-glucose 4,6-dehydratase [Vibrio cholerae TMA 21]
          Length = 354

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 188/337 (55%), Positives = 247/337 (73%), Gaps = 6/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++   +  V+ +DKLTYAGNL SL  ++ S  ++F Q+DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHVIQSTQDSVVNLDKLTYAGNLESLASVAGSERYAFEQIDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     E QPDA+++ AAESHVDRSI G   FI TNIIGT+ LLE  R +WS L  
Sbjct: 61  DRAELDRVFAEHQPDAVMHLAAESHVDRSIDGPAAFIETNIIGTYTLLEAARHYWSHLES 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           ++K  FRF  ISTDEVYG L+    LF+E   Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 ERKAAFRFHHISTDEVYGDLEGTDDLFTETTAYEPSSPYSASKASSDHLVRAWLRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYGPYHFPEKLIPL I   +EG  + +YGDG  +RDWL+VEDH RALY V+ 
Sbjct: 181 TIVTNCSNNYGPYHFPEKLIPLMILNALEGKALPVYGDGMQIRDWLFVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G++GE YNIGG+NE+ NI++V  +  LL+ L+P   +    + +LI +++DRPGHD RY
Sbjct: 241 EGQVGETYNIGGHNEKANIEVVNTLCALLEELVPNKPAGVAHYADLITYVKDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           AID+SKI+ E+GW P+E  ESG+ KTV WYL +  WW
Sbjct: 301 AIDASKIERELGWKPEETFESGIRKTVEWYLHHREWW 337


>gi|240948929|ref|ZP_04753285.1| dTDP-glucose 4,6-dehydratase [Actinobacillus minor NM305]
 gi|240296744|gb|EER47355.1| dTDP-glucose 4,6-dehydratase [Actinobacillus minor NM305]
          Length = 356

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 185/336 (55%), Positives = 250/336 (74%), Gaps = 6/336 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           +++VTGGAGFIGSA+ R+++ND +  V+ +DKLTYAGNL SL+ +  +  ++F QVDICD
Sbjct: 4   KILVTGGAGFIGSAVVRHIINDTQDSVINVDKLTYAGNLESLESVENNPRYAFEQVDICD 63

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           +  +     ++QPDA+++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L ++
Sbjct: 64  KAALERVFHQYQPDAVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEVARGYWNNLPEE 123

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           +K  FRF  ISTDEVYG L+    LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 124 RKSAFRFHHISTDEVYGDLEGTDDLFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 183

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGP+HFPEKLIPL I   +EG  + +YG+G  +RDWL+VEDH RALY V+ +
Sbjct: 184 IVTNCSNNYGPFHFPEKLIPLMILNALEGKKLPVYGNGMQIRDWLFVEDHARALYKVVTE 243

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NE+ NI++V  I  LL+ L+P   +    + +LI ++ DRPGHD RYA
Sbjct: 244 GVVGETYNIGGHNEKANIEVVRTICGLLEELVPNKPAGVAKYEDLITYVTDRPGHDVRYA 303

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           ID++KI +E+GW PQE  E+G+ KTV WYL+N  WW
Sbjct: 304 IDATKIGNELGWKPQETFETGIRKTVEWYLNNKKWW 339


>gi|254673891|emb|CBA09674.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis alpha275]
          Length = 371

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 186/336 (55%), Positives = 248/336 (73%), Gaps = 6/336 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL E++ +  ++F QVDICDR
Sbjct: 9   ILVTGGAGFIGSAVVRHIIRNTRDAVVNVDKLTYAGNLKSLTEVADNPRYAFEQVDICDR 68

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             +     + +PDA+++ AAESHVDRSI  A EFI TNI+GTF LLE  R +W  +  ++
Sbjct: 69  AELDRVFAQHRPDAVMHLAAESHVDRSIGSAGEFIQTNIVGTFNLLEAARAYWQQMPSEQ 128

Query: 123 KDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
            + FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P +
Sbjct: 129 HEAFRFHHISTDEVYGDLGGTDDLFTETAPYAPSSPYSASKASSDHLVRAWLRTYGLPTI 188

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           ++NCSNNYGPYHFPEKLIPL I   ++G  + +YGDG  +RDWL+VEDH RALY V+ +G
Sbjct: 189 VTNCSNNYGPYHFPEKLIPLMILNALDGKPLPVYGDGMQIRDWLFVEDHARALYQVVTEG 248

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYAI 296
            +GE YNIGG+NE+ NI++V  I  LL+ L+P+  +    + +LI F++DRPGHD RYA+
Sbjct: 249 VVGETYNIGGHNEKANIEVVKTICTLLEELVPEKPAGVARYEDLITFVQDRPGHDVRYAV 308

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           D++KI+ ++GW P E  ESGL KTV WYLDN  WW+
Sbjct: 309 DAAKIRRDLGWLPLETFESGLRKTVQWYLDNKTWWQ 344


>gi|238918075|ref|YP_002931589.1| dTDP-glucose 4,6-dehydratase, [Edwardsiella ictaluri 93-146]
 gi|238867643|gb|ACR67354.1| dTDP-glucose 4,6-dehydratase, putative [Edwardsiella ictaluri
           93-146]
          Length = 356

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 190/339 (56%), Positives = 244/339 (71%), Gaps = 6/339 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R++VTGGAGFIGSA+ R+++ D    V+V+DKLTYAGNL SL  ++ S+ ++F + DI D
Sbjct: 5   RILVTGGAGFIGSAVVRHIIMDTTDSVVVVDKLTYAGNLASLAPVADSDRYAFERADIGD 64

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +   L +++PDAI++ AAESHVDRSI G  +FI TNI+GT+ LLE TR +WS L   
Sbjct: 65  RAAMDRILAQYRPDAIMHLAAESHVDRSIDGPADFIQTNIVGTYTLLEATRGYWSALPVA 124

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            +  FRF  ISTDEVYG L   + LF ED PY PSSPYS +KA+SD+LV AW  TYG+P 
Sbjct: 125 LRAAFRFHHISTDEVYGDLHDPQALFREDTPYAPSSPYSTSKAASDHLVRAWLRTYGLPT 184

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   +    + +YG+G  VRDWLYVEDH  ALY VL  
Sbjct: 185 LITNCSNNYGPYHFPEKLIPLTIINALAAKPLPVYGNGLQVRDWLYVEDHACALYRVLTT 244

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NER+NID+V  +  LL  ++P+         +LI ++ DRPGHD RYA
Sbjct: 245 GQVGETYNIGGHNERRNIDVVTTLCALLQEMVPEKPVGVRHFADLITYVADRPGHDVRYA 304

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           ID++KI+ E+GW PQE  ESG+ KTV WYL N  WWR +
Sbjct: 305 IDAAKIERELGWRPQETFESGIRKTVAWYLANERWWRAV 343


>gi|332995213|gb|AEF05268.1| dTDP-glucose 4,6 dehydratase [Alteromonas sp. SN2]
          Length = 359

 Score =  400 bits (1028), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 192/342 (56%), Positives = 250/342 (73%), Gaps = 10/342 (2%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIGSA+ R+L+N  + +V+ +DKLTYAGNL SL  +S +  ++F QVDICD 
Sbjct: 4   ILVTGGAGFIGSAVVRHLINYTEHKVVNLDKLTYAGNLESLLSVSDNERYAFEQVDICDA 63

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
           + +++ L   QPD I++ AAESHVDRSI G  EFI TN++GT+ LLE+ R +WS L   K
Sbjct: 64  DGVKAVLNTHQPDIIMHLAAESHVDRSIDGPGEFIQTNVVGTYTLLEQARAYWSTLDDVK 123

Query: 123 KDQFRFLQISTDEVYGSL------DKG----LFSEDMPYNPSSPYSATKASSDYLVLAWG 172
           K+ F+F  ISTDEVYG L      ++G    LF+E  PY PSSPYSA+KASSD LV +W 
Sbjct: 124 KEGFKFHHISTDEVYGDLPHPDEVEEGAELPLFTETTPYAPSSPYSASKASSDQLVRSWL 183

Query: 173 HTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRA 232
            TY +P L++NCSNNYGPYHFPEKLIPL I   + G  + +YG G  +RDWLYVEDH RA
Sbjct: 184 RTYKLPTLVTNCSNNYGPYHFPEKLIPLVILNALAGKPLPVYGKGNQIRDWLYVEDHARA 243

Query: 233 LYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDR 292
           L LV  +G+IGE YNIGG+NE++NI++V  I  +LD + PK   ++E I ++ DRPGHD 
Sbjct: 244 LVLVALEGKIGETYNIGGHNEKQNIEVVNTICDILDDVQPKDSKYSEQITYVADRPGHDM 303

Query: 293 RYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           RYAID+SKI+ E+GW PQE  ESG+ KTV WYL+N  WW+ +
Sbjct: 304 RYAIDASKIERELGWSPQETFESGIRKTVEWYLNNEGWWKAV 345


>gi|227114346|ref|ZP_03828002.1| dTDP-glucose 4,6-dehydratase [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 357

 Score =  400 bits (1028), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 189/339 (55%), Positives = 245/339 (72%), Gaps = 6/339 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R+++TGGAGFIGSAL RY++ + +  V+V+DKLTYAGNL+SL  ++ S+ F+F QVDICD
Sbjct: 5   RILITGGAGFIGSALVRYILTETQDSVVVVDKLTYAGNLSSLAPVADSSRFAFEQVDICD 64

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +      +QP  +++ AAESHVDRSI G   FI TNI+GT+ +LE  R +W  L+  
Sbjct: 65  RAELDRVFTAYQPALVMHLAAESHVDRSIDGPAAFIETNIVGTYTMLEAARHYWQNLADA 124

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            K  FRF  ISTDEV+G L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG P 
Sbjct: 125 DKRAFRFHHISTDEVFGDLHGTDDLFTETTPYAPSSPYSASKASSDHLVRAWLRTYGFPT 184

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I   + G  + +YGDG  +RDWL+VEDH RALY V+ +
Sbjct: 185 VITNCSNNYGPYHFPEKLIPLVILNAVAGKPLPVYGDGAQIRDWLFVEDHARALYKVVTE 244

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
           G IGE YNIGG+NERKNI++V  I  LL+ L P   +    + +LI +++DRPGHD RYA
Sbjct: 245 GEIGETYNIGGHNERKNIEVVQTICDLLEELAPNKPAGVAHYRDLITYVKDRPGHDMRYA 304

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           ID+ KI+ E+GW P+E  E+G+ KTV WYL+N  WWR +
Sbjct: 305 IDAGKIERELGWRPEETFETGMRKTVSWYLNNEKWWRSV 343


>gi|15676000|ref|NP_273127.1| dTDP-D-glucose 4,6-dehydratase [Neisseria meningitidis MC58]
 gi|15676012|ref|NP_273142.1| dTDP-D-glucose 4,6-dehydratase [Neisseria meningitidis MC58]
 gi|12644325|sp|P55294|RFBB_NEIMB RecName: Full=dTDP-glucose 4,6-dehydratase
 gi|7225283|gb|AAF40531.1| dTDP-D-glucose 4,6-dehydratase [Neisseria meningitidis MC58]
 gi|7225297|gb|AAF40543.1| dTDP-D-glucose 4,6-dehydratase [Neisseria meningitidis MC58]
 gi|316985925|gb|EFV64864.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis H44/76]
 gi|325141224|gb|EGC63723.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis CU385]
 gi|325141235|gb|EGC63734.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis CU385]
 gi|325199291|gb|ADY94746.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis H44/76]
 gi|325199302|gb|ADY94757.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis H44/76]
 gi|325205167|gb|ADZ00620.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis M04-240196]
 gi|325205180|gb|ADZ00633.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis M04-240196]
          Length = 355

 Score =  400 bits (1028), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 186/337 (55%), Positives = 249/337 (73%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           +++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL E++ +  ++F QVDICD
Sbjct: 3   KILVTGGAGFIGSAVVRHIIRNTRDAVVNVDKLTYAGNLESLTEVADNPRYAFEQVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     +++PDA+++ AAESHVDRSI  A EFI TNI+GTF LLE  R +W  +  +
Sbjct: 63  RAELDRVFAQYRPDAVMHLAAESHVDRSIGSAGEFIQTNIVGTFNLLEAARAYWQQMPSE 122

Query: 122 KKDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           + + FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 QHEAFRFHHISTDEVYGDLGGTDDLFTETAPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I   ++G  + +YGDG  +RDWL+VEDH RALY V+ +
Sbjct: 183 IVTNCSNNYGPYHFPEKLIPLMILNALDGKPLPVYGDGMQIRDWLFVEDHARALYQVVTE 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NE+ NI++V  I  LL+ L P+  +    + +LI F++DRPGHD RYA
Sbjct: 243 GVVGETYNIGGHNEKANIEVVKTICALLEELAPEKPAGVARYEDLITFVQDRPGHDVRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           +D++KI+ ++GW P E  ESGL KTV WYLDN  WW+
Sbjct: 303 VDAAKIRRDLGWLPLETFESGLRKTVQWYLDNKTWWQ 339


>gi|158423457|ref|YP_001524749.1| dTDP-D-glucose-4,6-dehydratase [Azorhizobium caulinodans ORS 571]
 gi|158330346|dbj|BAF87831.1| dTDP-D-glucose-4,6-dehydratase [Azorhizobium caulinodans ORS 571]
          Length = 354

 Score =  400 bits (1028), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 191/336 (56%), Positives = 242/336 (72%), Gaps = 4/336 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R++VTGGAGFIGSA+ R+LV      VL  DKLTYAGNL S+  ++    + F+Q DICD
Sbjct: 7   RVLVTGGAGFIGSAVVRHLVA-TGATVLNFDKLTYAGNLASVGPVADHPNYQFVQADICD 65

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
            E +R AL+ F+PD +++ AAESHVDRSI G   FITTNI GT+++L+E   +W  L   
Sbjct: 66  AEAVRGALEGFKPDTVMHLAAESHVDRSIDGPGAFITTNINGTYVMLQEALRYWRTLGSA 125

Query: 122 KKDQFRFLQISTDEVYGSLD-KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
            ++ FRF  ISTDEV+GSL  +GLF ED PY P+SPYSA+KA+SD+LV AW HTYG+P +
Sbjct: 126 AQEGFRFHHISTDEVFGSLGAEGLFREDTPYQPNSPYSASKAASDHLVRAWHHTYGLPTV 185

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           +SNCSNNYGPYHFPEKLIPL I   ++G  + +YG G+N+RDWLYVEDH  AL L+   G
Sbjct: 186 MSNCSNNYGPYHFPEKLIPLTILNALDGLKLPVYGTGENIRDWLYVEDHAEALALIAATG 245

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIP--KSYSHTELIRFIEDRPGHDRRYAIDS 298
             GE YN+GG NER+NID+V  I  +LD + P  K      LI F+ DRPGHD RYAID+
Sbjct: 246 TPGESYNVGGLNERRNIDVVRTICAILDEIRPDAKIGPRENLITFVTDRPGHDARYAIDA 305

Query: 299 SKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           +K+ +E+GW  +E  E+GL KTV WYLDN  WW PL
Sbjct: 306 TKLTTELGWKARETFETGLRKTVHWYLDNRAWWEPL 341


>gi|29725979|gb|AAO88913.1| dTDP-D-glucose-4,6-dehydratase [Vibrio cholerae]
          Length = 354

 Score =  400 bits (1028), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 189/337 (56%), Positives = 247/337 (73%), Gaps = 6/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++   +  V+ +DKLTYAGNL SL  ++ S  ++F Q+DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIIQSTQDSVVNLDKLTYAGNLESLASVAGSERYAFEQIDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     E QPDA+++ AAESHVDRSI G   FI TNIIGT+ LLE  R +WS L  
Sbjct: 61  DRVELDRVFAEHQPDAVMHLAAESHVDRSIDGPTAFIETNIIGTYTLLEAARHYWSQLES 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           ++K  FRF  ISTDEVYG L+    LF+E   Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 ERKAVFRFHHISTDEVYGDLEGTDDLFTETTAYEPSSPYSASKASSDHLVRAWLRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYGPYHFPEKLIPL I   +EG  + +YGDG  +RDWL+VEDH RALY V+ 
Sbjct: 181 TIVTNCSNNYGPYHFPEKLIPLMILNALEGKALPVYGDGMQIRDWLFVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G +GE YNIGG+NE+ NI++V  +  LL+ L+P   +    + +LI +++DRPGHD RY
Sbjct: 241 EGLVGETYNIGGHNEKANIEVVNTLCALLEELVPNKPAGVAHYADLITYVKDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           AID+SKI+ E+GW P+E  ESG+ KTV WYL N+ WW
Sbjct: 301 AIDASKIERELGWKPEETFESGIRKTVEWYLHNHEWW 337


>gi|225025757|ref|ZP_03714949.1| hypothetical protein EIKCOROL_02661 [Eikenella corrodens ATCC
           23834]
 gi|224941538|gb|EEG22747.1| hypothetical protein EIKCOROL_02661 [Eikenella corrodens ATCC
           23834]
          Length = 357

 Score =  400 bits (1028), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 190/338 (56%), Positives = 247/338 (73%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           + +++TGGAGFIGSA+ R+++   +  V+ +DKLTYAGNL SL E+S S  ++F QVDIC
Sbjct: 2   INILLTGGAGFIGSAVIRHIIRHTRDSVINLDKLTYAGNLESLAEVSGSPRYTFEQVDIC 61

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +R  +     + QPD +++ AAESHVDRSI  A EFI TNI+GTF LLE  R +W  L +
Sbjct: 62  NRAELDRVFAQHQPDCVMHLAAESHVDRSIDSAGEFIQTNIVGTFNLLEAARTYWLGLPE 121

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           +++  FRF  ISTDEVYG L     LF+E MPY PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 122 NRRSVFRFHHISTDEVYGDLHGTSDLFTETMPYAPSSPYSASKASSDHLVRAWLRTYGLP 181

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWL+VEDH RALY V+ 
Sbjct: 182 TIITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLFVEDHARALYQVIT 241

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRY 294
           +G+IGE YNIGG+NE+ N+++V  I  LL+ L P+       + +LI F+ DRPGHD RY
Sbjct: 242 QGKIGESYNIGGHNEKNNLEVVQTICTLLEELAPEKPVGVSRYADLITFVPDRPGHDLRY 301

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID++KI  E+GW PQE  ESG+ KTV WYLDN  WW+
Sbjct: 302 AIDATKIGHELGWQPQETFESGMRKTVQWYLDNKIWWQ 339


>gi|84386936|ref|ZP_00989960.1| dTDP-D-glucose 4,6-dehydratase [Vibrio splendidus 12B01]
 gi|84378226|gb|EAP95085.1| dTDP-D-glucose 4,6-dehydratase [Vibrio splendidus 12B01]
          Length = 368

 Score =  400 bits (1028), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 186/338 (55%), Positives = 245/338 (72%), Gaps = 10/338 (2%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIGSA+ R+++N+    V+ +DKLTYAGNL SL E+  S  ++F QVDIC+R
Sbjct: 6   ILVTGGAGFIGSAVIRHIINNTSDSVINVDKLTYAGNLESLIEVDSSERYAFEQVDICNR 65

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             +     + +PDA+++ AAESHVDRSI G   FI TNI+GT+ LLE TR +W+ L +  
Sbjct: 66  SELDRVFADHKPDAVMHLAAESHVDRSITGPAAFIETNIVGTYTLLEATREYWNTLEERA 125

Query: 123 KDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLAWG 172
           K +F F  ISTDEVYG L             +F E   Y PSSPYSA+KASSD+LV AW 
Sbjct: 126 KAEFCFHHISTDEVYGDLPHPDEVPEGTALPMFLETTSYEPSSPYSASKASSDHLVRAWL 185

Query: 173 HTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRA 232
            TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWL+VEDH RA
Sbjct: 186 RTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKELPIYGKGDQIRDWLFVEDHARA 245

Query: 233 LYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDR 292
           LY V+ +G++GE YNIGG+NE+KN+++V  I  +LD L+PK  ++ E I +++DRPGHDR
Sbjct: 246 LYKVVTEGKVGETYNIGGHNEKKNLEVVNTICEILDTLVPKESAYAEQITYVQDRPGHDR 305

Query: 293 RYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           RYAIDSSK++ E+ W P+E  E+GL KTV WYLDN+ W
Sbjct: 306 RYAIDSSKMQRELDWTPEETFETGLRKTVQWYLDNSTW 343


>gi|29726028|gb|AAO88953.1| dTDP-D-glucose-4,6-dehydratase [Vibrio cholerae]
          Length = 356

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 186/340 (54%), Positives = 245/340 (72%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL  ++ S  ++F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIICNTQDSVINLDKLTYAGNLESLVSVAASERYAFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     + QPDA+++ AAESHVDRSI G  +FI TNI+GT+ LLE  R +W+ L  
Sbjct: 61  DRVELDRVFVKHQPDAVMHLAAESHVDRSITGPADFIQTNIVGTYTLLEAARQYWNALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           ++K  FRF  ISTDEVYG L             LF+E  PY PSSPYSA+KASSD+LV A
Sbjct: 121 ERKAAFRFHHISTDEVYGDLPHPDEVAAGSKLPLFTETTPYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL     +EG  + +YG G  +RDWLYV+DH 
Sbjct: 181 WLRTYGLPTIVTNCSNNYGPYHFPEKLIPLVTLNALEGKPLPIYGKGDQIRDWLYVKDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G++GE YNIGG+NE++N+++V  I  +LD+L+PK   + E I ++ DRPGH
Sbjct: 241 RALYKVVTEGKVGETYNIGGHNEKQNLEVVQTICSILDSLVPKDTPYAEQITYVTDRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+SK+  E+ W PQE  E+GL KTV WYL N  W
Sbjct: 301 DRRYAIDASKMSCELDWQPQETFETGLRKTVEWYLANQEW 340


>gi|297182566|gb|ADI18726.1| dtdP-d-glucose 4,6-dehydratase [uncultured Rhizobiales bacterium
           HF4000_32B18]
          Length = 351

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 187/336 (55%), Positives = 241/336 (71%), Gaps = 2/336 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+CR+LV      V+ +DKLTYA NL+SL  I+    + F++ DIC
Sbjct: 1   MKILVTGGAGFIGSAVCRHLVAATDHAVVNLDKLTYAANLSSLAPIADDPRYRFVEGDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +   ++    DA+++ AAESHVDRSI G  EF+ TN+ GTF LLE  R  W  L  
Sbjct: 61  DRAMVAGLMETEGIDAVMHLAAESHVDRSIDGPGEFVRTNVTGTFELLEAARGHWERLPG 120

Query: 121 DKKDQFRFLQISTDEVYG--SLDKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            KKD FRF  ISTDEV+G   L  GLF+E+ PY PSSPYSA+KA+SD+LV+AW  TYG+P
Sbjct: 121 AKKDAFRFHHISTDEVFGDLPLSGGLFTEETPYEPSSPYSASKAASDHLVMAWHRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+LSNCSNNYGPYHFPEKLIPL I   + G  + +YG G+NVRDWLYV+DH RAL  +L 
Sbjct: 181 VVLSNCSNNYGPYHFPEKLIPLMILNALHGEALPVYGRGENVRDWLYVDDHARALTTILT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDS 298
           +G  G  YN+GG NER N+++V  I   +D L P + S  +L+RF+ DRPGHD RYAID+
Sbjct: 241 RGAPGRSYNVGGRNERSNLEVVHAICDTIDRLAPAATSRRDLVRFVTDRPGHDLRYAIDA 300

Query: 299 SKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           ++I++E+GW  +E  E+GL KT  WYL N  WWRP+
Sbjct: 301 TRIETELGWRAEETFETGLEKTARWYLANEAWWRPI 336


>gi|167623417|ref|YP_001673711.1| dTDP-glucose 4,6 dehydratase [Shewanella halifaxensis HAW-EB4]
 gi|167353439|gb|ABZ76052.1| dTDP-glucose 4,6-dehydratase [Shewanella halifaxensis HAW-EB4]
          Length = 384

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 189/358 (52%), Positives = 246/358 (68%), Gaps = 28/358 (7%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL  I  +  + F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVINVDKLTYAGNLESLASIESNERYVFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     + +PDA+++ AAESHVDRSI G  +FI TNI+GT+ LLE TR +W+ L++
Sbjct: 61  DRAELDRVFVKCKPDAVMHLAAESHVDRSITGPADFIQTNIVGTYTLLEATRAYWNTLAE 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------------------------LFSEDMPYN 152
           D K  FRF  ISTDEVYG L                               LF+E   Y 
Sbjct: 121 DAKKAFRFHHISTDEVYGDLPHPDDIEDETEPSTGKEPSADNEPSANKSLPLFTETTSYE 180

Query: 153 PSSPYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVF 212
           PSSPYSA+KASSD+LV AW  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + 
Sbjct: 181 PSSPYSASKASSDHLVRAWLRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKPLP 240

Query: 213 LYGDGQNVRDWLYVEDHVRALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIP 272
           +YG G  +RDWLYVEDH RALY V+ +G +GE YNIGG+NE++N+++V  I  +LD+L+P
Sbjct: 241 IYGKGDQIRDWLYVEDHARALYKVVTEGVVGETYNIGGHNEKQNLEVVQTICAILDSLVP 300

Query: 273 KSYSHTELIRFIEDRPGHDRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           K   + E I ++ DRPGHDRRYAIDSSK++ E+GW P E  E+GL KT+ WYL N  W
Sbjct: 301 KETKYKEQITYVTDRPGHDRRYAIDSSKMQRELGWTPIETFETGLKKTIEWYLTNQEW 358


>gi|29726004|gb|AAO88933.1| dTDP-D-glucose-4,6-dehydratase [Vibrio cholerae]
          Length = 354

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 189/337 (56%), Positives = 248/337 (73%), Gaps = 6/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL  ++ S  ++F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHVIQNTQDSVVNLDKLTYAGNLESLVSVAGSERYAFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     E+QPDA+++ AAESHVDRSI G   FI TNIIGT+ LLE  R +WS L  
Sbjct: 61  DRAELDRVFAEYQPDAVMHLAAESHVDRSIDGPAAFIETNIIGTYTLLEAARHYWSNLES 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           ++K  FRF  ISTDEVYG L+    LF+E   Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 ERKVAFRFHHISTDEVYGDLEGTDDLFTETTAYEPSSPYSASKASSDHLVRAWLRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYGPYHFPEKLIPL I   +EG  + +YGDG  +RDWL+VEDH RALY V+ 
Sbjct: 181 TIVTNCSNNYGPYHFPEKLIPLMILNALEGKALPVYGDGMQIRDWLFVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G +GE YNIGG+NE+ NI++V  +  LL+ L+P   +    + +LI +++DRPGHD RY
Sbjct: 241 EGLVGETYNIGGHNEKANIEVVNTLCALLEELVPNKPAGVAHYADLITYVKDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           AID+SKI+ E+GW P+E  ESG+ KTV WYL +  WW
Sbjct: 301 AIDASKIERELGWKPEETFESGIRKTVEWYLHHREWW 337


>gi|325133137|gb|EGC55808.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis M6190]
          Length = 355

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 186/337 (55%), Positives = 249/337 (73%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           +++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL +I+ +  ++F QVDICD
Sbjct: 3   KILVTGGAGFIGSAVVRHIIRNTQDSVVNLDKLTYAGNLESLTDIADNPRYAFEQVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     + +PDA+++ AAESHVDRSI  A EFI TNI+GTF LLE  R +W  +  +
Sbjct: 63  RAELDRVFAQHRPDAVMHLAAESHVDRSIGSAGEFIQTNIVGTFNLLEAARAYWQQMPSE 122

Query: 122 KKDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           + + FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 QHEAFRFHHISTDEVYGDLGGTDDLFTETTPYAPSSPYSASKASSDHLVRAWQRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I   ++G  + +YGDG  +RDWL+VEDH RALY V+ +
Sbjct: 183 IVTNCSNNYGPYHFPEKLIPLMILNALDGKPLPVYGDGMQIRDWLFVEDHARALYQVVTE 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NE+ NI++V  I  LL+ L+P+  +    + +LI F++DRPGHD RYA
Sbjct: 243 GVVGETYNIGGHNEKANIEVVKTICALLEELVPEKPAGVARYEDLITFVQDRPGHDVRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           +D++KI+ ++GW P E  ESGL KTV WYLDN  WW+
Sbjct: 303 VDAAKIRRDLGWLPLETFESGLRKTVQWYLDNKTWWQ 339


>gi|34863495|gb|AAQ82925.1| dTDP-glucose 4,6-dehydratase [Raoultella terrigena]
          Length = 354

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 190/338 (56%), Positives = 248/338 (73%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ + +  V V+D LTYAGNL SL  ++Q+  +SF + DI 
Sbjct: 1   MKILVTGGAGFIGSAVVRHIIENTQDDVRVVDCLTYAGNLESLASVAQNERYSFSRTDIT 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D + I     EFQPD +++ AAESHVDRSI G   FI TN+IGTF LLE  R ++  L++
Sbjct: 61  DAQGIAGQFSEFQPDIVMHLAAESHVDRSIDGPAAFIQTNLIGTFTLLEAARHYYQSLNE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K +FRF  ISTDEVYG L     LF+E+  Y PSSPYSA+KA SD+LV AW  TYG+P
Sbjct: 121 AQKQRFRFHHISTDEVYGDLHGTDDLFTEETSYAPSSPYSASKAGSDHLVRAWNRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+++NCSNNYGPYHFPEKLIPL I   + G  + +YG+G+ VRDWLYVEDH RALY V  
Sbjct: 181 VVVTNCSNNYGPYHFPEKLIPLTILNALAGKPLPVYGNGEQVRDWLYVEDHARALYKVAT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALI---PKSYSH-TELIRFIEDRPGHDRRY 294
           +G  GE YNIGG+NERKNID+V  I  +LD ++   P + SH  +LI F++DRPGHD RY
Sbjct: 241 EGHSGETYNIGGHNERKNIDVVRTICAILDKVVEQKPGNISHFADLITFVKDRPGHDLRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID++KI+ ++GW P+E  ESG+ KTV WYL+N  WW+
Sbjct: 301 AIDAAKIQRDLGWVPEETFESGIEKTVHWYLNNQTWWQ 338


>gi|120598285|ref|YP_962859.1| dTDP-glucose 4,6 dehydratase [Shewanella sp. W3-18-1]
 gi|120558378|gb|ABM24305.1| dTDP-glucose 4,6-dehydratase [Shewanella sp. W3-18-1]
          Length = 359

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 184/343 (53%), Positives = 249/343 (72%), Gaps = 13/343 (3%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL  ++ +  ++F +VDIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIIGNTQDSVVNVDKLTYAGNLESLTSVANNARYTFEKVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     + QPDA+++ AAESHVDRSI G  +FI TNI+GT++LLE  R +W  L  
Sbjct: 61  DRAELDRVFLQHQPDAVMHLAAESHVDRSITGPSDFIQTNIVGTYMLLEAARNYWMQLDT 120

Query: 121 DKKDQFRFLQISTDEVYGSL-------------DKGLFSEDMPYNPSSPYSATKASSDYL 167
           ++K  FRF  ISTDEVYG L             +  LF+E+ PY PSSPYSA+KASSD+L
Sbjct: 121 ERKSAFRFHHISTDEVYGDLPHPDEQEGQVVNQELPLFTENTPYAPSSPYSASKASSDHL 180

Query: 168 VLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVE 227
           V AW  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVE
Sbjct: 181 VRAWLRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKLLPIYGKGDQIRDWLYVE 240

Query: 228 DHVRALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDR 287
           DH RALY V+ +G+IGE YNIGG+NE++N+++V  I  +LD+L+PK+  + E I ++ DR
Sbjct: 241 DHARALYKVVTEGKIGETYNIGGHNEKQNLEVVQTICSILDSLVPKATPYAEQITYVTDR 300

Query: 288 PGHDRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           PGHDRRYAID+ K+ +++ W PQE  E+GL KT+ WYL N  W
Sbjct: 301 PGHDRRYAIDARKMSNDLNWRPQETFETGLRKTIEWYLANQEW 343


>gi|325133152|gb|EGC55823.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis M6190]
          Length = 360

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 186/336 (55%), Positives = 248/336 (73%), Gaps = 6/336 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL +I+ +  ++F QVDICDR
Sbjct: 9   ILVTGGAGFIGSAVVRHIIRNTQDSVVNLDKLTYAGNLESLTDIADNPRYAFEQVDICDR 68

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             +     + +PDA+++ AAESHVDRSI  A EFI TNI+GTF LLE  R +W  +  ++
Sbjct: 69  AELDRVFAQHRPDAVMHLAAESHVDRSIGSAGEFIQTNIVGTFNLLEAARAYWQQMPSEQ 128

Query: 123 KDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
            + FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P +
Sbjct: 129 HEAFRFHHISTDEVYGDLGGTDDLFTETTPYAPSSPYSASKASSDHLVRAWQRTYGLPTI 188

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           ++NCSNNYGPYHFPEKLIPL I   ++G  + +YGDG  +RDWL+VEDH RALY V+ +G
Sbjct: 189 VTNCSNNYGPYHFPEKLIPLMILNALDGKPLPVYGDGMQIRDWLFVEDHARALYQVVTEG 248

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYAI 296
            +GE YNIGG+NE+ NI++V  I  LL+ L+P+  +    + +LI F++DRPGHD RYA+
Sbjct: 249 VVGETYNIGGHNEKANIEVVKTICALLEELVPEKPAGVARYEDLITFVQDRPGHDVRYAV 308

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           D++KI+ ++GW P E  ESGL KTV WYLDN  WW+
Sbjct: 309 DAAKIRRDLGWLPLETFESGLRKTVQWYLDNKTWWQ 344


>gi|183600264|ref|ZP_02961757.1| hypothetical protein PROSTU_03818 [Providencia stuartii ATCC 25827]
 gi|188020054|gb|EDU58094.1| hypothetical protein PROSTU_03818 [Providencia stuartii ATCC 25827]
          Length = 355

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 189/337 (56%), Positives = 241/337 (71%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R+++TGGAGFIGSA+ R+++ +     +V+D LTYAGNL SL E+S S+ ++F QV+IC 
Sbjct: 3   RILITGGAGFIGSAVVRHIIENTNDSAVVVDCLTYAGNLESLSEVSNSDRYAFEQVNICH 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     ++QPDA+++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W  L   
Sbjct: 63  RAELDRVFAKYQPDAVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARHYWMGLDAA 122

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK QFRF  ISTDEVYG L+   G F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKAQFRFHHISTDEVYGDLEGPDGFFTETTPYAPSSPYSASKASSDHLVRAWQRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I   + G  + +YG G+ +RDWL+VEDH RALYLV   
Sbjct: 183 MITNCSNNYGPYHFPEKLIPLIIINALAGKPLPVYGKGEQIRDWLFVEDHARALYLVATT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
            + G  YNIGG+NER+NID+V  I  LL+ L P+       + +LI ++ DRPGHD RYA
Sbjct: 243 AQPGTTYNIGGHNERRNIDVVETICELLEELHPQKPEGVAHYRDLITYVTDRPGHDMRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+ KI  E+GW PQE  ESG+ KTV WYL+N  WWR
Sbjct: 303 IDADKIARELGWTPQETFESGIRKTVQWYLNNETWWR 339


>gi|115279709|gb|ABI85325.1| dTDP-D-glucose-4,6-dehydratase [Vibrio cholerae]
          Length = 354

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 188/337 (55%), Positives = 246/337 (72%), Gaps = 6/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++   +  V+ +DKLTYAGNL SL  ++ S  ++F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHVIQSTQDSVVNLDKLTYAGNLESLASVAGSERYAFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     E QPD +++ AAESHVDRSI G   FI TNIIGT+ LLE  R +WS L  
Sbjct: 61  DRAELDRVFAEHQPDVVMHLAAESHVDRSIDGPAAFIETNIIGTYTLLEAARHYWSHLES 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           ++K  FRF  ISTDEVYG L+    LF+E   Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 ERKAAFRFHHISTDEVYGDLEGTDDLFTETTAYEPSSPYSASKASSDHLVRAWLRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYGPYHFPEKLIPL I   +EG  + +YGDG  +RDWL+VEDH RALY V+ 
Sbjct: 181 TIVTNCSNNYGPYHFPEKLIPLMILNALEGKALPVYGDGMQIRDWLFVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G++GE YNIGG+NE+ NI++V  +  LL+ L+P   +    + +LI +++DRPGHD RY
Sbjct: 241 EGQVGETYNIGGHNEKANIEVVNTLCALLEELVPNKPAGVAHYADLITYVKDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           AID+SKI+ E+GW P+E  ESG+ KTV WYL +  WW
Sbjct: 301 AIDASKIERELGWKPEETFESGIRKTVEWYLHHREWW 337


>gi|90021776|ref|YP_527603.1| dTDP-glucose 4,6-dehydratase [Saccharophagus degradans 2-40]
 gi|89951376|gb|ABD81391.1| dTDP-glucose 4,6-dehydratase [Saccharophagus degradans 2-40]
          Length = 358

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 186/341 (54%), Positives = 245/341 (71%), Gaps = 10/341 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ RY++N  K  V+ +DKLTYAGNL SL  +S S+ ++F QVDIC
Sbjct: 1   MKIMVTGGAGFIGSAVIRYIINQTKHSVVNVDKLTYAGNLQSLVGVSSSSRYTFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   ++   K  +P+ +++ AAESHVDRSI G   F+ TNIIGT+ LLE+ R +W  L  
Sbjct: 61  DAVALKRIFKLHEPNIVMHLAAESHVDRSIDGPSVFMQTNIIGTYTLLEQARAYWLTLRG 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           + K QFRF  ISTDEV+G L          +  LF+E+  YNPSSPYSA+KASSD+LV A
Sbjct: 121 ENKTQFRFHHISTDEVFGDLPHPDFVRQSGELPLFTEETGYNPSSPYSASKASSDHLVKA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   + G  + +YG+G  +RDWLYVEDH 
Sbjct: 181 WAKTYGLPTVITNCSNNYGPYHFPEKLIPLVILNAVAGKPLPVYGEGNQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
            AL LV  +G++ E YNIGG+NE+KNI++V  I  +LD + P++  + + I F+ DRPGH
Sbjct: 241 EALILVATEGKVSETYNIGGHNEKKNIEVVHAICKILDEVKPQATKYADQITFVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           D RYAID++KI+ E+GW P+E  E+GL KTV WYL N  WW
Sbjct: 301 DMRYAIDATKIQKELGWQPKETFETGLRKTVLWYLQNEAWW 341


>gi|167856001|ref|ZP_02478747.1| dTDP-glucose 4,6-dehydratase [Haemophilus parasuis 29755]
 gi|167852883|gb|EDS24151.1| dTDP-glucose 4,6-dehydratase [Haemophilus parasuis 29755]
          Length = 351

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 188/342 (54%), Positives = 257/342 (75%), Gaps = 6/342 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           +++++TGGAGFIGSA+ RY++N+ +  V+ IDKLTYAGNL+SL+EIS S+ ++F Q+DIC
Sbjct: 3   IKILITGGAGFIGSAMIRYIINNTQDLVINIDKLTYAGNLSSLEEISNSSRYAFKQIDIC 62

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D+  +     E+QPD +++ AAESHVDRSI  ++ FI TNI GT+ LLE  R +W+ L +
Sbjct: 63  DKIALEQIFNEYQPDIVMHLAAESHVDRSIKNSEVFIKTNIWGTYTLLEVARKYWNDLPE 122

Query: 121 DKKDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           +KK  FRF  ISTDEVYG L   +  F+E MPY PS+PYSA+KA+SD+LV AW  TYG+P
Sbjct: 123 EKKSIFRFHHISTDEVYGDLGTSERQFTEIMPYAPSNPYSASKAASDHLVHAWRRTYGVP 182

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYGP+HFPEKLIPL I   IEG  + +YG+G  VRDWL+VEDHVRALY V+K
Sbjct: 183 TIVTNCSNNYGPFHFPEKLIPLIILNAIEGKKLPIYGNGLQVRDWLFVEDHVRALYKVIK 242

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRY 294
           +GR+GE YNIGG++ + N+++V+ I  +L+ L+P        + +LI ++ DR GHD RY
Sbjct: 243 EGRVGESYNIGGDSTKSNLEVVYAICEILEELLPHKPKGVQKYKDLISYVPDRLGHDTRY 302

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYK 336
           AIDS+KI+ E+ W PQE  ESG+ KTV WYL+N  WW+ + K
Sbjct: 303 AIDSTKIREELDWKPQETFESGIRKTVEWYLNNQKWWKSIRK 344


>gi|145298428|ref|YP_001141269.1| dTDP-glucose 4,6 dehydratase [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142851200|gb|ABO89521.1| dTDP-glucose-4,6-dehydratase [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 366

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 188/345 (54%), Positives = 247/345 (71%), Gaps = 15/345 (4%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ + K  V+ +DKLTYAGN  SL E++ S  ++F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIIRNTKDAVVNLDKLTYAGNRESLAEVAASERYAFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +R  +       QPDA+++ AAESHVDRSI G  +FI TNI+GT+ LLE  R +W+ L+ 
Sbjct: 61  NRSELDRVFALHQPDAVMHLAAESHVDRSITGPADFIETNIVGTYTLLEAARAYWNELND 120

Query: 121 DKKDQFRFLQISTDEVYG------SLDKG---------LFSEDMPYNPSSPYSATKASSD 165
            +K  FRF  ISTDEVYG       +  G         LF+E  PY PSSPYSA+KASSD
Sbjct: 121 TRKATFRFHHISTDEVYGDQPHPDEVSAGHPLWNKPLPLFTETTPYAPSSPYSASKASSD 180

Query: 166 YLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLY 225
           +LV AW  TYG+P L++NCSNNYGPYHFPEKLIPL I   ++G  + +YG G  +RDWLY
Sbjct: 181 HLVRAWRRTYGLPTLVTNCSNNYGPYHFPEKLIPLVILNALDGKPLPVYGKGDQIRDWLY 240

Query: 226 VEDHVRALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIE 285
           VEDH RALY V+  G +GE YNIGG+NE++N+D+V  +  LLD ++PK+ S+ + I ++ 
Sbjct: 241 VEDHARALYKVVTTGLVGETYNIGGHNEKQNLDVVHTVCDLLDEMVPKTGSYRDQITYVA 300

Query: 286 DRPGHDRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRPGHDRRYAID+SK+ +E+ W P+E  ESG+ KTV WYLDN  W
Sbjct: 301 DRPGHDRRYAIDASKMSAELDWQPEETFESGIRKTVQWYLDNQQW 345


>gi|29726014|gb|AAO88941.1| dTDP-D-glucose-4,6-dehydratase [Vibrio cholerae]
          Length = 354

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 187/337 (55%), Positives = 246/337 (72%), Gaps = 6/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++++TGGAGFIGSA+ R+++   +  V+ +DKLTYAGNL SL  ++ S  ++F Q+DIC
Sbjct: 1   MKILITGGAGFIGSAVVRHVIQSTQDSVVNLDKLTYAGNLESLASVANSERYAFEQIDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     E QPDA+++ AAESHVDRSI G   FI TNIIGT+ LLE  R +WS L  
Sbjct: 61  DRAELDRVFAEHQPDAVMHLAAESHVDRSIDGPAAFIETNIIGTYTLLEAARHYWSHLES 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           ++K  FRF  ISTDEVYG L+    LF+E   Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 ERKAAFRFHHISTDEVYGDLEGTDDLFTETTAYEPSSPYSASKASSDHLVRAWLRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYGPYHFPEKLIPL I   +EG  + +YGDG  +RDWL+VEDH RALY V+ 
Sbjct: 181 TIVTNCSNNYGPYHFPEKLIPLMILNALEGKALPVYGDGMQIRDWLFVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G +GE YNIGG+NE+ NI++V  +  LL+ L+P   +    + +LI +++DRPGHD RY
Sbjct: 241 EGLVGETYNIGGHNEKANIEVVNTLCALLEELVPNKPADVAHYADLITYVKDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           AID+SKI+ E+GW P+E  ESG+ KTV WYL +  WW
Sbjct: 301 AIDASKIERELGWKPEETFESGIRKTVEWYLHHREWW 337


>gi|212710193|ref|ZP_03318321.1| hypothetical protein PROVALCAL_01252 [Providencia alcalifaciens DSM
           30120]
 gi|212687192|gb|EEB46720.1| hypothetical protein PROVALCAL_01252 [Providencia alcalifaciens DSM
           30120]
          Length = 357

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 185/337 (54%), Positives = 243/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R+++TGGAGFIGSA+ R+++ + +   +V+D LTYAGNL SL  ++ S  ++F QV+ICD
Sbjct: 5   RILITGGAGFIGSAVVRHVIENTQDHAIVVDCLTYAGNLESLAGVANSERYAFEQVNICD 64

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E +PD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +WS L + 
Sbjct: 65  RTALDKVFAEHKPDVVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARHYWSALEES 124

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           +K  FRF  ISTDEVYG LD  +G F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 125 QKAAFRFHHISTDEVYGDLDGPEGFFTETTPYAPSSPYSASKASSDHLVRAWQRTYGLPT 184

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I   I G  + +YG G+ +RDWL+VEDH RAL+LV  +
Sbjct: 185 MITNCSNNYGPYHFPEKLIPLIILNAISGKPLPVYGKGEQIRDWLFVEDHARALHLVATQ 244

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
            + G  YNIGG+NER+NI +V  I  LL+ L P+       + +LI +++DRPGHD RYA
Sbjct: 245 AQPGSTYNIGGHNERRNIQVVETICELLEELHPQKPQGVTHYRDLITYVKDRPGHDMRYA 304

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+ KI+ E+GW P+E  ESG+ KTV WYL+N  WWR
Sbjct: 305 IDADKIQRELGWTPEETFESGIRKTVLWYLNNETWWR 341


>gi|330962125|gb|EGH62385.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. maculicola
           str. ES4326]
          Length = 360

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 194/338 (57%), Positives = 248/338 (73%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSAL R+L+ + +  VL  DKLTYAGNL SL+ I+ +  + F+Q DIC
Sbjct: 1   MRILVTGGAGFIGSALIRHLIYNTEHDVLNFDKLTYAGNLESLQSIATNTRYEFVQADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D+  + + L+ F P AI++ AAESHVDRSI G  EF+ TNI+GT+ LLE TR +W  L +
Sbjct: 61  DQAKVSAVLERFAPHAIMHLAAESHVDRSIDGPAEFVQTNIVGTYSLLEATRAYWLKLPE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            ++  FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KA+SD+LV AW  TYG+P
Sbjct: 121 AERQAFRFHHISTDEVYGDLHGVDDLFTETTPYAPSSPYSASKAASDHLVRAWHRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+++NCSNNYGP+HFPEKLIPL I   + G  + +YG+G  VRDWLYVEDH RAL  V+ 
Sbjct: 181 VVVTNCSNNYGPFHFPEKLIPLVILNALAGKPLPVYGNGLQVRDWLYVEDHARALLKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G +GE YNIGG+NE+KNID+V  I  LLD L P+  +    +++LI ++ DRPGHD+RY
Sbjct: 241 EGEVGETYNIGGHNEQKNIDVVRGICTLLDELTPQHPAGVQHYSDLITYVVDRPGHDQRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID+SKI   +GW P+E  ESGL KTV WYLDN  W R
Sbjct: 301 AIDASKIDKYLGWTPEETFESGLRKTVQWYLDNLDWCR 338


>gi|268592928|ref|ZP_06127149.1| dTDP-glucose 4,6-dehydratase [Providencia rettgeri DSM 1131]
 gi|291311721|gb|EFE52174.1| dTDP-glucose 4,6-dehydratase [Providencia rettgeri DSM 1131]
          Length = 357

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 186/336 (55%), Positives = 245/336 (72%), Gaps = 6/336 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R+++TGGAGFIGSA+ R+++ +     +V+D LTYAGNL SL  ++    ++F QV+ICD
Sbjct: 5   RILITGGAGFIGSAVVRHIIENTDDSAVVLDCLTYAGNLESLATVANDPRYAFEQVNICD 64

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  + +  +++QPDA+++ AAESHVDRSI G   FI TNI+GT+ LLE  R +WS L+ +
Sbjct: 65  RAALDAVFEKYQPDAVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARHYWSALNDE 124

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L+   G F+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 125 KKAAFRFHHISTDEVYGDLEGPDGFFTETTPYAPSSPYSASKASSDHLVRAWQRTYGLPT 184

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I   + G  + +YG G+ +RDWL+VEDH RAL+LV   
Sbjct: 185 MITNCSNNYGPYHFPEKLIPLIILNALAGKPLPVYGKGEQIRDWLFVEDHARALHLVATT 244

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
            + G  YNIGG+NER+NID+V  I  LL+ L P+       + +LI F++DRPGHD RYA
Sbjct: 245 AQPGTTYNIGGHNERRNIDVVETICELLEELHPQKPQGVAHYRDLITFVKDRPGHDMRYA 304

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           ID++KI+ E+GW PQE  ESG+ KTV WYL+N  WW
Sbjct: 305 IDAAKIERELGWTPQETFESGIRKTVQWYLNNETWW 340


>gi|330874357|gb|EGH08506.1| dTDP-glucose 4,6-dehydratase [Pseudomonas syringae pv. morsprunorum
           str. M302280PT]
          Length = 360

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 194/338 (57%), Positives = 247/338 (73%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSAL R+L+N+ +  VL  DKLTYAGNL SL+ I+ +  + F+Q DIC
Sbjct: 1   MRILVTGGAGFIGSALIRHLINNTEHDVLNFDKLTYAGNLESLQSIASNTRYEFVQADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D+  + + L+ F P AI++ AAESHVDRSI G  EF+ TNI+GT+ LLE  R +W  L  
Sbjct: 61  DQAKVSAVLERFAPQAIMHLAAESHVDRSIDGPAEFVQTNIVGTYSLLEAARAYWLKLPD 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            ++  FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KA+SD+LV AW  TYG+P
Sbjct: 121 VERQAFRFHHISTDEVYGDLHGVDDLFTETTPYAPSSPYSASKAASDHLVRAWHRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+++NCSNNYGP+HFPEKLIPL I   + G  + +YG+G  VRDWLYVEDH RAL  V+ 
Sbjct: 181 VVVTNCSNNYGPFHFPEKLIPLVILNALAGKPLPVYGNGLQVRDWLYVEDHARALLKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRY 294
           +G +GE YNIGG+NE+KNID+V  I  LLD L P+       +++LI ++ DRPGHD+RY
Sbjct: 241 EGDVGETYNIGGHNEQKNIDVVRGICSLLDELAPQHPDGVQHYSDLITYVVDRPGHDQRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID+SKI +E+GW P+E  ES L KTV WYLDN  W R
Sbjct: 301 AIDASKIDNELGWTPEETFESALRKTVQWYLDNLDWCR 338


>gi|254225683|ref|ZP_04919290.1| dTDP-glucose 4,6-dehydratase [Vibrio cholerae V51]
 gi|125621803|gb|EAZ50130.1| dTDP-glucose 4,6-dehydratase [Vibrio cholerae V51]
          Length = 357

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 187/340 (55%), Positives = 244/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ + +  V+ +D LTYAGNL SL  +  +  ++F QV+IC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIIQNTQDSVVNLDCLTYAGNLESLASVETNGRYAFEQVNIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     E +PDA+++ AAESHVDRSI G   FI TNI+GT+ LLE TR +W+ L  
Sbjct: 61  DRTELDRVFAEHKPDAVMHLAAESHVDRSITGPAAFIETNIVGTYTLLEATRQYWNKLDD 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
             K  FRF  ISTDEVYG L             LF E  PY PSSPYSA+KASSD+LV A
Sbjct: 121 KAKLSFRFHHISTDEVYGDLPHPDEVVEGSKLPLFLETTPYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWL+VEDH 
Sbjct: 181 WLRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKDLPIYGKGDQIRDWLFVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G++GE YNIGG+NE++N+++V  I  +LD L+PK+  + E I +++DRPGH
Sbjct: 241 RALYKVVTEGKVGETYNIGGHNEKQNLEVVQTICSILDTLVPKARPYAEQITYVQDRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAIDSSK++ E+GW P E  E+GL KTV WYLDN  W
Sbjct: 301 DRRYAIDSSKMQKELGWTPLETFETGLLKTVQWYLDNQQW 340


>gi|152971036|ref|YP_001336145.1| dTDP-glucose 4,6-dehydratase [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|150955885|gb|ABR77915.1| dTDP-glucose 4,6-dehydratase [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
          Length = 354

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 189/338 (55%), Positives = 246/338 (72%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ + + +V V+D LTYAGNL SL  ++ S  +SF Q DI 
Sbjct: 1   MKILVTGGAGFIGSAVVRHIIENTQDEVRVMDCLTYAGNLESLATVADSERYSFTQTDIT 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D + +     +F+PD +++ AAESHVDRSI G   FI TN+IGTF LLE  R ++S L  
Sbjct: 61  DAKSVSEQFSDFRPDIVMHLAAESHVDRSIDGPAAFIQTNLIGTFTLLEAARHYYSTLDA 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K  FRF  ISTDEVYG L     LF+E+ PY PSSPYSA+KA SD+LV AW  TYG+P
Sbjct: 121 AQKQAFRFHHISTDEVYGDLHGTDDLFTEETPYAPSSPYSASKAGSDHLVRAWNRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+++NCSNNYGPYHFPEKLIPL I   + G  + +YG+G+ +RDWLYVEDH RALY V  
Sbjct: 181 VVVTNCSNNYGPYHFPEKLIPLTILNALAGKPLPVYGNGEQIRDWLYVEDHARALYKVAT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALI---PKSYSH-TELIRFIEDRPGHDRRY 294
           +G  GE YNIGG+NERKNID+V  I  +LD ++   P + S   +LI F++DRPGHD RY
Sbjct: 241 EGESGETYNIGGHNERKNIDVVRTICAILDKVVEQKPGNISQFADLITFVKDRPGHDLRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID++KI+ ++GW PQE  ESG+ KTV WYL+N  WW+
Sbjct: 301 AIDAAKIQRDLGWVPQETFESGIEKTVHWYLNNQTWWQ 338


>gi|89073286|ref|ZP_01159816.1| dTDP-glucose 4,6-dehydratase [Photobacterium sp. SKA34]
 gi|89050996|gb|EAR56460.1| dTDP-glucose 4,6-dehydratase [Photobacterium sp. SKA34]
          Length = 359

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 190/337 (56%), Positives = 244/337 (72%), Gaps = 6/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL  +  +N + F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLLTVENNNRYEFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     E QPDA+++ AAESHVDRSI G   FI TNI+GT+ +LE TR +W  L Q
Sbjct: 61  DRSELDRVFAEHQPDAVMHLAAESHVDRSIDGPAAFIETNIVGTYTILEATRAYWGQLDQ 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K  FRF  ISTDEVYG L+    LF+E   Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 TRKTTFRFHHISTDEVYGDLEDTNDLFTETTSYEPSSPYSASKASSDHLVRAWLRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYG YHFPEKLIPL I   ++G ++ +YGDG  +RDWLYVEDH  ALY V+ 
Sbjct: 181 SIVTNCSNNYGLYHFPEKLIPLIILNALDGKNLPVYGDGAQIRDWLYVEDHASALYTVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRY 294
           KG +GE YNIGG+NE+ NI++V  I  LL+ L+P        + +LI  ++DRPGHD RY
Sbjct: 241 KGEVGETYNIGGHNEKANIEVVRTICSLLEELVPNKPDGVEQYQDLIIHVKDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           AID+SKI+ E+GW P E  ESG+ KTV WYL+N  WW
Sbjct: 301 AIDASKIERELGWKPAETFESGIRKTVEWYLNNKTWW 337


>gi|388933|gb|AAA63157.1| TDP-glucose-dehydratase [Neisseria meningitidis]
          Length = 360

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 186/336 (55%), Positives = 248/336 (73%), Gaps = 6/336 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL +I+ +  ++F QVDICDR
Sbjct: 9   ILVTGGAGFIGSAVVRHIIRNTQDSVVNLDKLTYAGNLESLTDIADNPRYAFEQVDICDR 68

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             +     + +PDA+++ AAESHVDRSI  A EFI TNI+GTF LLE  R +W  +  ++
Sbjct: 69  AELDRVFAQHRPDAVMHLAAESHVDRSIGSAGEFIQTNIVGTFNLLEAARAYWQQMPSEQ 128

Query: 123 KDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
            + FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P +
Sbjct: 129 HEAFRFHHISTDEVYGDLHGTDDLFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPTI 188

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           ++NCSNNYGPYHFPEKLIPL I   ++G  + +YGDG  +RDWL+VEDH RALY V+ +G
Sbjct: 189 VTNCSNNYGPYHFPEKLIPLMILNALDGKPLPVYGDGMQIRDWLFVEDHARALYQVVTEG 248

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYAI 296
            +GE YNIGG+NE+ NI++V  I  LL+ L+P+  +    + +LI F++DRPGHD RYA+
Sbjct: 249 VVGETYNIGGHNEKANIEVVKTICTLLEELVPEKPAGVARYEDLITFVQDRPGHDVRYAV 308

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           D++KI+ ++GW P E  ESGL KTV WYLDN  WW+
Sbjct: 309 DAAKIRRDLGWLPLETFESGLRKTVQWYLDNKTWWQ 344


>gi|159154694|gb|ABW93679.1| dTDP-D-glucose 4,6-hydratase [Neisseria meningitidis]
 gi|254673658|emb|CBA09233.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis alpha275]
          Length = 355

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 186/337 (55%), Positives = 249/337 (73%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           +++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL +I+ +  ++F QVDICD
Sbjct: 3   KILVTGGAGFIGSAVVRHIIRNTQDSVVNLDKLTYAGNLESLTDIADNPRYAFEQVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     + +PDA+++ AAESHVDRSI  A EFI TNI+GTF LLE  R +W  +  +
Sbjct: 63  RAELDRVFAQHRPDAVMHLAAESHVDRSIGSAGEFIQTNIVGTFNLLEAARAYWQQMPSE 122

Query: 122 KKDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           + + FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 QHEAFRFHHISTDEVYGDLGGTDDLFTETAPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I   ++G  + +YGDG  +RDWL+VEDH RALY V+ +
Sbjct: 183 IVTNCSNNYGPYHFPEKLIPLMILNALDGKPLPVYGDGMQIRDWLFVEDHARALYQVVTE 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NE+ NI++V  I  LL+ L+P+  +    + +LI F++DRPGHD RYA
Sbjct: 243 GVVGETYNIGGHNEKANIEVVKTICTLLEELVPEKPAGVARYEDLITFVQDRPGHDVRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           +D++KI+ ++GW P E  ESGL KTV WYLDN  WW+
Sbjct: 303 VDAAKIRRDLGWLPLETFESGLRKTVQWYLDNKTWWQ 339


>gi|294140251|ref|YP_003556229.1| dTDP-glucose 4,6-dehydratase [Shewanella violacea DSS12]
 gi|293326720|dbj|BAJ01451.1| dTDP-glucose 4,6-dehydratase [Shewanella violacea DSS12]
          Length = 348

 Score =  398 bits (1023), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 187/332 (56%), Positives = 244/332 (73%), Gaps = 2/332 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ +    V+ +DKLTYAGNL SL E+S S  + F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVIRHIIKNTNDSVINLDKLTYAGNLESLLEVSNSERYVFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +R  +     E +PDA+++ AAESHVDRSI G   FI TNI+GT+ LLE TR +W  L +
Sbjct: 61  NRTELERVFSEHKPDALMHLAAESHVDRSIDGPAAFIETNIVGTYQLLEATRQYWLTLDE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K  FRF  ISTDEVYG L+    LF+E+  Y PSSPYSA+KASSD+LV  W  TYG+P
Sbjct: 121 QQKSAFRFHHISTDEVYGDLEGTTDLFTENTSYEPSSPYSASKASSDHLVRTWLRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G+ +RDWLYVEDH RALY V+ 
Sbjct: 181 TIITNCSNNYGPYHFPEKLIPLVILNALEGKLLPIYGKGEQIRDWLYVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDS 298
           +G IGE YN+GG+NE++NI++V  I  +L+ L+P+   + E I F++DRPGHD RYAID+
Sbjct: 241 EGNIGETYNVGGHNEKRNIEVVETICDILNELVPQQTDYKEQITFVKDRPGHDMRYAIDA 300

Query: 299 SKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           SKI+ E+ W P E  E+GL KTV WYL+N  W
Sbjct: 301 SKIEKELDWTPIETFETGLRKTVEWYLENKTW 332


>gi|253690367|ref|YP_003019557.1| dTDP-glucose 4,6-dehydratase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251756945|gb|ACT15021.1| dTDP-glucose 4,6-dehydratase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 355

 Score =  398 bits (1023), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 189/339 (55%), Positives = 243/339 (71%), Gaps = 6/339 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R+++TGGAGFIGSAL RY++ + +  V+++DKLTYAGNL+SL  ++ S  F+F QVDICD
Sbjct: 3   RILITGGAGFIGSALVRYILTETQDSVVIVDKLTYAGNLSSLAPVADSERFAFEQVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +    K +QP  +++ AAESHVDRSI G   FI TNI+GT+ +LE  R +W  L+  
Sbjct: 63  RAELDRVFKTYQPALVMHLAAESHVDRSIDGPAAFIETNIVGTYTMLEAARHYWQSLADA 122

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            K  FRF  ISTDEV+G L     LF+E   Y PSSPYSA+KASSD+LV AW  TYG P 
Sbjct: 123 DKCAFRFHHISTDEVFGDLHGTDDLFTETTSYAPSSPYSASKASSDHLVRAWLRTYGFPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I   + G  + +YGDG  +RDWL+VEDH RALY V+ +
Sbjct: 183 IITNCSNNYGPYHFPEKLIPLVILNAVAGKPLPVYGDGAQIRDWLFVEDHARALYKVVTE 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTE----LIRFIEDRPGHDRRYA 295
           G IGE YNIGG+NERKNI++V  I  LL+ L P   +  E    LI +++DRPGHD RYA
Sbjct: 243 GEIGETYNIGGHNERKNIEVVQTICALLEELAPNKPAGVEHYRDLITYVKDRPGHDMRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           ID+ KI+ E+GW P+E  E+G+ KTV WYL+N  WWR +
Sbjct: 303 IDAGKIERELGWRPEETFETGMRKTVNWYLNNEKWWRSV 341


>gi|323960872|gb|EGB56492.1| dTDP-glucose 4,6-dehydratase [Escherichia coli H489]
          Length = 361

 Score =  398 bits (1023), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 188/340 (55%), Positives = 242/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R++++D    V+ +DKLTYAGNL SL  +S S  +SF QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIISDTGDSVINLDKLTYAGNLESLASVSSSERYSFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +R  +       QPDA+++ AAESHVDRSI G  +FI TNI+GT+ LLE  R +WS L +
Sbjct: 61  NRAELDRVFALHQPDAVMHLAAESHVDRSITGPADFIETNIVGTYTLLEAARAYWSSLGE 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
             K  FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 LSKAAFRFHHISTDEVYGDLPHPDEVASGEALPLFTETTSYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   ++G  + +YG G  +RDWLYVEDH 
Sbjct: 181 WYRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALDGKPLPVYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+  G +GE YNIGG+NE++N+D+V  I  LLD ++PK+ S+ + I ++ DRPGH
Sbjct: 241 RALYKVVTTGLVGETYNIGGHNEKQNLDVVHTICDLLDEMVPKAGSYRDQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ K+ + + W P+E  ESG+ KTV WYLDN  W
Sbjct: 301 DRRYAIDACKMSAALDWQPEETFESGIRKTVQWYLDNQQW 340


>gi|316935621|ref|YP_004110603.1| dTDP-glucose 4,6-dehydratase [Rhodopseudomonas palustris DX-1]
 gi|315603335|gb|ADU45870.1| dTDP-glucose 4,6-dehydratase [Rhodopseudomonas palustris DX-1]
          Length = 343

 Score =  398 bits (1023), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 190/335 (56%), Positives = 247/335 (73%), Gaps = 3/335 (0%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           + VTGGAGFIGSA+CRYL+     QV+ +DKLTYAGNL SLK I  +  + F+Q DI DR
Sbjct: 4   VFVTGGAGFIGSAVCRYLIERTDAQVVNLDKLTYAGNLQSLKTIEDNPRYRFVQGDIGDR 63

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
           E + + L++ +P  +++ AAESHVDRSI GA +FI TNI+GTF LLE  R +   LS + 
Sbjct: 64  ELVSALLRDARPTHVMHLAAESHVDRSIRGAGDFIDTNIVGTFRLLEAARAYRDELSGEA 123

Query: 123 KDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLL 181
           +DQFRFL +STDEVYG+L D G F E  PY P+SPYSA+KA+SD+LV AW HTYG P L+
Sbjct: 124 RDQFRFLHVSTDEVYGTLGDTGYFVETTPYAPNSPYSASKAASDHLVRAWFHTYGFPALI 183

Query: 182 SNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKGR 241
           SNCSNNYGPY +PEKL+   ITR +    + ++G G N+RDWLYVEDH +AL+LV+ +GR
Sbjct: 184 SNCSNNYGPYQYPEKLVGRTITRALARQSLPVFGQGLNIRDWLYVEDHAQALWLVVSRGR 243

Query: 242 IGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS--HTELIRFIEDRPGHDRRYAIDSS 299
           +GE+YNIGG NER+NID+V  I  LLDA    + +  +  LI F+ DR GHD RYAID++
Sbjct: 244 LGEQYNIGGRNERRNIDLVKRICTLLDAKTSDAPAGGYASLIEFVVDRAGHDFRYAIDAT 303

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           KI++E+GW  + + +SG+  TV WYL N WWW+PL
Sbjct: 304 KIETELGWKAEHDFDSGIEATVDWYLANEWWWKPL 338


>gi|254671512|emb|CBA09102.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis alpha153]
          Length = 360

 Score =  398 bits (1023), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 186/336 (55%), Positives = 248/336 (73%), Gaps = 6/336 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL +I+ +  ++F QVDICDR
Sbjct: 9   ILVTGGAGFIGSAVVRHIIRNTQDSVVNLDKLTYAGNLESLTDIADNPRYAFEQVDICDR 68

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             +     + +PDA+++ AAESHVDRSI  A EFI TNI+GTF LLE  R +W  +  ++
Sbjct: 69  AELDRVFAQHRPDAVMHLAAESHVDRSIGSAGEFIQTNIVGTFNLLEAARAYWQQMPSEQ 128

Query: 123 KDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
            + FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P +
Sbjct: 129 HEAFRFHHISTDEVYGDLGGTDDLFTETAPYAPSSPYSASKASSDHLVRAWLRTYGLPTI 188

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           ++NCSNNYGPYHFPEKLIPL I   ++G  + +YGDG  +RDWL+VEDH RALY V+ +G
Sbjct: 189 VTNCSNNYGPYHFPEKLIPLMILNALDGKPLPVYGDGMQIRDWLFVEDHARALYQVVTEG 248

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYAI 296
            +GE YNIGG+NE+ NI++V  I  LL+ L+P+  +    + +LI F++DRPGHD RYA+
Sbjct: 249 VVGETYNIGGHNEKANIEVVKTICTLLEELVPEKPAGVARYEDLITFVQDRPGHDVRYAV 308

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           D++KI+ ++GW P E  ESGL KTV WYLDN  WW+
Sbjct: 309 DAAKIRRDLGWLPLETFESGLRKTVQWYLDNKTWWQ 344


>gi|295148946|gb|ADF80946.1| dTDP-glucose 4,6-dehydratase [Vibrio cholerae]
          Length = 354

 Score =  398 bits (1023), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 187/337 (55%), Positives = 246/337 (72%), Gaps = 6/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL  ++ S  ++F Q+DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHVIQNTQDSVVNLDKLTYAGNLESLASVAGSERYAFEQIDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     E QPDA+++ AAESHVDRSI G   FI TNIIGT+ LLE  R +W  L  
Sbjct: 61  DRADLDRVFAEHQPDAVMHLAAESHVDRSIDGPAAFIETNIIGTYTLLEAARHYWKHLES 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           ++K  FRF  ISTDEVYG L+    LF+E   Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 ERKAAFRFHHISTDEVYGDLEGTDDLFTETTAYEPSSPYSASKASSDHLVRAWLRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYGPYHFPEKLIPL I   +EG  + +YGDG  +RDWL+VEDH RALY V+ 
Sbjct: 181 TIVTNCSNNYGPYHFPEKLIPLMILNALEGKALPVYGDGMQIRDWLFVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G +GE YNIGG+NE+ NI++V  +  LL+ L+P   +    + +LI +++DRPGHD RY
Sbjct: 241 EGLVGETYNIGGHNEKANIEVVKTLCALLEELVPNKPAGIAHYADLITYVKDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           AID+SKI+ E+GW P+E  ESG+ KTV WYL +  WW
Sbjct: 301 AIDASKIERELGWKPEETFESGIRKTVEWYLHHREWW 337


>gi|262192436|ref|ZP_06050588.1| dTDP-glucose 4,6-dehydratase [Vibrio cholerae CT 5369-93]
 gi|262031700|gb|EEY50286.1| dTDP-glucose 4,6-dehydratase [Vibrio cholerae CT 5369-93]
          Length = 354

 Score =  398 bits (1023), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 188/337 (55%), Positives = 246/337 (72%), Gaps = 6/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ +    V+ +DKLTYAGNL SL  ++ S  ++F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHVIQNTPDSVVNLDKLTYAGNLESLASVANSERYAFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     E QPD +++ AAESHVDRSI G   FI TNIIGT+ LLE  R +WS L  
Sbjct: 61  DRAELDRVFAEHQPDVVMHLAAESHVDRSIDGPAAFIETNIIGTYTLLEAARHYWSQLES 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           ++K  FRF  ISTDEVYG L+    LF+E   Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 ERKAVFRFHHISTDEVYGDLEGTDDLFTETTAYEPSSPYSASKASSDHLVRAWLRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYGPYHFPEKLIPL I   +EG  + +YGDG  +RDWL+VEDH RALY V+ 
Sbjct: 181 TIVTNCSNNYGPYHFPEKLIPLMILNALEGKALPVYGDGMQIRDWLFVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G++GE YNIGG+NE+ NI++V  +  LL+ L+P   +    + +LI +++DRPGHD RY
Sbjct: 241 EGQVGETYNIGGHNEKANIEVVNTLCALLEELVPNKPAGIAHYADLITYVKDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           AID+SKI+ E+GW P+E  ESG+ KTV WYL +  WW
Sbjct: 301 AIDASKIERELGWKPEETFESGIRKTVEWYLHHREWW 337


>gi|325135198|gb|EGC57823.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis M13399]
          Length = 355

 Score =  398 bits (1022), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 188/337 (55%), Positives = 248/337 (73%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           +++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL +I+ +  ++F QVDICD
Sbjct: 3   KILVTGGAGFIGSAVVRHIIRNTQDSVVNLDKLTYAGNLESLTDIADNPRYAFEQVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     + QPDA+++ AAESHVDRSI  A EFI TNI+GTF LLE  R +W  +  +
Sbjct: 63  RAELDRIFAQHQPDAVMHLAAESHVDRSIDSAGEFIQTNIVGTFNLLEAARAYWQQMPSE 122

Query: 122 KKDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           + + FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 QHEAFRFHHISTDEVYGDLGGTDDLFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I   ++G  + +YGDG  +RDWL+VEDH RALY V+ +
Sbjct: 183 IVTNCSNNYGPYHFPEKLIPLMILNALDGKPLPVYGDGMQIRDWLFVEDHARALYQVVTE 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NE+ NI++V  I  LL+ L P+  +    + +LI +++DRPGHD RYA
Sbjct: 243 GVVGETYNIGGHNEKANIEVVKTICALLEELAPEKPAGVARYEDLITYVKDRPGHDVRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID++KI  E+GW PQE  ESG+ KTV WYLDN  WW+
Sbjct: 303 IDAAKIGRELGWQPQETFESGIRKTVEWYLDNKTWWQ 339


>gi|259906870|ref|YP_002647226.1| DTDP-glucose 4,6-dehydratase [Erwinia pyrifoliae Ep1/96]
 gi|224962492|emb|CAX53947.1| DTDP-glucose 4,6-dehydratase [Erwinia pyrifoliae Ep1/96]
 gi|283476662|emb|CAY72490.1| dTDP-glucose 4,6-dehydratase [Erwinia pyrifoliae DSM 12163]
          Length = 355

 Score =  398 bits (1022), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 185/337 (54%), Positives = 248/337 (73%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R++VTGGAGFIGSA+ R++++    +VLV+DKL+YAGNL SL  ++++  F+F +VDICD
Sbjct: 3   RILVTGGAGFIGSAVVRHILSSTPDRVLVLDKLSYAGNLASLAPVAENPRFAFSKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +  A+  FQP  I++ AAESHVDRSI G   F+ TNI+GT+++LE  R +W+ L   
Sbjct: 63  RAALDGAIAAFQPQLIMHLAAESHVDRSIDGPLAFVETNIVGTYMMLEAARHYWTSLPAP 122

Query: 122 KKDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           ++  F F  ISTDEV+G L  D   F+E  PY PSSPYSATKASSD+LV AW  TYG+PV
Sbjct: 123 ERSAFIFHHISTDEVFGDLENDTDFFTETTPYAPSSPYSATKASSDHLVRAWHRTYGLPV 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I   + G  + +YGDG  +RDWLYV+DH RALY V+  
Sbjct: 183 IVTNCSNNYGPYHFPEKLIPLMIINALAGKPLPVYGDGGQIRDWLYVDDHARALYQVVTA 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG++ER+NID+V  +  LL+ L P+  +    + +LI  + DRPGHDRRYA
Sbjct: 243 GKVGETYNIGGHSERRNIDVVETLCALLEELAPEKPAGLGHYRDLITRVADRPGHDRRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+ KI+ E+GW PQE  ESG+ KTV W+++N  WW+
Sbjct: 303 IDAGKIERELGWRPQETFESGMRKTVSWFINNPAWWQ 339


>gi|260877871|ref|ZP_05890226.1| dTDP-glucose 4,6-dehydratase [Vibrio parahaemolyticus AN-5034]
 gi|193787947|dbj|BAG50456.1| dTDP-D-glucose 4,6-dehydratase [Vibrio parahaemolyticus]
 gi|308090071|gb|EFO39766.1| dTDP-glucose 4,6-dehydratase [Vibrio parahaemolyticus AN-5034]
          Length = 354

 Score =  398 bits (1022), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 190/338 (56%), Positives = 245/338 (72%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ D +  V+ +DKLTYAGNL SL +++ S+ + F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIIRDTQDSVVNLDKLTYAGNLESLVDVADSDRYYFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     E QPD +++ AAESHVDRSI G   FI TN++GT+ LLE  R +WS L +
Sbjct: 61  DRTELDRVFSEHQPDMVMHLAAESHVDRSIDGPAAFIETNVMGTYHLLEAARQYWSSLEE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
             K  FRF  ISTDEVYG L+    LF+E   Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 ANKSAFRFHHISTDEVYGDLEGTDDLFTETTSYAPSSPYSASKASSDHLVRAWQRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            L++NCSNNYGPYHFPEKLIPL I   ++G  + +YGDG  +RDWL+VEDH RALY V+ 
Sbjct: 181 TLVTNCSNNYGPYHFPEKLIPLMILNALDGKPLPVYGDGMQIRDWLFVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRY 294
           +G IGE YNIGG+NE+ NI++V  I  LL+ L P       S+  LI +++DRPGHD RY
Sbjct: 241 EGEIGETYNIGGHNEKANIEVVKTICALLEELRPDKPAGVESYESLITYVKDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID++KI  E+GW P+E  ESG+ KTV WYL+N  WW+
Sbjct: 301 AIDATKIAQELGWTPEETFESGIRKTVEWYLNNPQWWQ 338


>gi|325135187|gb|EGC57812.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis M13399]
          Length = 360

 Score =  398 bits (1022), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 188/336 (55%), Positives = 247/336 (73%), Gaps = 6/336 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL +I+ +  ++F QVDICDR
Sbjct: 9   ILVTGGAGFIGSAVVRHIIQNTQDSVVNLDKLTYAGNLESLTDIADNPRYAFEQVDICDR 68

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             +     + QPDA+++ AAESHVDRSI  A EFI TNI+GTF LLE  R +W  +  ++
Sbjct: 69  AELDRIFAQHQPDAVMHLAAESHVDRSIDSAGEFIQTNIVGTFNLLEAARAYWQQMPSEQ 128

Query: 123 KDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
            + FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P +
Sbjct: 129 HEAFRFHHISTDEVYGDLGGTDDLFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPTI 188

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           ++NCSNNYGPYHFPEKLIPL I   ++G  + +YGDG  +RDWL+VEDH RALY V+ +G
Sbjct: 189 VTNCSNNYGPYHFPEKLIPLMILNALDGKPLPVYGDGMQIRDWLFVEDHARALYQVVTEG 248

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYAI 296
            +GE YNIGG+NE+ NI++V  I  LL+ L P+  +    + +LI +++DRPGHD RYAI
Sbjct: 249 VVGETYNIGGHNEKANIEVVKTICALLEELAPEKPAGVARYEDLITYVKDRPGHDVRYAI 308

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           D++KI  E+GW PQE  ESG+ KTV WYLDN  WW+
Sbjct: 309 DAAKIGRELGWQPQETFESGIRKTVEWYLDNKTWWQ 344


>gi|313747656|gb|ADR74235.1| RmlB [Escherichia coli]
          Length = 356

 Score =  398 bits (1022), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 190/342 (55%), Positives = 243/342 (71%), Gaps = 11/342 (3%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +       QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DTAAMARIFALHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNTEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G +GE YNIGG+NE KN+D+V+ I  LLD ++PK  S+ + I ++ DR GH
Sbjct: 241 RALYTVVTQGIVGETYNIGGHNE-KNLDVVYTICDLLDEILPKEGSYRDQITYVTDRLGH 299

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           DRRYAI++ KI   +GW PQE  ESG+ KTV WYL+N  W R
Sbjct: 300 DRRYAINADKISQTLGWKPQETFESGIRKTVEWYLNNTNWCR 341


>gi|298370181|ref|ZP_06981497.1| dTDP-glucose 4,6-dehydratase [Neisseria sp. oral taxon 014 str.
           F0314]
 gi|298281641|gb|EFI23130.1| dTDP-glucose 4,6-dehydratase [Neisseria sp. oral taxon 014 str.
           F0314]
          Length = 355

 Score =  398 bits (1022), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 187/337 (55%), Positives = 249/337 (73%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           +++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL +++ +  ++F QVDICD
Sbjct: 3   KILVTGGAGFIGSAVVRHIIKNTQDSVVNLDKLTYAGNLESLTDVADNPRYAFEQVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     + +PDA+++ AAESHVDRSI  A EFI TNI+GTF LLE  R +W  +  +
Sbjct: 63  RAELDRVFAQHRPDAVMHLAAESHVDRSIDSAGEFIQTNIVGTFNLLEAARAYWQRMPSE 122

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           K++ FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KREAFRFHHISTDEVYGDLHGTDDLFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I   ++G  + +YGDG  +RDWL+VEDH RALY V+ +
Sbjct: 183 IVTNCSNNYGPYHFPEKLIPLMILNALDGKPLPVYGDGMQIRDWLFVEDHARALYQVVTE 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
           G  GE YNIGG+NE+ NI++V  I  LL+ L+P+  +    + +LI F++DRPGHD RYA
Sbjct: 243 GVGGETYNIGGHNEKANIEVVKTICALLEELVPEKPAGVARYEDLITFVQDRPGHDVRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID++KI  E+GW PQE  ESG+ KTV WYL+N  WW+
Sbjct: 303 IDAAKIGRELGWKPQETFESGIRKTVQWYLNNKTWWQ 339


>gi|308125432|ref|ZP_05775277.2| dTDP-glucose 4,6-dehydratase [Vibrio parahaemolyticus K5030]
 gi|308111322|gb|EFO48862.1| dTDP-glucose 4,6-dehydratase [Vibrio parahaemolyticus K5030]
          Length = 358

 Score =  398 bits (1022), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 186/338 (55%), Positives = 243/338 (71%), Gaps = 10/338 (2%)

Query: 5   VTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDREC 64
           +TGGAGFIGSAL R+++ +    V+ +D LTYAGNL SL  + QS  + F QV+ICDR  
Sbjct: 1   MTGGAGFIGSALVRHIIKNTSDSVVNVDCLTYAGNLESLGSVIQSERYVFEQVNICDRAE 60

Query: 65  IRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKD 124
           +    +  +PDA+++ AAESHVDRSI G   FI TN++GT+ +LE TR +WS L  + K 
Sbjct: 61  LNRVFEAHKPDAVMHLAAESHVDRSITGPAAFIETNVVGTYTMLEATREYWSKLDDNAKA 120

Query: 125 QFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHT 174
            FRF  ISTDEVYG L          +  +F E  PY PSSPYSA+KASSD+LV AW  T
Sbjct: 121 AFRFHHISTDEVYGDLPHPDEVSDGKELPMFLETTPYEPSSPYSASKASSDHLVRAWLRT 180

Query: 175 YGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALY 234
           YG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWL+VEDH RALY
Sbjct: 181 YGLPTMVTNCSNNYGPYHFPEKLIPLVILNALEGKDLPIYGKGDQIRDWLFVEDHARALY 240

Query: 235 LVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRY 294
            V+ +G++GE YNIGG+NE+KNI++V  I  +LD L+PK  +++E I +++DRPGHDRRY
Sbjct: 241 KVITEGKVGETYNIGGHNEKKNIEVVNTICEILDTLVPKQTAYSEQITYVQDRPGHDRRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AIDSSK++ E+ W P+E  E+GL KTV WYLDN  W +
Sbjct: 301 AIDSSKMQRELNWTPEETFETGLRKTVQWYLDNPTWCK 338


>gi|288549835|ref|ZP_05968346.2| dTDP-glucose 4,6-dehydratase [Enterobacter cancerogenus ATCC 35316]
 gi|288317582|gb|EFC56520.1| dTDP-glucose 4,6-dehydratase [Enterobacter cancerogenus ATCC 35316]
          Length = 378

 Score =  398 bits (1022), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 188/345 (54%), Positives = 247/345 (71%), Gaps = 11/345 (3%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           ++++VTGGAGFIGSA+ R+++N+ + +V+ +DKLTYAGNL SL ++S    ++F   DIC
Sbjct: 22  VKILVTGGAGFIGSAVVRHIINNTQDEVVNVDKLTYAGNLESLSDVSGHARYAFEHADIC 81

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D+  +     E +PDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L +
Sbjct: 82  DKTAMDRIFAEHKPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARAYWSKLDE 141

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
             K+ FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 142 AAKNAFRFHHISTDEVYGDLPHPDEHPSSAELPLFTETTAYAPSSPYSASKASSDHLVRA 201

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG P +++NCSNNYGPYHFPEKLIPL I   ++G  + +YG G  +RDWLYVEDH 
Sbjct: 202 WLRTYGFPTIVTNCSNNYGPYHFPEKLIPLVILNALDGKALPIYGKGDQIRDWLYVEDHA 261

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE++N+D+V  I  LLD ++PK  S+ + I ++ DRPGH
Sbjct: 262 RALYTVVTRGKPGETYNIGGHNEKQNLDVVHTICDLLDEIVPKEGSYRDQITYVADRPGH 321

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDN-NWWWRPL 334
           DRRYAID+ KI  E+GW P+E  ESG+ KTV WYL N NW  R L
Sbjct: 322 DRRYAIDAHKISVELGWKPEETFESGIRKTVKWYLINKNWCMRVL 366


>gi|307302363|ref|ZP_07582121.1| dTDP-glucose 4,6-dehydratase [Shewanella baltica BA175]
 gi|306914401|gb|EFN44822.1| dTDP-glucose 4,6-dehydratase [Shewanella baltica BA175]
          Length = 356

 Score =  398 bits (1022), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 187/340 (55%), Positives = 244/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++++ K  V+ +DKLTYAGNL SL  +S  + ++F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIIDNTKDSVVNLDKLTYAGNLESLLSVSIDSRYTFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +   +    K+ QPDA+++ AAESHVDRSI G  +FI TNI+GT+ LLE  R +W  +  
Sbjct: 61  NSTELNRVFKQHQPDAVMHLAAESHVDRSITGPSDFIQTNIVGTYTLLEAARQYWMQMDA 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           ++K  FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 ERKSVFRFHHISTDEVYGDLPHPDEVENVESLPLFTEATSYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WQRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+  G++GE YNIGG+NE++NI++V  I  +LD L+PK  S+ E I ++ DRPGH
Sbjct: 241 RALYKVVTTGKVGETYNIGGHNEKQNIEVVETICTILDELVPKVTSYIEQITYVTDRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID++K+  E+ W PQE  E+GL KTV WYL N  W
Sbjct: 301 DRRYAIDATKMSIELNWQPQETFETGLRKTVEWYLANLKW 340


>gi|114563994|ref|YP_751508.1| dTDP-glucose 4,6-dehydratase [Shewanella frigidimarina NCIMB 400]
 gi|114335287|gb|ABI72669.1| dTDP-glucose 4,6-dehydratase [Shewanella frigidimarina NCIMB 400]
          Length = 367

 Score =  397 bits (1021), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 186/337 (55%), Positives = 248/337 (73%), Gaps = 6/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M  ++TGGAGFIGSA+ R ++ + +  V+ +D LTYAGNL SL E+S +  +SF QV+IC
Sbjct: 4   MLFLITGGAGFIGSAVIRNIILNTEHSVINVDALTYAGNLESLSEVSDNERYSFKQVNIC 63

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     E++PDA+++ AAE+HVDRSI G   FI TNI+GT+ LLE TR +W+ L++
Sbjct: 64  DSRALARIFTEYKPDAVMHLAAETHVDRSIDGPAAFIETNIVGTYTLLEATRAYWNTLTK 123

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           D+K  FRF  ISTDEVYG L+    LF+E+  Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 124 DRKSAFRFHHISTDEVYGDLEGTDDLFTEETSYEPSSPYSASKASSDHLVRAWLRTYGLP 183

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYGPYHFPEKLIPL I   ++G  + +YGDG  +RDWL+VEDH RALY V+ 
Sbjct: 184 TIVTNCSNNYGPYHFPEKLIPLMILNALDGKPLPVYGDGMQIRDWLFVEDHARALYRVVT 243

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRY 294
           +G +GE YNIGG+NE+ NI++V  I  LL+ L+P        +++LI ++ DRPGHD RY
Sbjct: 244 EGVVGETYNIGGHNEKSNIEVVKTICSLLEELVPNKPNGITQYSDLITYVTDRPGHDFRY 303

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           AID+SKI  ++GW P+E+ ESG+ KTV WYLDN  WW
Sbjct: 304 AIDASKIDQKLGWKPEESFESGIRKTVEWYLDNKQWW 340


>gi|325145411|gb|EGC67687.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis M01-240013]
          Length = 355

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 186/337 (55%), Positives = 248/337 (73%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           +++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL +I+ +  ++F QVDICD
Sbjct: 3   KILVTGGAGFIGSAVVRHIIRNTQDSVVNLDKLTYAGNLESLTDIADNPRYAFEQVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     + +PDA+++ AAESHVDRSI  A EFI TNI+GTF LLE  R +W  +  +
Sbjct: 63  RAELDRVFAQHRPDAVMHLAAESHVDRSIGSAGEFIQTNIVGTFNLLEAARAYWQQMPSE 122

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           + + FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 QHEAFRFHHISTDEVYGDLSGTDDLFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I   ++G  + +YGDG  +RDWL+VEDH RALY V+ +
Sbjct: 183 IVTNCSNNYGPYHFPEKLIPLMILNALDGKPLPVYGDGMQIRDWLFVEDHARALYQVVTE 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NE+ NI++V  I  LL+ L P+  +    + +LI F++DRPGHD RYA
Sbjct: 243 GVVGETYNIGGHNEKANIEVVKTICALLEELAPEKPAGVARYEDLITFVQDRPGHDVRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           +D++KI+ ++GW P E  ESGL KTV WYLDN  WW+
Sbjct: 303 VDAAKIRRDLGWLPLETFESGLRKTVQWYLDNKTWWQ 339


>gi|188533477|ref|YP_001907274.1| DTDP-glucose 4,6-dehydratase [Erwinia tasmaniensis Et1/99]
 gi|188028519|emb|CAO96381.1| DTDP-glucose 4,6-dehydratase [Erwinia tasmaniensis Et1/99]
          Length = 357

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 191/338 (56%), Positives = 248/338 (73%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ +    VL +DKLTYAGNL SL++IS S  + F + DIC
Sbjct: 1   MKILVTGGAGFIGSAVIRHIIKNTNDTVLNVDKLTYAGNLESLQDISDSPRYHFSKTDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D E +     +F+PD +++ AAESHVDRSI G   FI TNIIGT++LLE  R++W  L  
Sbjct: 61  DPESLNRIFNDFEPDVVMHLAAESHVDRSIDGPAAFIETNIIGTYVLLEAARIYWFGLPF 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           ++K+ FRF  ISTDEV+G L     LF+E   Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 ERKEAFRFHHISTDEVFGDLHGTDDLFTEQTAYAPSSPYSASKASSDHLVRAWLRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+++NCSNNYGPYHFPEKLIPL I   + G  + +YG+G+ VRDWLYVEDH RALY V  
Sbjct: 181 VIVTNCSNNYGPYHFPEKLIPLTILNALAGKPLPVYGNGKQVRDWLYVEDHARALYRVAT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDAL-IPKSYS---HTELIRFIEDRPGHDRRY 294
            GR+GE YNIGG+NER+NID+V  I  +L+ L + K Y    ++ LI F+ DRPGHD RY
Sbjct: 241 AGRVGETYNIGGHNERQNIDVVNTICKILNRLVVDKPYGVDDYSALITFVRDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID++KI  E+GW P+E  E+G+ KTV WYL+N  WW+
Sbjct: 301 AIDATKIGKELGWLPEETFETGVEKTVRWYLENTEWWQ 338


>gi|218708289|ref|YP_002415910.1| dTDP-D-glucose-4,6-dehydratase [Vibrio splendidus LGP32]
 gi|218321308|emb|CAV17258.1| dTDP-D-glucose-4,6-dehydratase [Vibrio splendidus LGP32]
          Length = 358

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 188/350 (53%), Positives = 254/350 (72%), Gaps = 13/350 (3%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           + ++GGAGFIGSA+ R+++ +    ++ +DKLTYAGN+ S+  IS S+ + F+Q DI D 
Sbjct: 2   IFISGGAGFIGSAVVRHIITNTTESIVNVDKLTYAGNVESIALISGSDRYHFVQADISDA 61

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
           + +    +++QP A+++ AAESHVDRSI G  +F+ TNI+GTF LLE  R++WS L QDK
Sbjct: 62  DAMAEVFEKYQPTAVMHLAAESHVDRSIDGPADFMQTNIMGTFTLLEAARVYWSTLPQDK 121

Query: 123 KDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           ++ FRF  ISTDEVYG L+    LF+E+  Y PSSPYSA+KASSD+LV AW  TYG+PV+
Sbjct: 122 RETFRFHHISTDEVYGDLEGTDELFTEETSYEPSSPYSASKASSDHLVRAWNRTYGLPVI 181

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           ++NCSNNYGPYHFPEKLIP  I   ++   + +YGDG  +RDWLYVEDH RALY V+ +G
Sbjct: 182 VTNCSNNYGPYHFPEKLIPHVILNALDAKPLPIYGDGSQIRDWLYVEDHARALYKVVTEG 241

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----------YSHTELIRFIEDRPGH 290
            +GE YNIGG+NE+KNI++V  +  +LD L P S           ++ ELI F++DRPGH
Sbjct: 242 VVGETYNIGGHNEKKNIEVVETLCTILDELKPISDNPAFTSSSIVNYNELITFVKDRPGH 301

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDN-NWWWRPLYKELK 339
           D RYAID+SKI+ E+GW P+E+ E+G+ KTV WYL N NWW R L  E +
Sbjct: 302 DVRYAIDASKIEKELGWVPEESFETGIRKTVEWYLSNENWWKRVLNGEYQ 351


>gi|325203191|gb|ADY98644.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis M01-240355]
 gi|325203203|gb|ADY98656.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis M01-240355]
          Length = 355

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 185/337 (54%), Positives = 248/337 (73%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           +++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL +I+ +  ++F QVDICD
Sbjct: 3   KILVTGGAGFIGSAVVRHIIQNTQDSVVNLDKLTYAGNLESLTDIADNPRYAFEQVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     + +PDA+++ AAESHVDRSI  A EFI TNI+GTF LLE  R +W  +  +
Sbjct: 63  RAELDRVFAQHRPDAVMHLAAESHVDRSIGSAGEFIQTNIVGTFNLLEAARAYWQQMPSE 122

Query: 122 KKDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           +++ FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 QREAFRFHHISTDEVYGDLGGTDDLFTETAPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I   ++G  + +YGDG  +RDWL+VEDH RALY V+ +
Sbjct: 183 IVTNCSNNYGPYHFPEKLIPLMILNALDGKPLPVYGDGMQIRDWLFVEDHARALYQVVTE 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NE+ NI++V  I  LL+ L+P        + +LI +++DRPGHD RYA
Sbjct: 243 GVVGETYNIGGHNEKANIEVVRTICALLEELVPNKPQGVARYEDLITYVKDRPGHDVRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           +D++KI+ ++GW P E  ESGL KTV WYLDN  WW+
Sbjct: 303 VDAAKIRRDLGWLPLETFESGLRKTVQWYLDNKTWWQ 339


>gi|254805862|ref|YP_003084083.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis alpha14]
 gi|254669404|emb|CBA08589.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis alpha14]
 gi|325143301|gb|EGC65637.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis 961-5945]
 gi|325143316|gb|EGC65651.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis 961-5945]
 gi|325143339|gb|EGC65672.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis 961-5945]
 gi|325197363|gb|ADY92819.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis G2136]
 gi|325197378|gb|ADY92834.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis G2136]
          Length = 360

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 186/336 (55%), Positives = 247/336 (73%), Gaps = 6/336 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL +I+ +  ++F QVDICDR
Sbjct: 9   ILVTGGAGFIGSAVVRHIIQNTQDSVVNLDKLTYAGNLESLTDIADNPRYAFEQVDICDR 68

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             +     + +PDA+++ AAESHVDRSI  A EFI TNI+GTF LLE  R +W  +  ++
Sbjct: 69  AELDRVFAQHRPDAVMHLAAESHVDRSIGSAGEFIQTNIVGTFNLLEAARAYWQQMPSEQ 128

Query: 123 KDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
            + FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P +
Sbjct: 129 HEAFRFHHISTDEVYGDLGGTDDLFTETAPYAPSSPYSASKASSDHLVRAWLRTYGLPTI 188

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           ++NCSNNYGPYHFPEKLIPL I   ++G  + +YGDG  +RDWL+VEDH RALY V+ +G
Sbjct: 189 VTNCSNNYGPYHFPEKLIPLMILNALDGKPLPVYGDGMQIRDWLFVEDHARALYQVVTEG 248

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYAI 296
            +GE YNIGG+NE+ NI++V  I  LL+ L P+  +    + +LI F++DRPGHD RYA+
Sbjct: 249 VVGETYNIGGHNEKANIEVVKTICALLEELAPEKPAGVARYEDLITFVQDRPGHDVRYAV 308

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           D++KI+ ++GW P E  ESGL KTV WYLDN  WW+
Sbjct: 309 DAAKIRRDLGWLPLETFESGLRKTVQWYLDNKTWWQ 344


>gi|121633945|ref|YP_974190.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis FAM18]
 gi|121633957|ref|YP_974202.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis FAM18]
 gi|120865651|emb|CAM09371.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis FAM18]
 gi|120865663|emb|CAM09387.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis FAM18]
 gi|261391609|emb|CAX49047.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis 8013]
 gi|261391622|emb|CAX49064.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis 8013]
          Length = 355

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 186/337 (55%), Positives = 248/337 (73%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           +++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL +I+ +  ++F QVDICD
Sbjct: 3   KILVTGGAGFIGSAVVRHIIRNTQDSVVNLDKLTYAGNLESLTDIADNPRYAFEQVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     + +PDA+++ AAESHVDRSI  A EFI TNI+GTF LLE  R +W  +  +
Sbjct: 63  RAELDRVFAQHRPDAVMHLAAESHVDRSIGSAGEFIQTNIVGTFNLLEAARAYWQQMPSE 122

Query: 122 KKDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           + + FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 QHEAFRFHHISTDEVYGDLGGTDDLFTETAPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I   ++G  + +YGDG  +RDWL+VEDH RALY V+ +
Sbjct: 183 IVTNCSNNYGPYHFPEKLIPLMILNALDGKPLPVYGDGMQIRDWLFVEDHARALYQVVTE 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NE+ NI++V  I  LL+ L P+  +    + +LI F++DRPGHD RYA
Sbjct: 243 GVVGETYNIGGHNEKANIEVVKTICALLEELAPEKPAGVARYEDLITFVQDRPGHDVRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           +D++KI+ ++GW P E  ESGL KTV WYLDN  WW+
Sbjct: 303 VDAAKIRRDLGWLPLETFESGLRKTVQWYLDNKTWWQ 339


>gi|288816242|gb|ADC54962.1| RmlB [Escherichia coli]
          Length = 361

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 187/340 (55%), Positives = 240/340 (70%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYIFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DAAAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L          +  LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNNEELPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNI++V  I  LLD ++PK   + E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIEVVLTICDLLDEIVPKEKFYCEQINYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
             R+AID+ K+  E+GW P E  ESG+ KTV WYL N  W
Sbjct: 301 YCRFAIDAEKVSRELGWKPPETFESGICKTVEWYLSNTKW 340


>gi|304398137|ref|ZP_07380012.1| dTDP-glucose 4,6-dehydratase [Pantoea sp. aB]
 gi|304354423|gb|EFM18795.1| dTDP-glucose 4,6-dehydratase [Pantoea sp. aB]
          Length = 356

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 190/340 (55%), Positives = 241/340 (70%), Gaps = 7/340 (2%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R ++TGGAGFIGSAL R+L+ + + QV+V+DKL+YAGNL SL  ++ S+ F F QVDICD
Sbjct: 3   RFLITGGAGFIGSALVRFLIAETEHQVVVVDKLSYAGNLASLASVANSDRFCFEQVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +       QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W  L   
Sbjct: 63  RTALDEVFARHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTWQLLEAARSYWQTLDDA 122

Query: 122 KKDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           +K  F F  ISTDEV+G L   +  F+E  PY PSSPY+A+KASSD+LV AW  TYG+P 
Sbjct: 123 RKRAFLFHHISTDEVFGDLHDSQAYFTETTPYAPSSPYAASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGP HFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V+  
Sbjct: 183 LVTNCSNNYGPCHFPEKLIPLTIINALAGKALPVYGNGQQIRDWLYVEDHARALYQVVSY 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALI----PKSYSH-TELIRFIEDRPGHDRRY 294
           G+ GE YNIGG+NER+NI++V  I  LL+ L     P   +H  +LI ++ DRPGHD+RY
Sbjct: 243 GKPGETYNIGGHNERRNIEVVETICSLLEELAAEQKPAGLAHYRDLITYVADRPGHDQRY 302

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           AID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+ +
Sbjct: 303 AIDASKIAHELGWVPQETFESGMRKTVAWYLANPAWWQAI 342


>gi|88813322|ref|ZP_01128560.1| dTDP-glucose 4,6-dehydratase [Nitrococcus mobilis Nb-231]
 gi|88789380|gb|EAR20509.1| dTDP-glucose 4,6-dehydratase [Nitrococcus mobilis Nb-231]
          Length = 362

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 183/331 (55%), Positives = 242/331 (73%), Gaps = 1/331 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++++TGGAGFIGSAL RYL+ + +  V+ +D LTYAG+ +++  ++Q   + F   DIC
Sbjct: 1   MKILITGGAGFIGSALVRYLIGETEHCVVNVDALTYAGDPSTVASVAQDPRYRFYHTDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +R+     +PDA+++ AAESHVDRSI G  EFI TNI GT+ LLE  R +W+ L+ 
Sbjct: 61  DAAALRALFASEKPDAVMHLAAESHVDRSIDGPAEFIRTNIHGTYCLLEAARAYWTELAP 120

Query: 121 DKKDQFRFLQISTDEVYGSLDK-GLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            ++++FRF  ISTDEV+G+L   G F+E  PY P+SPY+A+KASSD+LV AW HTYG P 
Sbjct: 121 TEQERFRFHHISTDEVFGALGANGCFTEASPYRPNSPYAASKASSDHLVRAWCHTYGFPA 180

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +LSNCSNNYGPY FPEKLIPL ITR + G  + +YGDG+NVRDWL+V+DH RAL  VL +
Sbjct: 181 VLSNCSNNYGPYQFPEKLIPLQITRALAGRSLPVYGDGRNVRDWLFVDDHARALVRVLTR 240

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSS 299
           GR+GE YNIGGN ER N+ +V  +   LD L P++  H  LI F+ DRPGHD RYAID+ 
Sbjct: 241 GRVGESYNIGGNAERTNLQVVETLCAQLDRLRPQTQPHARLIEFVSDRPGHDFRYAIDAG 300

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           K++ E+GW P+E+ +SGL KTV WYLD   W
Sbjct: 301 KVRRELGWSPEESFDSGLEKTVRWYLDRPDW 331


>gi|29725999|gb|AAO88929.1| dTDP-D-glucose-4,6-dehydratase [Vibrio cholerae]
          Length = 354

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 188/337 (55%), Positives = 247/337 (73%), Gaps = 6/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL  ++ S  ++F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHVIQNTQDSVVNLDKLTYAGNLESLVSVAGSERYAFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +      +QPDA+++ AAESHVDRSI G   FI TNIIGT+ LLE  R +WS L  
Sbjct: 61  DRAELDRVFAGYQPDAVMHLAAESHVDRSIDGPAAFIETNIIGTYTLLEAARHYWSNLES 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           ++K  FRF  ISTDEVYG L+    LF+E   Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 ERKVAFRFHHISTDEVYGDLEGTDDLFTETTAYEPSSPYSASKASSDHLVRAWLRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYGPYHFPEKLIPL I   +EG  + +YGDG  +RDWL+VEDH RALY V+ 
Sbjct: 181 TIVTNCSNNYGPYHFPEKLIPLMILNALEGKALPVYGDGMQIRDWLFVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G +GE YNIGG+NE+ NI++V  +  LL+ L+P   +    + +LI +++DRPGHD RY
Sbjct: 241 EGLVGETYNIGGHNEKANIEVVNTLCALLEELVPNKPAGVAHYADLITYVKDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           AID+SKI+ E+GW P+E  ESG+ KTV WYL +  WW
Sbjct: 301 AIDASKIERELGWKPEETFESGIRKTVEWYLHHREWW 337


>gi|153001416|ref|YP_001367097.1| dTDP-glucose 4,6 dehydratase [Shewanella baltica OS185]
 gi|151366034|gb|ABS09034.1| dTDP-glucose 4,6-dehydratase [Shewanella baltica OS185]
          Length = 358

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 190/342 (55%), Positives = 245/342 (71%), Gaps = 12/342 (3%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSAL R+++N+    V+ +DKLTYAGNL SL  +S+S  + F  VDIC
Sbjct: 1   MKILVTGGAGFIGSALIRHVINETTDSVINVDKLTYAGNLESLAAVSESPRYFFELVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DRE +    + +QPDA+++ AAESHVDRSI G  EFI TNI+GT+ LLE  R ++S L  
Sbjct: 61  DREELDRVFQLYQPDAVMHLAAESHVDRSITGPAEFIQTNIVGTYTLLEAARSYFSSLDL 120

Query: 121 DKKDQFRFLQISTDEVYGSL------------DKGLFSEDMPYNPSSPYSATKASSDYLV 168
           + K +FRF  ISTDEVYG L            +  LF+E+  Y PSSPYSA+KASSD+LV
Sbjct: 121 EAKTKFRFHHISTDEVYGDLPHPDELHSLSNQELPLFTENTSYAPSSPYSASKASSDHLV 180

Query: 169 LAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVED 228
            AW  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWL+VED
Sbjct: 181 RAWLRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKSLPIYGKGDQIRDWLFVED 240

Query: 229 HVRALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRP 288
           H RALY V+ KG +GE YNIGG+NE++NI++V  I  +LD L PK+  + E + ++ DRP
Sbjct: 241 HARALYKVVTKGTVGETYNIGGHNEKQNIEVVETICSILDELKPKNNKYIEQVTYVTDRP 300

Query: 289 GHDRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           GHDRRYAID+SK+  E+ W P E  E+GL KTV WYL N  W
Sbjct: 301 GHDRRYAIDASKMSIELNWQPLETFETGLRKTVEWYLANQEW 342


>gi|296447931|ref|ZP_06889840.1| dTDP-glucose 4,6-dehydratase [Methylosinus trichosporium OB3b]
 gi|296254568|gb|EFH01686.1| dTDP-glucose 4,6-dehydratase [Methylosinus trichosporium OB3b]
          Length = 365

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 184/336 (54%), Positives = 244/336 (72%), Gaps = 2/336 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSA+CR ++      +LV DKLTYAGNL+SL  ++    +SF + DIC
Sbjct: 1   MRVLVTGGAGFIGSAVCRRIIEATPHHLLVFDKLTYAGNLDSLAPVANDPRYSFRRADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  + +A++EFQPD +++ AAESHVDRSI G   FI TN++GTF +L+    +W  L  
Sbjct: 61  DRGAVAAAMQEFQPDIVMHLAAESHVDRSIDGPAAFIHTNVVGTFTMLDAALEYWRGLDS 120

Query: 121 DKKDQFRFLQISTDEVYGSLDK-GLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           ++   FRFL ISTDEV+G+L   GLF ED PY+P+SPYSA+KA SD+L  AW  TYG+P 
Sbjct: 121 ERAAAFRFLHISTDEVFGALGATGLFREDTPYSPNSPYSASKAGSDHLARAWRETYGLPT 180

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I   ++G  + +YG G+NVRDWLYV+DH  AL LV  +
Sbjct: 181 IVTNCSNNYGPYHFPEKLIPLMILNALDGRPLPVYGRGENVRDWLYVDDHAAALLLVATR 240

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS-HTELIRFIEDRPGHDRRYAIDS 298
           G +GE YNIGG +E +NID+V  I  +LD + P++   + +LI ++ DRPGHD RYAID 
Sbjct: 241 GAVGETYNIGGRSEMRNIDVVTTICDILDEIHPRAAGPYRQLISYVTDRPGHDLRYAIDC 300

Query: 299 SKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           SKI+ E+GW   E  E+G+ KTV WYLDN  WW+ +
Sbjct: 301 SKIERELGWRASETFETGIRKTVRWYLDNEDWWQAI 336


>gi|308388285|gb|ADO30605.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis alpha710]
 gi|325131108|gb|EGC53829.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis OX99.30304]
 gi|325137131|gb|EGC59726.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis M0579]
 gi|325201250|gb|ADY96704.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis M01-240149]
 gi|325207109|gb|ADZ02561.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis NZ-05/33]
          Length = 355

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 188/337 (55%), Positives = 248/337 (73%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           +++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL +I+ +  ++F QVDICD
Sbjct: 3   KILVTGGAGFIGSAVVRHIIRNTQDSVVNLDKLTYAGNLESLTDIADNPRYAFEQVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     + +PDA+++ AAESHVDRSI  A EFI TNI+GTF LLE  R +   +  +
Sbjct: 63  RAELDRVFAQHRPDAVMHLAAESHVDRSIGSAGEFIQTNIVGTFNLLEAARAYRQQMPSE 122

Query: 122 KKDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           + + FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 QHEAFRFHHISTDEVYGDLGGTDDLFTETAPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I   ++G  + +YGDG  +RDWL+VEDH RALY V+ +
Sbjct: 183 IVTNCSNNYGPYHFPEKLIPLMILNALDGKPLPVYGDGMQIRDWLFVEDHARALYQVVTE 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NE+ NI++V  I  LL+ L P+  +    + +LI F++DRPGHD RYA
Sbjct: 243 GVVGETYNIGGHNEKANIEVVKTICALLEELAPEKPAGVARYEDLITFVQDRPGHDVRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID++KI  E+GW PQE  ESGL+KTV WYLDN  WW+
Sbjct: 303 IDTAKISRELGWKPQETFESGLHKTVQWYLDNKTWWQ 339


>gi|325129125|gb|EGC51973.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis N1568]
          Length = 360

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 186/336 (55%), Positives = 247/336 (73%), Gaps = 6/336 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL +I+ +  ++F QVDICDR
Sbjct: 9   ILVTGGAGFIGSAVVRHIIRNTQDSVVNLDKLTYAGNLESLTDIADNPRYAFEQVDICDR 68

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             +     + +PDA+++ AAESHVDRSI  A EFI TNI+GTF LLE  R +W  +  ++
Sbjct: 69  AELDRVFAQHRPDAVMHLAAESHVDRSIGSAGEFIQTNIVGTFNLLEAARAYWQQMPSEQ 128

Query: 123 KDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
            + FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P +
Sbjct: 129 HEAFRFHHISTDEVYGDLGGTDDLFTETAPYAPSSPYSASKASSDHLVRAWLRTYGLPTI 188

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           ++NCSNNYGPYHFPEKLIPL I   ++G  + +YGDG  +RDWL+VEDH RALY V+ +G
Sbjct: 189 VTNCSNNYGPYHFPEKLIPLMILNALDGKPLPVYGDGMQIRDWLFVEDHARALYQVVTEG 248

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYAI 296
            +GE YNIGG+NE+ NI++V  I  LL+ L+P+  +    + +LI F+ DRPGHD RYA+
Sbjct: 249 VVGETYNIGGHNEKANIEVVKTICDLLEELVPEKPAGVARYEDLITFVPDRPGHDVRYAV 308

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           D++KI+ ++GW P E  ESGL KTV WYLDN  WW+
Sbjct: 309 DAAKIRRDLGWLPLETFESGLRKTVQWYLDNKTWWQ 344


>gi|29725984|gb|AAO88917.1| dTDP-D-glucose-4,6-dehydratase [Vibrio cholerae]
          Length = 354

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 187/337 (55%), Positives = 245/337 (72%), Gaps = 6/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++   +  V+ +DKLTYAGNL SL  ++ S  ++F Q+DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHVIQSTQDSVVNLDKLTYAGNLESLASVAGSERYAFEQIDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     E QPD +++ AAESHVDRSI G   FI TNIIGT+ LLE  R +WS L  
Sbjct: 61  DRAELDRVFAEHQPDVVMHLAAESHVDRSIDGPAAFIETNIIGTYTLLEAARHYWSHLES 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           ++K  FRF  ISTDEVYG L+    LF+E   Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 ERKAAFRFHHISTDEVYGDLEGTDDLFTETTAYEPSSPYSASKASSDHLVRAWLRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYGPYHFPEKLIPL I   +EG  + +YGDG  +RDWL+VEDH RALY V+ 
Sbjct: 181 TIVTNCSNNYGPYHFPEKLIPLMILNALEGKVLPVYGDGMQIRDWLFVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G +GE YNIGG+NE+ NI++V  +  LL+ L+P   +    + +LI +++DRPGHD RY
Sbjct: 241 EGLVGETYNIGGHNEKANIEVVNTLCALLEELVPNKPAGVAHYADLITYVKDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           AID+SKI+ E+GW P+E  ESG+ KTV WYL +  WW
Sbjct: 301 AIDASKIERELGWKPEETFESGIRKTVEWYLHHREWW 337


>gi|262404977|ref|ZP_06081529.1| dTDP-glucose 4,6-dehydratase [Vibrio sp. RC586]
 gi|262348816|gb|EEY97957.1| dTDP-glucose 4,6-dehydratase [Vibrio sp. RC586]
          Length = 354

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 187/337 (55%), Positives = 247/337 (73%), Gaps = 6/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++   +  V+ +DKLTYAGNL SL  ++ S  ++F +VD+C
Sbjct: 1   MKILVTGGAGFIGSAVVRHIIQSTQDSVVNLDKLTYAGNLESLASVAGSERYAFERVDVC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     E QPDA+++ AAESHVDRSI G   FI TNIIGT+ LLE  R +W+ L  
Sbjct: 61  DRFELDRVFAEHQPDAVMHLAAESHVDRSIDGPAAFIETNIIGTYTLLEAARHYWNHLES 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           ++K  FRF  ISTDEVYG L+    LF+E   Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 ERKAAFRFHHISTDEVYGDLEGTDELFTETTAYEPSSPYSASKASSDHLVRAWLRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYGPYHFPEKLIPL I   +EG  + +YGDG  +RDWL+VEDH RALY V+ 
Sbjct: 181 TIVTNCSNNYGPYHFPEKLIPLMILNALEGKALPVYGDGMQIRDWLFVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G +GE YNIGG+NE+ NI++V  +  LL+ L+P   +    + +LI +++DRPGHD RY
Sbjct: 241 EGLVGETYNIGGHNEKANIEVVNTLCALLEELMPNKPAGVAHYADLITYVKDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           AID+SKI+ E+GW P+E  ESG+ KTV WYL N+ WW
Sbjct: 301 AIDASKIERELGWKPEETFESGIRKTVEWYLHNHEWW 337


>gi|161869082|ref|YP_001598248.1| dTDP-D-glucose 4,6-dehydratase [Neisseria meningitidis 053442]
 gi|161869097|ref|YP_001598263.1| dTDP-D-glucose 4,6-dehydratase [Neisseria meningitidis 053442]
 gi|161594635|gb|ABX72295.1| dTDP-D-glucose 4,6-dehydratase [Neisseria meningitidis 053442]
 gi|161594650|gb|ABX72310.1| dTDP-D-glucose 4,6-dehydratase [Neisseria meningitidis 053442]
          Length = 355

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 188/337 (55%), Positives = 247/337 (73%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           +++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL +I+ +  ++F QVDICD
Sbjct: 3   KILVTGGAGFIGSAVVRHIIRNTQDSVVNLDKLTYAGNLESLTDIADNPRYAFEQVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     + +PDA+++ AAESHVDRSI  A EFI TNI+GTF LLE  R +   +  +
Sbjct: 63  RAELDRVFAQHRPDAVMHLAAESHVDRSIGSAGEFIQTNIVGTFNLLEAARAYRQQMPSE 122

Query: 122 KKDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           + + FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 QHEAFRFHHISTDEVYGDLGGTDDLFTETAPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I   ++G  + +YGDG  +RDWL+VEDH RALY V+ +
Sbjct: 183 IVTNCSNNYGPYHFPEKLIPLMILNALDGKPLPVYGDGMQIRDWLFVEDHARALYQVVTE 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NE+ NI++V  I  LL+ L P+  +    + +LI F++DRPGHD RYA
Sbjct: 243 GVVGETYNIGGHNEKANIEVVKTICALLEELAPEKPAGVARYEDLITFVQDRPGHDVRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID++KI  E+GW PQE  ESGL KTV WYLDN  WW+
Sbjct: 303 IDAAKISRELGWKPQETFESGLRKTVQWYLDNKTWWQ 339


>gi|319427036|gb|ADV55110.1| dTDP-glucose 4,6-dehydratase [Shewanella putrefaciens 200]
          Length = 352

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 186/343 (54%), Positives = 246/343 (71%), Gaps = 13/343 (3%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N  +  V+ +DKLTYAGNL SL  ++ S  ++F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINKTQDCVINVDKLTYAGNLESLVSVAASERYAFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     + +PDA+++ AAESHVDRSI G  +FI TNI+GT+ LLE  R +W  L  
Sbjct: 61  DRAELDRVFSQHRPDAVMHLAAESHVDRSITGPADFIQTNIVGTYTLLEAARHYWMKLDA 120

Query: 121 DKKDQFRFLQISTDEVYGSL-------------DKGLFSEDMPYNPSSPYSATKASSDYL 167
           ++K  FRF  ISTDEVYG L             +  LF+E   Y PSSPYSA+KASSD+L
Sbjct: 121 ERKVAFRFHHISTDEVYGDLPHPDEQEGQVVKQELPLFTETTAYAPSSPYSASKASSDHL 180

Query: 168 VLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVE 227
           V AW  TYG+P +++NCSNNYGP+HFPEKLIPL I   +EG  + +YG G  +RDWLYVE
Sbjct: 181 VRAWLRTYGLPTIVTNCSNNYGPFHFPEKLIPLVIINALEGKPLPIYGKGDQIRDWLYVE 240

Query: 228 DHVRALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDR 287
           DH RALY+V+ +G+IGE YNIGG+NE++N+++V  I  +LD+L+PK+  + E I ++ DR
Sbjct: 241 DHARALYIVVTEGKIGETYNIGGHNEKQNLEVVQTICRILDSLVPKATPYAEQITYVTDR 300

Query: 288 PGHDRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
            GHDRRYAID+SK+  E+ W PQE  E+GL KTV WYL N  W
Sbjct: 301 LGHDRRYAIDASKMSRELNWQPQETFETGLRKTVEWYLANQEW 343


>gi|146293636|ref|YP_001184060.1| dTDP-glucose 4,6 dehydratase [Shewanella putrefaciens CN-32]
 gi|145565326|gb|ABP76261.1| dTDP-glucose 4,6-dehydratase [Shewanella putrefaciens CN-32]
          Length = 359

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 185/343 (53%), Positives = 245/343 (71%), Gaps = 13/343 (3%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ +    V+ +DKLTYAGNL SL  ++ +  ++F +VDIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIIGNTPDSVVNVDKLTYAGNLESLSSVASNARYTFEKVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +       QPD +++ AAESHVDRSI G  +FI TNI+GT+ LLE  R +W  L  
Sbjct: 61  DRAQLDRVFLLHQPDVVMHLAAESHVDRSITGPADFIQTNIVGTYTLLEAARNYWMQLDT 120

Query: 121 DKKDQFRFLQISTDEVYGSL-------------DKGLFSEDMPYNPSSPYSATKASSDYL 167
           ++K  FRF  ISTDEVYG L             +  LF+E  PY PSSPYSA+KASSD+L
Sbjct: 121 ERKLAFRFHHISTDEVYGDLPHPDEQEGQVVNQELPLFTETTPYAPSSPYSASKASSDHL 180

Query: 168 VLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVE 227
           V AW  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVE
Sbjct: 181 VRAWLRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPIYGKGDQIRDWLYVE 240

Query: 228 DHVRALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDR 287
           DH RALY V+ +G++GE YNIGG+NE++N+++V  I  +LD+L+PK+  + E I ++ DR
Sbjct: 241 DHARALYKVVTEGKVGETYNIGGHNEKQNLEVVQTICRILDSLVPKATPYAEQITYVTDR 300

Query: 288 PGHDRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           PGHDRRYAID+SK+ +E+ W PQE  E+GL KTV WYL N  W
Sbjct: 301 PGHDRRYAIDASKMSAELDWQPQETFETGLRKTVEWYLANQEW 343


>gi|262374521|ref|ZP_06067795.1| dTDP-glucose 4,6-dehydratase [Acinetobacter junii SH205]
 gi|262310517|gb|EEY91607.1| dTDP-glucose 4,6-dehydratase [Acinetobacter junii SH205]
          Length = 361

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 190/336 (56%), Positives = 239/336 (71%), Gaps = 6/336 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+ +VTGGAGFIGSA+ RYL+ + +  VL +DKLTYAGNL SL  I  +  + F Q DIC
Sbjct: 1   MKFLVTGGAGFIGSAVVRYLIEETEHIVLNVDKLTYAGNLESLNSIESNPRYQFSQTDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
            R  +      FQPD +++ AAESHVDRSI G+  FI TNI+GT+ +LE  R +W+ L+ 
Sbjct: 61  VRADLDQLFAGFQPDVVMHLAAESHVDRSITGSAAFIETNILGTYQMLEAARHYWNGLNA 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
             K  FRF  ISTDEVYG L+    LF+E   Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 QSKQAFRFHHISTDEVYGDLEGTDDLFTETTSYAPSSPYSASKASSDHLVRAWQRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+L+NCSNNYGPYHFPEKLIPL I   ++G  + +YG+G  +RDWLYVEDH RALY V+ 
Sbjct: 181 VVLTNCSNNYGPYHFPEKLIPLTILNALQGKPLPVYGNGHQIRDWLYVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRY 294
           +  +GE YNIGG+NE+KNID+V  I  LL+ L P        + +LI F+ DRPGHD RY
Sbjct: 241 EANVGETYNIGGHNEQKNIDVVKSICALLEELAPNKPEGLSRYEDLITFVTDRPGHDHRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           AID++KIK ++GW PQE+ E+GL KTV WYL N  W
Sbjct: 301 AIDATKIKQDLGWVPQESFETGLRKTVEWYLANTQW 336


>gi|261823423|ref|YP_003261529.1| dTDP-glucose 4,6-dehydratase [Pectobacterium wasabiae WPP163]
 gi|261607436|gb|ACX89922.1| dTDP-glucose 4,6-dehydratase [Pectobacterium wasabiae WPP163]
          Length = 355

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 187/339 (55%), Positives = 244/339 (71%), Gaps = 6/339 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R+++TGGAGFIGSAL RY++ + +  V+V+DKLTYAGNL+SL  +++S  F+F +VDICD
Sbjct: 3   RILITGGAGFIGSALVRYILTETQDSVVVVDKLTYAGNLSSLAPVAESERFAFERVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +      +QP  +++ AAESHVDRSI G   FI TNI+GT+ +LE  R +W  L+  
Sbjct: 63  RAELDRVFAAYQPALVMHLAAESHVDRSIDGPAAFIETNIVGTYTMLEAARHYWQNLADA 122

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            K  FRF  ISTDEV+G L     LF+E   Y PSSPYSA+KASSD+LV AW  TYG P 
Sbjct: 123 DKGVFRFHHISTDEVFGDLHGTDDLFTETTSYAPSSPYSASKASSDHLVRAWLRTYGFPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I   + G  + +YGDG  +RDWL+VEDH RALY V+ +
Sbjct: 183 VITNCSNNYGPYHFPEKLIPLVILNAVAGKPLPVYGDGAQIRDWLFVEDHARALYKVVTE 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
           G IGE YNIGG+NERKNI++V  I  LL+ L P   +    + +LI +++DRPGHD RYA
Sbjct: 243 GEIGETYNIGGHNERKNIEVVQTICELLEELAPNKPAGVAHYRDLITYVKDRPGHDMRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           ID+ KI+ E+GW P+E  E+G+ KTV WYL+N  WWR +
Sbjct: 303 IDAGKIERELGWRPEETFETGMKKTVSWYLNNEKWWRSV 341


>gi|254229475|ref|ZP_04922890.1| dTDP-glucose 4,6-dehydratase [Vibrio sp. Ex25]
 gi|262392582|ref|YP_003284436.1| dTDP-glucose 4,6-dehydratase [Vibrio sp. Ex25]
 gi|151938046|gb|EDN56889.1| dTDP-glucose 4,6-dehydratase [Vibrio sp. Ex25]
 gi|262336176|gb|ACY49971.1| dTDP-glucose 4,6-dehydratase [Vibrio sp. Ex25]
          Length = 355

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 187/337 (55%), Positives = 245/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           +++VTGGAGFIGSA+ R+++ D +  V+ +DKLTYAGNL SL ++S+S  + F QVDICD
Sbjct: 3   KILVTGGAGFIGSAVVRHIIRDTQDTVINLDKLTYAGNLESLVDVSESERYYFEQVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E QPD +++ AAESHVDRSI G   FI TN++GT+ LLE  R +WS L + 
Sbjct: 63  RTELDRVFSEHQPDMVMHLAAESHVDRSIDGPAAFIETNVMGTYHLLEAARQYWSNLDEA 122

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           ++  FRF  ISTDEVYG L+    LF+E   Y PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 RQSAFRFHHISTDEVYGDLEGTDDLFTETTSYAPSSPYSASKASSDHLVRAWQRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   ++G  + +YGDG  +RDWL+VEDH RALY V+ +
Sbjct: 183 LVTNCSNNYGPYHFPEKLIPLMILNALDGKPLPVYGDGMQIRDWLFVEDHARALYKVVNE 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NE+ NI++V  I  LL+ L P       S+  L+ +++DRPGHD RYA
Sbjct: 243 GEVGETYNIGGHNEKANIEVVKTICALLEELRPDKPAGVESYESLVTYVKDRPGHDVRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID++KI  E+GW P+E  ESG+ KTV WYL+N  WW+
Sbjct: 303 IDATKIAQELGWTPEETFESGIRKTVGWYLNNPQWWQ 339


>gi|325131122|gb|EGC53843.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis OX99.30304]
 gi|325137145|gb|EGC59740.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis M0579]
 gi|325201264|gb|ADY96718.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis M01-240149]
 gi|325207123|gb|ADZ02575.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis NZ-05/33]
          Length = 358

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 187/335 (55%), Positives = 245/335 (73%), Gaps = 6/335 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL E++ +  ++F QVDICDR
Sbjct: 9   ILVTGGAGFIGSAVVRHIIRNTRDAVVNVDKLTYAGNLKSLTEVADNPRYAFEQVDICDR 68

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             +     + +PDA+++ AAESHVDRSI  A EFI TNIIGTF LLE  R +   +  ++
Sbjct: 69  AELDRVFAQHRPDAVMHLAAESHVDRSIDSAGEFIQTNIIGTFNLLEAARAYRRQMPSEQ 128

Query: 123 KDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           ++ FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P +
Sbjct: 129 REAFRFHHISTDEVYGDLHGTDDLFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPTI 188

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           ++NCSNNYGPYHFPEKLIPL I   ++G  + +YGDG  +RDWL+VEDH RALY V+ +G
Sbjct: 189 VTNCSNNYGPYHFPEKLIPLMILNALDGKPLPVYGDGMQIRDWLFVEDHARALYQVVTEG 248

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYAI 296
            IGE YNIGG+NE+ NI++V  I  LL+ L+P        + +LI +++DRPGHD RYAI
Sbjct: 249 EIGETYNIGGHNEKANIEVVRTICALLEELVPNKPQGVARYEDLITYVKDRPGHDVRYAI 308

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           D++KI  E+GW PQE  ESG+ KTV WYL+N  WW
Sbjct: 309 DAAKIGRELGWQPQETFESGIRKTVEWYLNNQTWW 343


>gi|329297885|ref|ZP_08255221.1| dTDP-glucose 4,6-dehydratase [Plautia stali symbiont]
          Length = 358

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 190/340 (55%), Positives = 245/340 (72%), Gaps = 7/340 (2%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           + +VTGGAGFIGSAL R+L+ +    V+V+DKL+YAGNL SL  + Q   F+F QVDICD
Sbjct: 3   QFLVTGGAGFIGSALVRFLIANTDHWVVVVDKLSYAGNLVSLAPVEQDARFAFEQVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +   L ++QPD I++ AAESHVDRSI     F+ TNI+GT+ LLE TR +W+ ++ +
Sbjct: 63  RAALDRVLAQYQPDCIMHLAAESHVDRSIDWPIAFVETNIVGTYQLLEATRHYWNGMTDE 122

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           +K  F    ISTDEV+G L   +  F+E  PY PSSPYSATKASSD+LV AW  TYG+PV
Sbjct: 123 RKKGFILHHISTDEVFGDLHGTEDFFTETTPYAPSSPYSATKASSDHLVRAWLRTYGLPV 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I   + G  + +YG+G  +RDWLYVEDH RALY V+  
Sbjct: 183 VVTNCSNNYGPYHFPEKLIPLTIINALAGKPLPVYGNGSQIRDWLYVEDHARALYTVVSS 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY-----SHTELIRFIEDRPGHDRRY 294
           G++GE YNIGG+NER+NI++V  +  LLD L P+       S+ ELI F+ DRPGHD RY
Sbjct: 243 GKVGETYNIGGHNERRNIEVVETLCDLLDELAPQQRAAGLSSYRELITFVHDRPGHDLRY 302

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           AID+SKI  E+GW PQE  +SG+ +TV WYL N  WW+ +
Sbjct: 303 AIDASKIARELGWTPQETFDSGIRETVQWYLANPQWWQAI 342


>gi|119384853|ref|YP_915909.1| dTDP-glucose 4,6-dehydratase [Paracoccus denitrificans PD1222]
 gi|119374620|gb|ABL70213.1| dTDP-glucose 4,6-dehydratase [Paracoccus denitrificans PD1222]
          Length = 345

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 191/335 (57%), Positives = 241/335 (71%), Gaps = 4/335 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R  V     +V+ +D LTYA NL ++  +S S L++F Q DI 
Sbjct: 1   MKILVTGGAGFIGSAVVRLAVARGH-RVVNLDSLTYAANLENVASVSGSPLYAFEQADIR 59

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +   L E +PDAI++ AAESHVDRSI G   FI TN+ GT+ LLE  R WW+  +Q
Sbjct: 60  DRAALDRILAEHRPDAIMHLAAESHVDRSIDGPGAFIETNVTGTYNLLEAARAWWT--AQ 117

Query: 121 DKKDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            + + FRF  ISTDEV+GSL + G F+ED PY+P SPYSA+KA+SD+LV AW  TYG+PV
Sbjct: 118 GRPEGFRFHHISTDEVFGSLGETGQFTEDTPYDPRSPYSASKAASDHLVRAWHETYGLPV 177

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +L+NCSNNYGP+HFPEKL+P+ I   + G  + +YGDG NVRDWLYVEDH  AL LVL+K
Sbjct: 178 VLTNCSNNYGPFHFPEKLVPVVILNALHGRPIPVYGDGGNVRDWLYVEDHADALLLVLEK 237

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSS 299
           GRIG  YNIGG NE +NID+V  I   +D L P +  H  LI F+ DRPGHDRRYAID  
Sbjct: 238 GRIGRSYNIGGENEARNIDLVRTICGHMDRLRPNAAPHDRLITFVTDRPGHDRRYAIDPG 297

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           +++SE+GW P   +E GL +TV WYL N  WWRPL
Sbjct: 298 RVRSELGWRPSVTVEEGLRRTVEWYLANEDWWRPL 332


>gi|91226572|ref|ZP_01261296.1| dTDP-D-glucose 4;6-dehydratase [Vibrio alginolyticus 12G01]
 gi|91189046|gb|EAS75328.1| dTDP-D-glucose 4;6-dehydratase [Vibrio alginolyticus 12G01]
          Length = 354

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 188/338 (55%), Positives = 245/338 (72%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ D +  V+ +DKLTYAGNL SL ++S+S  + F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIIRDTQDTVINLDKLTYAGNLESLVDVSESERYYFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     E QPD +++ AAESHVDRSI G   FI TN++GT+ LLE  R +WS L +
Sbjct: 61  DRAELDRVFSEHQPDMVMHLAAESHVDRSIDGPAAFIETNVMGTYHLLEAARQYWSGLDE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            ++  FRF  ISTDEVYG L+    LF+E   Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 ARQSAFRFHHISTDEVYGDLEGTDDLFTETTSYAPSSPYSASKASSDHLVRAWQRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            L++NCSNNYGPYHFPEKLIPL I   ++G  + +YGDG  +RDWL+VEDH RALY V+ 
Sbjct: 181 TLVTNCSNNYGPYHFPEKLIPLMILNALDGKPLPVYGDGMQIRDWLFVEDHARALYKVVN 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRY 294
           +G +GE YNIGG+NE+ NI++V  I  LL+ L P       S+  LI +++DRPGHD RY
Sbjct: 241 EGEVGETYNIGGHNEKANIEVVKTICALLEELRPDKPAGVESYESLITYVKDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID++KI  E+ W P+E  ESG+ KTV WYL+N  WW+
Sbjct: 301 AIDATKIAQELNWTPEETFESGIRKTVEWYLNNPQWWQ 338


>gi|325138768|gb|EGC61320.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis ES14902]
          Length = 360

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 185/336 (55%), Positives = 246/336 (73%), Gaps = 6/336 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL +I+ +  ++F QVDICDR
Sbjct: 9   ILVTGGAGFIGSAVVRHIIRNTQDSVVNLDKLTYAGNLESLTDIADNPRYAFEQVDICDR 68

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             +     + +PDA+++ AAESHVDRSI  A EFI TNI+GTF LLE  R +W  +  ++
Sbjct: 69  AELDRVFAQHRPDAVMHLAAESHVDRSIGSAGEFIQTNIVGTFNLLEAARAYWQQMPSEQ 128

Query: 123 KDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
            + FRF  ISTDEVYG L     LF+E  PY PSSPYSA+K SSD+LV AW  TYG+P +
Sbjct: 129 HEAFRFHHISTDEVYGDLGGTDDLFTETAPYAPSSPYSASKVSSDHLVRAWLRTYGLPTI 188

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           ++NCSNNYGPYHFPEKLIPL I   ++G  + +YGDG  +RDWL+VEDH RALY V+ +G
Sbjct: 189 VTNCSNNYGPYHFPEKLIPLMILNALDGKPLPVYGDGMQIRDWLFVEDHARALYQVVTEG 248

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYAI 296
            +GE YNIGG+NE+ NI++V  I  LL+ L P+  +    + +LI F++DRPGHD RYA+
Sbjct: 249 VVGETYNIGGHNEKANIEVVKTICALLEELAPEKPAGVARYEDLITFVQDRPGHDVRYAV 308

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           D++KI+ ++GW P E  ESGL KTV WYLDN  WW+
Sbjct: 309 DAAKIRRDLGWLPLETFESGLRKTVQWYLDNKTWWQ 344


>gi|89056334|ref|YP_511785.1| dTDP-glucose 4,6-dehydratase [Jannaschia sp. CCS1]
 gi|88865883|gb|ABD56760.1| dTDP-glucose 4,6-dehydratase [Jannaschia sp. CCS1]
          Length = 346

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 187/337 (55%), Positives = 244/337 (72%), Gaps = 4/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++++TGGAGFIGSA+ R  V     +V+ +D LTYA  L+++  ++ SNL++F + DIC
Sbjct: 1   MKILITGGAGFIGSAVVRLAVARGH-EVINLDALTYAACLDNVAPVASSNLYTFEKADIC 59

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DRE + + L    PDAI++ AAESHVDRSI G   FI TNI GT+ LLE  R +W   + 
Sbjct: 60  DREAMDTILSRHTPDAILHLAAESHVDRSIDGPGAFIQTNITGTYTLLEAARTYWE--AN 117

Query: 121 DKKDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            + D FRF  +STDEV+G+L D GLF+ED PY P+SPYSA+KA+SD++V AW  TYG+PV
Sbjct: 118 GRPDGFRFHHVSTDEVFGTLGDTGLFTEDSPYAPNSPYSASKAASDHMVRAWAETYGLPV 177

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +L+NCSNNYGPYHFPEKLIP+ I + + G  + +YGDG+N+RDWLYVEDH  AL  VL+K
Sbjct: 178 VLTNCSNNYGPYHFPEKLIPVVILKALAGETIPVYGDGKNIRDWLYVEDHADALLCVLEK 237

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSS 299
           G +G  YNIGG+NER NID+V  I  LLD   P+S  H  LI F+ DRPGHD RYAID++
Sbjct: 238 GELGRSYNIGGHNERTNIDLVRTICGLLDERRPESAPHDRLIEFVTDRPGHDMRYAIDAT 297

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYK 336
           +I+ E+GW P   +E GL KTV W+L N  WWR L +
Sbjct: 298 RIQEELGWTPSVTVEEGLAKTVDWFLANEDWWRALQQ 334


>gi|322513558|ref|ZP_08066658.1| dTDP-glucose 4,6-dehydratase [Actinobacillus ureae ATCC 25976]
 gi|322120629|gb|EFX92523.1| dTDP-glucose 4,6-dehydratase [Actinobacillus ureae ATCC 25976]
          Length = 357

 Score =  395 bits (1014), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 193/338 (57%), Positives = 246/338 (72%), Gaps = 6/338 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           + +TGGAGFIGSA+ R+++N  +  V+ IDKLTYAGNL SL+ +S+S+ + F QVDICD 
Sbjct: 4   IFITGGAGFIGSAVIRHIINYTQDVVVNIDKLTYAGNLASLEGVSKSSRYHFEQVDICDS 63

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             I     ++QPD +++ AAESHVDRSI G   FI TN+IGT+ LLE  R +W+ LS  K
Sbjct: 64  GRISQLFCKYQPDTVMHLAAESHVDRSIDGPSAFIQTNVIGTYTLLEAARSYWNGLSAAK 123

Query: 123 KDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           K  FRF  ISTDEVYG L   + LF+E  PY PSSPYSA+KA+SD+LV AW  TYG+P+L
Sbjct: 124 KAAFRFHHISTDEVYGDLHGMEELFTEQTPYAPSSPYSASKAASDHLVRAWFRTYGLPIL 183

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           ++NCSNNYGPYHFPEKLIPL I   +EG  + +YGDG  VRDWL+VEDH RALY V+ +G
Sbjct: 184 VTNCSNNYGPYHFPEKLIPLMILNALEGKPLPVYGDGLQVRDWLFVEDHARALYKVVCEG 243

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTE----LIRFIEDRPGHDRRYAI 296
           ++GE YNIGG+NE+ NI +V  I  LL+  +P   +  E    LI ++ DRPGHD RYAI
Sbjct: 244 KVGETYNIGGHNEKTNIKVVRAICQLLEEFVPNKPNAIEKYEDLITYVTDRPGHDVRYAI 303

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           D+SKI +E+GW PQE  ESGL KTV WYL +  WW+ +
Sbjct: 304 DASKIANELGWQPQETFESGLRKTVQWYLTHRDWWQAI 341


>gi|295691454|ref|YP_003595147.1| dTDP-glucose 4,6-dehydratase [Caulobacter segnis ATCC 21756]
 gi|295433357|gb|ADG12529.1| dTDP-glucose 4,6-dehydratase [Caulobacter segnis ATCC 21756]
          Length = 355

 Score =  395 bits (1014), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 184/336 (54%), Positives = 241/336 (71%), Gaps = 2/336 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           +R++VTGG+GFIGSA+CR+L     + +L  DKLTYA +  SL  +     + F+Q D+ 
Sbjct: 6   LRVMVTGGSGFIGSAVCRHLAGQNDVAILNFDKLTYAASPASLAMLEGKADYQFVQGDVA 65

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           + E +  A++ F+P+ I++ AAESHVDRSI G  EFI TNI+GT+++L+     W  L  
Sbjct: 66  NAEAVSRAIQAFRPNVIMHLAAESHVDRSITGPGEFIQTNIVGTYVMLQAALEHWRALEG 125

Query: 121 DKKDQFRFLQISTDEVYGSLD-KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            +K+ FRF  ISTDEV+GSL  +GLFSE  PY+P SPYSA+KASSD+L  AW HTYG+PV
Sbjct: 126 AEKEAFRFHHISTDEVFGSLGPEGLFSETTPYDPRSPYSASKASSDHLARAWHHTYGLPV 185

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           ++SNCSNNYGPYHFPEKLIPL     +EG  + +YG G NVRDWL+VEDH RAL+L+  +
Sbjct: 186 VVSNCSNNYGPYHFPEKLIPLVTLNALEGKPLPVYGKGDNVRDWLHVEDHARALHLIATR 245

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIP-KSYSHTELIRFIEDRPGHDRRYAIDS 298
           G  GE YN+GG NER N+ +V  I  +LD L P +  +  ELI F+ DRPGHD RYAID+
Sbjct: 246 GVPGESYNVGGRNERTNLQVVEAICDVLDELRPLQGRTRRELITFVADRPGHDARYAIDA 305

Query: 299 SKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           +K+++E+GW  QE  E+GL KTV WYLDN  WW PL
Sbjct: 306 TKLEAELGWKAQETFETGLRKTVQWYLDNEAWWAPL 341


>gi|307544986|ref|YP_003897465.1| dTDP-glucose 4,6-dehydratase [Halomonas elongata DSM 2581]
 gi|307217010|emb|CBV42280.1| dTDP-glucose 4,6-dehydratase [Halomonas elongata DSM 2581]
          Length = 353

 Score =  395 bits (1014), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 186/337 (55%), Positives = 243/337 (72%), Gaps = 5/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+ +VTGGAGFIGSA+ R L+N+   +V+ +DKLTYAGNL SL  +S +  ++F+Q DIC
Sbjct: 1   MKFLVTGGAGFIGSAVVRELINETDHEVVNVDKLTYAGNLESLDSVSNNIRYNFVQADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   I    ++ QPD +++ AAESHVDRSI G  EF+ TN++GT +LLE  R +W  L +
Sbjct: 61  DAPAINKLFEKHQPDVVMHLAAESHVDRSIDGPAEFVQTNVVGTTVLLEAARNYWKELKK 120

Query: 121 ---DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTY 175
              +K   FRF  +STDEVYG LD  K LF+ED PY PSSPYSA+KA SD+LV +W  T+
Sbjct: 121 SDPEKARGFRFHHVSTDEVYGDLDETKALFTEDTPYAPSSPYSASKAGSDHLVRSWYRTF 180

Query: 176 GIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYL 235
           G+P L++NCSNNYGPYHFPEKLIPL I   + G  + +YGDG+ VRDWLYVEDH RAL  
Sbjct: 181 GMPTLVTNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGDGKQVRDWLYVEDHARALVK 240

Query: 236 VLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYA 295
           V  +G +GE YNIGG+NE+ N+++V  +  LL  L+P    + +LI F+ DRPGHD RYA
Sbjct: 241 VAVEGEVGETYNIGGHNEKTNLEVVETLCSLLQELVPNDNLYRDLITFVTDRPGHDLRYA 300

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+ KI+ E+GW P+E  E+GL KTV WYL+N  WW+
Sbjct: 301 IDAGKIERELGWTPRETFETGLRKTVYWYLENTDWWK 337


>gi|292492255|ref|YP_003527694.1| dTDP-glucose 4,6-dehydratase [Nitrosococcus halophilus Nc4]
 gi|291580850|gb|ADE15307.1| dTDP-glucose 4,6-dehydratase [Nitrosococcus halophilus Nc4]
          Length = 358

 Score =  395 bits (1014), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 190/331 (57%), Positives = 242/331 (73%), Gaps = 3/331 (0%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           L++TGGAGFIGSA+ R+ + +   +V+ +DKLTYAGNL SL+ I+    + F+  DICD 
Sbjct: 6   LLITGGAGFIGSAVVRHFIENTDQRVINVDKLTYAGNLESLESIAFHPRYEFVHADICDG 65

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             +     +++P A+++ AAESHVDRSI    +FI TNI GT+ LLE    +W  L +  
Sbjct: 66  GAMAQLFAQYRPHAVLHLAAESHVDRSIDSPVDFINTNITGTYTLLETALDYWRKLDKSA 125

Query: 123 KDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLL 181
           + QFRF  ISTDEV+GSL + GLF ED PY P+SPY+A+KA+SD+LV AW HTYG+PVL+
Sbjct: 126 QAQFRFHHISTDEVFGSLGETGLFHEDSPYQPNSPYAASKAASDHLVRAWHHTYGLPVLI 185

Query: 182 SNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKGR 241
           +NCSNNYGPY FPEKLIPL +   IEG  + +YG G NVRDWLYVEDHVRAL +VL +G+
Sbjct: 186 TNCSNNYGPYQFPEKLIPLMVLNGIEGKPLPVYGAGDNVRDWLYVEDHVRALQIVLTEGQ 245

Query: 242 IGERYNIGGNNERKNIDIVFEIGFLLDALIPKS--YSHTELIRFIEDRPGHDRRYAIDSS 299
            GE YNIGG+NE+ NI++V  I  LLD L+P+S    H  LI F+ DRPGHDRRYAID+ 
Sbjct: 246 PGETYNIGGHNEQTNIEVVELICQLLDELLPESPHRPHRSLITFVSDRPGHDRRYAIDAG 305

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           KI SE+GW PQE  E+GL KT+ WYLDN  W
Sbjct: 306 KIASELGWRPQETFETGLRKTLQWYLDNQKW 336


>gi|310766118|gb|ADP11068.1| DTDP-glucose 4,6-dehydratase [Erwinia sp. Ejp617]
          Length = 355

 Score =  395 bits (1014), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 185/337 (54%), Positives = 246/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R++VTGGAGFIGSA+ R++++    +VLV+DKL+YAGNL SL  ++ +  F+F +VDICD
Sbjct: 3   RILVTGGAGFIGSAVVRHILSSTPDRVLVLDKLSYAGNLASLAPVADNPRFAFSKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +  A+  FQP  I++ AAESHVDRSI G   F+ TN++GT+++LE  R +W  L   
Sbjct: 63  RVALDGAIAAFQPQLIMHLAAESHVDRSIDGPLPFVETNVVGTYMMLEAARHYWISLPAP 122

Query: 122 KKDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           +K  F F  ISTDEV+G L  D   F+E  PY PSSPYSATKASSD+LV AW  TYG+PV
Sbjct: 123 EKANFVFHHISTDEVFGDLENDTDFFTETTPYAPSSPYSATKASSDHLVRAWHRTYGLPV 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I   + G  + +YGDG  +RDWLYV+DH RALY V+  
Sbjct: 183 IVTNCSNNYGPYHFPEKLIPLMIINALAGKPLPVYGDGGQIRDWLYVDDHARALYQVVTA 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG++ER+NID+V  +  LL+ L P+  +    + +LI  + DRPGHDRRYA
Sbjct: 243 GKVGETYNIGGHSERRNIDVVETLCALLEELAPEKPAGLGHYRDLITRVADRPGHDRRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+ KI+ E+GW PQE  ESG+ KTV W+++N  WW+
Sbjct: 303 IDAGKIERELGWRPQETFESGMRKTVSWFINNPAWWQ 339


>gi|114799940|ref|YP_759518.1| dTDP-glucose 4,6-dehydratase [Hyphomonas neptunium ATCC 15444]
 gi|114740114|gb|ABI78239.1| dTDP-glucose 4,6-dehydratase [Hyphomonas neptunium ATCC 15444]
          Length = 365

 Score =  395 bits (1014), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 185/339 (54%), Positives = 247/339 (72%), Gaps = 1/339 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           ++++VTGGAGFIGSAL R+L++    +V V+DKLTYA NL+SL  +S S  ++F++ DIC
Sbjct: 8   VKVLVTGGAGFIGSALVRHLIDTTHARVTVVDKLTYAANLDSLAPVSASPRYTFIREDIC 67

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +   +R      +PD +++ AAE+HVDRSI G+ +FI TNI GT+ LLE  R   +  S 
Sbjct: 68  NAPAMRDIFLAERPDYVLHLAAETHVDRSISGSQQFIQTNINGTYNLLEAARALQAERSG 127

Query: 121 DKKDQFRFLQISTDEVYGSLDK-GLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           D + +FRFL +STDEVYGSL   GLFSE   Y+PSSPYSA+KA+SD+L  AW  TYG+PV
Sbjct: 128 DLRSRFRFLHVSTDEVYGSLGPDGLFSETTAYDPSSPYSASKAASDHLAKAWHRTYGLPV 187

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           ++SNCSNNYGPYHFPEKLIPL I   +EG  + +YGDG N+RDWL+VEDH RAL+ +   
Sbjct: 188 IVSNCSNNYGPYHFPEKLIPLIILNALEGQRLPVYGDGSNIRDWLHVEDHARALWRIATT 247

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSS 299
           GR GE YN+GG NER N+ +V  I  LLD L P +    ELI F+ DRPGHD+RYAID++
Sbjct: 248 GRPGETYNVGGLNERTNLQVVHTICDLLDELRPANRPRRELIEFVSDRPGHDQRYAIDAA 307

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKEL 338
           K+++E+GW  +E  ++G+ KTV WY+D+  WW PL K +
Sbjct: 308 KLQTELGWKAEETFDTGIRKTVEWYIDHPEWWGPLRKSV 346


>gi|319784646|ref|YP_004144122.1| dTDP-glucose 4,6-dehydratase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317170534|gb|ADV14072.1| dTDP-glucose 4,6-dehydratase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 356

 Score =  394 bits (1013), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 190/341 (55%), Positives = 243/341 (71%), Gaps = 4/341 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M  +VTGGAGFIGSA+CR+L  +   +V  +DKLTYAGNL SL+ I  ++ + F Q DIC
Sbjct: 1   MNFLVTGGAGFIGSAVCRHLCANPAYRVTNLDKLTYAGNLASLRPIENAHNYRFAQADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +   L+    D ++N AAESHVDRSI G   FI TNI+GT+ +L     +W  L +
Sbjct: 61  DERAVLDILRRDDIDIVMNLAAESHVDRSIDGPGTFIETNIVGTYKMLNAALEYWRGLPE 120

Query: 121 DKKDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           D+K  FRF  +STDEV+G L  D G+F E+ PY PSSPYSA+KA+SD+LV AW  TYG+P
Sbjct: 121 DRKSHFRFHHVSTDEVFGDLPFDGGMFVEETPYAPSSPYSASKAASDHLVRAWHETYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+LSNCSNNYGPYHFPEKLIPL I   ++   + +YG G NVRDWL+VEDH RAL LV  
Sbjct: 181 VVLSNCSNNYGPYHFPEKLIPLVILNALDEKPLPVYGAGANVRDWLFVEDHARALELVAT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS--YSHTELIRFIEDRPGHDRRYAI 296
           +G  GE YN+GGN+ER N+ +V  I  LLD+  P++   S+ +LI F+ DRPGHDRRYAI
Sbjct: 241 RGLSGESYNVGGNSERTNLGVVETICDLLDSRRPRAGGKSYRDLISFVTDRPGHDRRYAI 300

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKE 337
           D+SKI  ++GW P EN +SGL KTV W+LDN WWW P+ ++
Sbjct: 301 DASKIGRDLGWTPNENFDSGLAKTVDWFLDNKWWWGPIREQ 341


>gi|188532358|ref|YP_001906155.1| DTDP-glucose 4,6-dehydratase [Erwinia tasmaniensis Et1/99]
 gi|188027400|emb|CAO95247.1| DTDP-glucose 4,6-dehydratase [Erwinia tasmaniensis Et1/99]
          Length = 355

 Score =  394 bits (1013), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 185/337 (54%), Positives = 245/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R++VTGGAGFIGSA+ R++++  + +VLV+DKL+YAGNL SL  ++ +  F+F +VDICD
Sbjct: 3   RILVTGGAGFIGSAVVRHILSSTQDRVLVLDKLSYAGNLASLDPVADNPRFTFKKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  + + +  FQP  I++ AAESHVDRSI G   F+ TNI+GT+++LE  R +W+ L   
Sbjct: 63  RAALDAEVAAFQPQLIMHLAAESHVDRSIDGPLAFVETNIVGTYMMLESARHYWASLPAP 122

Query: 122 KKDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           +K  F F  ISTDEV+G L  D   F+E  PY PSSPYSATKASSD+LV AW  TYG+PV
Sbjct: 123 EKSAFIFHHISTDEVFGDLENDTDFFTETTPYAPSSPYSATKASSDHLVRAWYRTYGLPV 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I   + G  + +YGDG  +RDWLYV+DH RALY V+  
Sbjct: 183 IVTNCSNNYGPYHFPEKLIPLMIINALAGKPLPVYGDGGQIRDWLYVDDHARALYQVVTT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
           G+ GE YNIGG+NER+NID++  +  LL+ L P+       + +LI  + DRPGHDRRYA
Sbjct: 243 GKAGETYNIGGHNERRNIDVIETLCALLEELAPQKPRGLLYYRDLITRVTDRPGHDRRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+ KI+ E+GW PQE  ESG+ KTV W++ N  WW+
Sbjct: 303 IDAGKIERELGWRPQETFESGMRKTVSWFIHNPAWWQ 339


>gi|260774439|ref|ZP_05883353.1| dTDP-glucose 4,6-dehydratase [Vibrio metschnikovii CIP 69.14]
 gi|260610566|gb|EEX35771.1| dTDP-glucose 4,6-dehydratase [Vibrio metschnikovii CIP 69.14]
          Length = 380

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 188/363 (51%), Positives = 249/363 (68%), Gaps = 33/363 (9%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL  I+ S  ++F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVIRHIIQNTQDSVVNLDKLTYAGNLESLALIADSERYAFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +R  +     + QPDA+++ AAESHVDRSI G   FI TNI+GT+ LLE TR +W+ L +
Sbjct: 61  NRAELDRVFAQHQPDAVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEATRSYWNRLDE 120

Query: 121 DKKDQFRFLQISTDEVYGSLDK---------------------------------GLFSE 147
           + K  FRF  ISTDEVYG L                                    LF+E
Sbjct: 121 EHKAAFRFHHISTDEVYGDLPHPDEVENNDECLMVNGELTQDNSTLSINNSLPHLPLFTE 180

Query: 148 DMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIE 207
              Y PSSPYSA+KASSD+LV AW  TYG+P +++NCSNNYGPYHFPEKLIPL I   +E
Sbjct: 181 TTAYAPSSPYSASKASSDHLVRAWLRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALE 240

Query: 208 GSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLL 267
           G  + +YG G  +RDWL+VEDH RALY V+ +G++GE YNIGG+NE++N+++V  I  +L
Sbjct: 241 GKDLPIYGKGDQIRDWLFVEDHARALYKVVTEGKVGETYNIGGHNEKQNLEVVQAICSIL 300

Query: 268 DALIPKSYSHTELIRFIEDRPGHDRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDN 327
           D L+PK+  + E I +++DRPGHDRRYAID+SK+++E+GW P E  E+GL KTV WYLDN
Sbjct: 301 DTLVPKARPYAEQITYVQDRPGHDRRYAIDASKMQNELGWTPLETFETGLLKTVQWYLDN 360

Query: 328 NWW 330
             W
Sbjct: 361 QQW 363


>gi|160876139|ref|YP_001555455.1| dTDP-glucose 4,6 dehydratase [Shewanella baltica OS195]
 gi|160861661|gb|ABX50195.1| dTDP-glucose 4,6-dehydratase [Shewanella baltica OS195]
 gi|315268335|gb|ADT95188.1| dTDP-glucose 4,6-dehydratase [Shewanella baltica OS678]
          Length = 359

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 187/343 (54%), Positives = 246/343 (71%), Gaps = 13/343 (3%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL  ++ +  ++F +VDIC
Sbjct: 1   MKVLVTGGAGFIGSAVVRHIICNTQDSVINVDKLTYAGNLESLTSVADNARYTFEKVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     ++QPDAI++ AAESHVDRSI G  +FI TNIIGT+ LLE  R +W  L  
Sbjct: 61  DRGELDRIFLQYQPDAIMHLAAESHVDRSITGPSDFIQTNIIGTYTLLEAARHYWIQLDS 120

Query: 121 DKKDQFRFLQISTDEVYGSL-------------DKGLFSEDMPYNPSSPYSATKASSDYL 167
           ++K  FRF  ISTDEVYG L             +  LF+E  PY PSSPYSA+KASSD+L
Sbjct: 121 ERKAAFRFHHISTDEVYGDLPHPDEHEGQVVNQELPLFTETTPYAPSSPYSASKASSDHL 180

Query: 168 VLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVE 227
           V AW  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVE
Sbjct: 181 VRAWLRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPIYGKGDQIRDWLYVE 240

Query: 228 DHVRALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDR 287
           DH RALY V+ +G++GE YNIGG+NE++N+++V  I  +LD L+PK   + E I ++ DR
Sbjct: 241 DHARALYKVVTEGKVGETYNIGGHNEKRNLEVVQTICSILDVLMPKGTPYAEQITYVTDR 300

Query: 288 PGHDRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
            GHDRRYAID+SK+ +E+ W PQE  E+GL KTV WYL N  W
Sbjct: 301 LGHDRRYAIDASKMSAELNWQPQETFETGLLKTVEWYLANQEW 343


>gi|328471767|gb|EGF42644.1| dTDP-glucose 4,6-dehydratase [Vibrio parahaemolyticus 10329]
          Length = 354

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 187/338 (55%), Positives = 244/338 (72%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++++TGGAGFIGSA+ R+++ D +  V+ +DKLTYAGNL SL +++ S+ + F QVDIC
Sbjct: 1   MKILITGGAGFIGSAVVRHIIRDTQDSVVNLDKLTYAGNLESLVDVADSDRYYFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     E QPD +++ AAESHVDRSI G   FI TN++GT+ LLE  R +WS L +
Sbjct: 61  DRTELDRVFSEHQPDMVMHLAAESHVDRSIDGPAAFIETNVMGTYHLLEAARQYWSSLEE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
             +  FRF  ISTDEVYG L+    LF+E   Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 ANQSAFRFHHISTDEVYGDLEGTDDLFTETTSYAPSSPYSASKASSDHLVRAWQRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            L++NCSNNYGPYHFPEKLIPL I   ++G  + +YGDG  +RDWL+VEDH RALY V+ 
Sbjct: 181 TLVTNCSNNYGPYHFPEKLIPLMILNALDGKPLPVYGDGMQIRDWLFVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRY 294
           +G IGE YNIGG+NE+ NI++V  I  LL+ L P       S+  LI +++DRPGHD RY
Sbjct: 241 EGEIGETYNIGGHNEKANIEVVKTICALLEELRPDKPAGVESYESLITYVKDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID++KI  E+ W P+E  ESG+ KTV WYL+N  WW+
Sbjct: 301 AIDATKIAQELNWTPEETFESGIRKTVEWYLNNPQWWQ 338


>gi|24374701|ref|NP_718744.1| dTDP-glucose 4,6 dehydratase [Shewanella oneidensis MR-1]
 gi|24349353|gb|AAN56188.1|AE015756_9 dTDP-glucose 4,6-dehydratase [Shewanella oneidensis MR-1]
          Length = 375

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 185/358 (51%), Positives = 247/358 (68%), Gaps = 28/358 (7%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL  ++ S  ++F +VDIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIIGNTQDCVVNVDKLTYAGNLESLTSVADSPRYTFEKVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +       QPDA+++ AAESHVDRSI G+ +FI TNI+GT+ LLE  R +W  L+ 
Sbjct: 61  DRTELERVFSLHQPDAVMHLAAESHVDRSITGSADFIQTNIVGTYTLLEAARHYWMQLNT 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------------------------LFSEDMPYN 152
           ++K  FRF  ISTDEVYG L                               LF+E  PY 
Sbjct: 121 ERKSAFRFHHISTDEVYGDLPHPDEINVECSMLNDECKDHSTLNIQHSTLPLFTETTPYT 180

Query: 153 PSSPYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVF 212
           PSSPYSA+KASSD+LV AW  TYG P +++NCSNNYGPYHFPEKLIPL I   +EG  + 
Sbjct: 181 PSSPYSASKASSDHLVRAWLRTYGFPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKPLP 240

Query: 213 LYGDGQNVRDWLYVEDHVRALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIP 272
           +YG G  +RDWLYVEDH RAL+ V+ +G++GE YNIGG+NE++N+++V  I  +LD+L+P
Sbjct: 241 IYGKGDQIRDWLYVEDHARALFKVVTEGKVGETYNIGGHNEKRNLEVVQTICSILDSLVP 300

Query: 273 KSYSHTELIRFIEDRPGHDRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           K+  + E I ++ DRPGHDRRYAID++K+ +E+ W PQE  E+GL KTV WYL N  W
Sbjct: 301 KNTPYAEQIAYVADRPGHDRRYAIDATKMSAELDWQPQETFETGLRKTVEWYLANQEW 358


>gi|292486663|ref|YP_003529533.1| dTDP-glucose 4,6-dehydratase [Erwinia amylovora CFBP1430]
 gi|292897900|ref|YP_003537269.1| dTDP-glucose 4,6-dehydratase [Erwinia amylovora ATCC 49946]
 gi|291197748|emb|CBJ44843.1| dTDP-glucose 4,6-dehydratase [Erwinia amylovora ATCC 49946]
 gi|291552080|emb|CBA19117.1| dTDP-glucose 4,6-dehydratase [Erwinia amylovora CFBP1430]
 gi|312170729|emb|CBX78991.1| dTDP-glucose 4,6-dehydratase [Erwinia amylovora ATCC BAA-2158]
          Length = 362

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 184/337 (54%), Positives = 244/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R++VTGGAGFIGSA+ R++++    +VLV+DKL+YAGNL SL  ++ +  F+F + DICD
Sbjct: 3   RILVTGGAGFIGSAVVRHILSSSSDRVLVLDKLSYAGNLASLAPVADNPRFTFSKTDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +  A+  FQP  I++ AAESHVDRSI G   F+ TN++GT ++LE  R +W  L   
Sbjct: 63  RAALDGAIAAFQPQLIMHLAAESHVDRSIDGPRAFVETNVVGTCMMLEAARHYWLSLPAP 122

Query: 122 KKDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           +K  F F  ISTDEV+G L  D   F+E  PY PSSPYSATKASSD+LV AW  TYG+PV
Sbjct: 123 EKSTFVFHHISTDEVFGDLANDTDFFTETTPYAPSSPYSATKASSDHLVRAWHRTYGLPV 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I   + G  + +YGDG  +RDWLYV+DH RALY V+  
Sbjct: 183 IVTNCSNNYGPYHFPEKLIPLMIINALAGKPLPVYGDGGQIRDWLYVDDHARALYQVVTA 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
           GR+GE YNIGG+N+R+NID+V  +  LL+ L P+  +    + +LI  + DRPGHDRRYA
Sbjct: 243 GRVGETYNIGGHNQRRNIDVVETLCALLEELAPEKPAGLRHYRDLITRVADRPGHDRRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+ KI+ E+GW PQE  ESG+ KTV W++++  WW+
Sbjct: 303 IDAGKIERELGWRPQETFESGMRKTVSWFINHPAWWQ 339


>gi|262163805|ref|ZP_06031545.1| dTDP-glucose 4,6-dehydratase [Vibrio mimicus VM223]
 gi|262027785|gb|EEY46450.1| dTDP-glucose 4,6-dehydratase [Vibrio mimicus VM223]
          Length = 354

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 186/337 (55%), Positives = 249/337 (73%), Gaps = 6/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++   K  V+ +DKLTYAGNL SL ++     ++F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIILRTKDVVVNLDKLTYAGNLESLCDVDGHERYTFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +RE +     E QPDA+++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L  
Sbjct: 61  NREQLDRVFAEHQPDAVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARHYWNSLED 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           ++K  FRF  ISTDEVYG L+    LF+E+ PY PSSPYSA+KASSD+LV +W  TYG P
Sbjct: 121 ERKLTFRFHHISTDEVYGDLEGTDDLFTEETPYAPSSPYSASKASSDHLVRSWLRTYGFP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG+G  +RDWL+VEDH RALY V+ 
Sbjct: 181 TIVTNCSNNYGPYHFPEKLIPLMILNALEGKALPVYGNGMQIRDWLFVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G++GE YNIGG+NE+ NI++V  +  LL+ L+P   +    +T+LI +++DRPGHD RY
Sbjct: 241 EGQVGETYNIGGHNEKANIEVVETLCTLLEELVPNKPTGITYYTDLITYVKDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           AID+SKI+ ++GW P+E  ESG+ KTV WYL +  WW
Sbjct: 301 AIDASKIERDLGWKPEETFESGIRKTVEWYLSHREWW 337


>gi|88800554|ref|ZP_01116116.1| dTDP-glucose 4,6-dehydratase [Reinekea sp. MED297]
 gi|88776699|gb|EAR07912.1| dTDP-glucose 4,6-dehydratase [Reinekea sp. MED297]
          Length = 353

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 185/331 (55%), Positives = 238/331 (71%), Gaps = 2/331 (0%)

Query: 4   IVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRE 63
           +VTGGAGFIGSA+ R L+     +V+ +DKLTYAGNL SL E+  S  + F + DICD  
Sbjct: 7   LVTGGAGFIGSAVVRELIKQGNTKVVNVDKLTYAGNLESLTEVENSPNYVFEKADICDAT 66

Query: 64  CIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKK 123
            +     ++QP A+++ AAESHVDRSI G  EFI TNI+GT+ LLE  R +WS L + ++
Sbjct: 67  AMAKLFSQYQPTAVMHLAAESHVDRSIDGPAEFIQTNIVGTYTLLEAARSYWSELPESQQ 126

Query: 124 DQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLL 181
             FRF  ISTDEVYG L     LF+E   Y PSSPYSA+KASSD+LV AW  T+G+P ++
Sbjct: 127 QAFRFHHISTDEVYGDLHGTNDLFTETTSYAPSSPYSASKASSDHLVRAWQRTFGLPTVV 186

Query: 182 SNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKGR 241
           +NCSNNYGPYHFPEKLIPL I   +EG  + +YGDGQ +RDWL+VEDH RAL  V+ +G 
Sbjct: 187 TNCSNNYGPYHFPEKLIPLVIINALEGKPLPVYGDGQQIRDWLFVEDHARALIKVVSEGE 246

Query: 242 IGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSSKI 301
           +GE YNIGG+NE+ N+ +V  I  +LD L+P +    ELI F++DRPGHD RYAID+SKI
Sbjct: 247 VGETYNIGGHNEQTNLSVVEGICDILDELVPANTPRRELITFVKDRPGHDVRYAIDASKI 306

Query: 302 KSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           + E+GW P E  ++GL KTV WYL+N  WW+
Sbjct: 307 ERELGWTPAETFDTGLRKTVEWYLNNKDWWQ 337


>gi|308388298|gb|ADO30618.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis alpha710]
          Length = 358

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 187/335 (55%), Positives = 245/335 (73%), Gaps = 6/335 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL +I+ +  ++F QVDICDR
Sbjct: 9   ILVTGGAGFIGSAVVRHIIQNTQDSVVNLDKLTYAGNLESLTDIADNPRYAFEQVDICDR 68

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             +     + +PDA+++ AAESHVDRSI  A EFI TNIIGTF LLE  R +   +  ++
Sbjct: 69  AELDRVFAQHRPDAVMHLAAESHVDRSIDSAGEFIQTNIIGTFNLLEAARAYRRQMPSEQ 128

Query: 123 KDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           ++ FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P +
Sbjct: 129 REAFRFHHISTDEVYGDLHGTDDLFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPTI 188

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           ++NCSNNYGPYHFPEKLIPL I   ++G  + +YGDG  +RDWL+VEDH RALY V+ +G
Sbjct: 189 VTNCSNNYGPYHFPEKLIPLMILNALDGKPLPVYGDGMQIRDWLFVEDHARALYQVVTEG 248

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYAI 296
            IGE YNIGG+NE+ NI++V  I  LL+ L+P        + +LI +++DRPGHD RYAI
Sbjct: 249 EIGETYNIGGHNEKANIEVVRTICALLEELVPNKPQGVARYEDLITYVKDRPGHDVRYAI 308

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           D++KI  E+GW PQE  ESG+ KTV WYL+N  WW
Sbjct: 309 DAAKIGRELGWQPQETFESGIRKTVEWYLNNQTWW 343


>gi|323964035|gb|EGB59525.1| dTDP-glucose 4,6-dehydratase [Escherichia coli M863]
          Length = 355

 Score =  393 bits (1010), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 197/337 (58%), Positives = 248/337 (73%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS+ F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETNDAVVVVDKLTYAGNLMSLAPVAQSDRFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNALAED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY+PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYSPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V+  
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVVTT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+++V  I  LL+ L P        + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLEVVETICELLEELAPNKPHGVAHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+
Sbjct: 303 IDASKIARELGWLPQETFESGMRKTVQWYLANESWWK 339


>gi|222087847|ref|YP_002546385.1| dTDP-glucose 4,6-dehydratase [Agrobacterium radiobacter K84]
 gi|221725295|gb|ACM28451.1| dTDP-glucose 4,6-dehydratase [Agrobacterium radiobacter K84]
          Length = 352

 Score =  393 bits (1010), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 187/333 (56%), Positives = 244/333 (73%), Gaps = 3/333 (0%)

Query: 4   IVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRE 63
           +VTGGAGFIGSA+CRYL+++    V+ +D LTYAG+L SL  I  +  FS +Q DI D  
Sbjct: 6   MVTGGAGFIGSAVCRYLIDETDYDVVNLDLLTYAGDLRSLDSIKSNPRFSTIQGDIGDSA 65

Query: 64  CIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKK 123
            +   L+  +P  I++ AAESHVDRSI GA  FI TNI+GTF LLE  R +WS L   ++
Sbjct: 66  LVGEILQRHRPSVILHLAAESHVDRSIDGAAPFIETNIVGTFRLLEAVRAYWSALPAAEQ 125

Query: 124 DQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLLS 182
            +FRFL +STDEVYG+L D+GLFSE  PY+P+SPYSA+KA+SD+LV AW HTYG+P+++S
Sbjct: 126 TEFRFLHVSTDEVYGTLGDEGLFSETTPYSPNSPYSASKAASDHLVNAWHHTYGLPIVIS 185

Query: 183 NCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKGRI 242
           NCSNNYGP+ FPEKLIP  IT  +E   + +YG G NVRDWL+V+DH  AL+LV  KGR+
Sbjct: 186 NCSNNYGPFQFPEKLIPRMITTALEHGSLPVYGAGNNVRDWLHVDDHASALWLVATKGRL 245

Query: 243 GERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS--HTELIRFIEDRPGHDRRYAIDSSK 300
           GE+YNIGG NER+N+D+V  I  LLD L P +    +  LI ++ DR GHD RYAID++K
Sbjct: 246 GEKYNIGGRNERRNVDVVRTICSLLDELGPPAPQGRYESLITYVTDRLGHDHRYAIDATK 305

Query: 301 IKSEIGWFPQENMESGLNKTVCWYLDNNWWWRP 333
           I++E+GW  + + + GL  T+ WYL N WWWRP
Sbjct: 306 IETELGWKAKYDFDHGLRATILWYLSNEWWWRP 338


>gi|189092398|gb|ACD75799.1| dTDP-glucose 4,6 dehydratase [Escherichia coli]
          Length = 358

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 185/340 (54%), Positives = 249/340 (73%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++IVTGGAGFIGSAL ++++++    VLV+DKLTYAGNL +L+ IS +N + F+  DIC
Sbjct: 1   MKIIVTGGAGFIGSALVKFIIDNTADHVLVLDKLTYAGNLLNLESISDNNRYQFINCDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     +++PDAI++ AAESHVDRSI  +  FI TNIIGT+ LL  ++ +W  LS 
Sbjct: 61  DVVAVEKIFLDYKPDAIMHLAAESHVDRSISSSAVFIDTNIIGTYNLLNVSKEYWMQLSN 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           +KK QFRF  ISTDEVYG L             LF+ED  Y PSSPYSA+KASSD+LV A
Sbjct: 121 EKKTQFRFHHISTDEVYGDLPHPDEFESISKLPLFTEDCAYKPSSPYSASKASSDHLVNA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TY +P +++NCSNNYGP+ +PEKLIP++I   ++G  +F+YG G  +RDWLYV DHV
Sbjct: 181 WHRTYSLPTVITNCSNNYGPFQYPEKLIPMSIINALQGEDIFIYGKGDQIRDWLYVYDHV 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
            ALYLVL  GR+G+ YNIGGNNE++NI++V  I  +LD + PK+ ++ + I+F+ DRPGH
Sbjct: 241 EALYLVLTNGRVGQTYNIGGNNEKRNIEVVETICKILDEIKPKNGTYQDQIKFVNDRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+SKIK E+ W P+E+  +G+ KT+ WYL+N  W
Sbjct: 301 DRRYAIDASKIKKELNWIPKESFYTGIRKTIKWYLNNLDW 340


>gi|319424473|gb|ADV52547.1| dTDP-glucose 4,6-dehydratase [Shewanella putrefaciens 200]
          Length = 363

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 185/347 (53%), Positives = 248/347 (71%), Gaps = 17/347 (4%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++++TGGAGFIGSA+ R+++ +    V+ +DKLTYAGNL SL  +++   ++F +VDIC
Sbjct: 1   MKVLITGGAGFIGSAVVRHIIKNTTDSVINLDKLTYAGNLESLSSVAEDIRYNFEKVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     ++QPD +++ AAESHVDRSI G  +FI TNI+GT+ LLE +R +W  L  
Sbjct: 61  DRTELGRVFNQYQPDVVMHLAAESHVDRSITGPSDFIQTNIVGTYTLLEASRQYWMELDV 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           ++K +FRF  ISTDEVYG L             LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 ERKARFRFHHISTDEVYGDLPHPDEMGIGESLPLFTESTSYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+PV+++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WLRTYGLPVIVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIP---KSY----SHTELIRF 283
           RALY V+ +G+IGE YNIGG NE++NI++V  I  ++D L+P   + Y    SH+ LI +
Sbjct: 241 RALYKVVTEGKIGETYNIGGQNEKQNIEVVNSICAIMDELVPLHERGYPLNTSHSTLITY 300

Query: 284 IEDRPGHDRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           + DRPGHDRRYAID++K+  E+ W PQE  E+GL KT+ WYL+N  W
Sbjct: 301 VTDRPGHDRRYAIDATKMSRELNWRPQETFETGLRKTIEWYLNNQEW 347


>gi|192288553|ref|YP_001989158.1| dTDP-glucose 4,6-dehydratase [Rhodopseudomonas palustris TIE-1]
 gi|192282302|gb|ACE98682.1| dTDP-glucose 4,6-dehydratase [Rhodopseudomonas palustris TIE-1]
          Length = 353

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 188/333 (56%), Positives = 237/333 (71%), Gaps = 3/333 (0%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R +VTGGAGFIGSA+ R L+     +VLV+DKLTYAGNL+SL  +S    F F++ DI +
Sbjct: 4   RFLVTGGAGFIGSAVVRRLIGTTPHEVLVVDKLTYAGNLDSLAPVSDDPRFRFVRADIVE 63

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           +  +R   +EF PD +++ AAESHVDRSI G  +FI TNI+GT+ LL+     W  L   
Sbjct: 64  QGTMRLLFEEFSPDVVMHLAAESHVDRSIDGPGDFIQTNIVGTYSLLQAALAHWRSLPAA 123

Query: 122 KKDQFRFLQISTDEVYGSLD-KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           +K  FRF  ISTDEV+GSL  +GLF ED PY P SPYSA+KA SD+LV AW HTYG+PV+
Sbjct: 124 RKSGFRFHHISTDEVFGSLGAEGLFREDTPYQPKSPYSASKAGSDHLVRAWHHTYGLPVV 183

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           ++NCSNNYGPYHFPEKLIPLAI + + G  + +YG G NVRDWL+VEDH  AL L  ++G
Sbjct: 184 ITNCSNNYGPYHFPEKLIPLAIIKALHGEAIPVYGTGANVRDWLHVEDHADALLLAAERG 243

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY--SHTELIRFIEDRPGHDRRYAIDS 298
             GE YNIGG NER N+++V  I  LLD L P +   S  +LI F+ DRPGHD RYAID+
Sbjct: 244 ENGESYNIGGRNERTNLEVVQAICRLLDELAPDAAIGSRAKLISFVADRPGHDARYAIDA 303

Query: 299 SKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           SK++ E+GW  + N + GL +TV WYLDN  WW
Sbjct: 304 SKVERELGWRARYNFDDGLRQTVQWYLDNRTWW 336


>gi|260460164|ref|ZP_05808416.1| dTDP-glucose 4,6-dehydratase [Mesorhizobium opportunistum WSM2075]
 gi|259033809|gb|EEW35068.1| dTDP-glucose 4,6-dehydratase [Mesorhizobium opportunistum WSM2075]
          Length = 366

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 190/341 (55%), Positives = 242/341 (70%), Gaps = 4/341 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M  +VTGGAGFIGSA+CR+L  +   +V  +DKLTYAGNL SL+ I  ++ +SF   DIC
Sbjct: 11  MNFLVTGGAGFIGSAVCRHLCANPAYRVTNLDKLTYAGNLASLRPIENAHNYSFAHADIC 70

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +   L+    D ++N AAESHVDRSI G   FI TNI+GT+ +L     +W  LS 
Sbjct: 71  DERAVLDILRRNDIDIVMNLAAESHVDRSIDGPGAFIETNIVGTYKILNAALEYWRGLSD 130

Query: 121 DKKDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           ++K +FRF  +STDEV+G L  D G+F E+ PY PSSPYSA+KA+SD+LV AW  TYG+P
Sbjct: 131 ERKGRFRFHHVSTDEVFGDLPFDGGMFVEETPYAPSSPYSASKAASDHLVRAWHETYGLP 190

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+LSNCSNNYGPYHFPEKLIPL I   ++   + +YG G NVRDWL+VEDH RAL LV  
Sbjct: 191 VVLSNCSNNYGPYHFPEKLIPLVILNALDEKPLPVYGAGANVRDWLFVEDHARALELVAT 250

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS--YSHTELIRFIEDRPGHDRRYAI 296
           KG  GE YN+GGN+ER N+ +V  I  LLD   P++    + +LI F+ DRPGHDRRYAI
Sbjct: 251 KGTPGESYNVGGNSERTNLAVVETICDLLDIRRPRADGKRYRDLIAFVTDRPGHDRRYAI 310

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKE 337
           D+SKI  E+GW P EN +SGL +TV W+LDN WWW P+ ++
Sbjct: 311 DASKIGRELGWTPSENFDSGLARTVDWFLDNKWWWGPIREQ 351


>gi|323974371|gb|EGB69499.1| dTDP-glucose 4,6-dehydratase [Escherichia coli TW10509]
          Length = 355

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 197/337 (58%), Positives = 248/337 (73%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS+ F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETNDAVVVVDKLTYAGNLMSLAPVAQSDRFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARIFTEHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNALAED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY+PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYSPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V+  
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVVTT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+++V  I  LL+ L P        + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLEVVETICELLEELAPNKPHGVAHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+SKI  E+GW PQE  ESG+ KTV WYL N  WW+
Sbjct: 303 IDASKIARELGWLPQETFESGMRKTVQWYLANESWWK 339


>gi|309378564|emb|CBX22836.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 355

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 185/336 (55%), Positives = 244/336 (72%), Gaps = 6/336 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL +I+ +  ++F QVDICDR
Sbjct: 9   ILVTGGAGFIGSAVVRHIIQNTQDSVVNLDKLTYAGNLESLTDIADNPRYAFEQVDICDR 68

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             +     + +PDA+++ AAESHVDRSI  A EFI TNI+GTF LLE  R +W  +  ++
Sbjct: 69  AELDRVFAQHRPDAVMHLAAESHVDRSIDSAGEFIQTNIVGTFNLLEAARAYWRQMPSEQ 128

Query: 123 KDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           ++ FRF  ISTDEVYG L     LF+E  PY PSSPY+A+KASSD+LV AW  TYG+P +
Sbjct: 129 REAFRFHHISTDEVYGDLGGTDDLFTETAPYAPSSPYAASKASSDHLVRAWQRTYGLPAI 188

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           +SNCSNNYGP  FPEKLIPL I   + G  + +YGDG  +RDWL+VEDH RALY ++ KG
Sbjct: 189 VSNCSNNYGPRQFPEKLIPLTILNALSGKPLPVYGDGMQIRDWLFVEDHARALYQLVSKG 248

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYAI 296
             GE YNIGG+NE+ N+++V  I  LL+ L P+  +    + +LI F++DRPGHD RYAI
Sbjct: 249 VAGETYNIGGHNEKTNLEVVKTICALLEELAPEKPAGVARYEDLITFVQDRPGHDVRYAI 308

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           D++KI  E+GW PQE  ESG+ KTV WYLDN  WW+
Sbjct: 309 DAAKIGRELGWEPQETFESGIRKTVQWYLDNKTWWQ 344


>gi|217426237|gb|ACK44397.1| dTDP-glucose 4,6 dehydratase [Escherichia coli]
          Length = 358

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 184/340 (54%), Positives = 249/340 (73%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++IVTGGAGFIGSAL ++++++    VLV+DKLTYAGNL +L+ IS +N + F+  DIC
Sbjct: 1   MKIIVTGGAGFIGSALVKFIIDNTADHVLVLDKLTYAGNLLNLESISDNNRYQFINCDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     +++PDAI++ AAESHVDRSI  +  FI TNIIGT+ LL  ++ +W  LS 
Sbjct: 61  DVVAVEKIFLDYKPDAIMHLAAESHVDRSISSSAVFIDTNIIGTYNLLNVSKEYWMQLSN 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           +KK QFRF  ISTDEVYG L             LF+ED  Y PSSPYSA+KASSD+LV A
Sbjct: 121 EKKTQFRFHHISTDEVYGDLPHPDEFESISKLPLFTEDCAYKPSSPYSASKASSDHLVNA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TY +P +++NCSNNYGP+ +PEKLIP++I   ++G  +F+YG G  +RDWLYV DHV
Sbjct: 181 WHRTYSLPTVITNCSNNYGPFQYPEKLIPMSIINALQGEDIFIYGKGDQIRDWLYVYDHV 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
            ALYLVL  GR+G+ YNIGGNNE++N+++V  I  +LD + PK+ ++ + I+F+ DRPGH
Sbjct: 241 EALYLVLTNGRVGQTYNIGGNNEKRNVEVVETICKILDEIKPKNGTYQDQIKFVNDRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+SKIK E+ W P+E+  +G+ KT+ WYL+N  W
Sbjct: 301 DRRYAIDASKIKRELNWIPKESFYTGIRKTIKWYLNNLDW 340


>gi|1098478|gb|AAC37049.1| dTDP-D-glucose 4,6-dehydratase [Neisseria meningitidis]
          Length = 355

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 185/337 (54%), Positives = 247/337 (73%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           +++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL +I+ +  ++F QVDICD
Sbjct: 3   KILVTGGAGFIGSAVVRHIIRNTQDSVVNLDKLTYAGNLESLTDIADNPRYAFEQVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     + +PDA+++ AAESHVDRSI  A EFI TNI+GTF LLE  R +W  +  +
Sbjct: 63  RAELDRVFAQHRPDAVMHLAAESHVDRSIGSAGEFIQTNIVGTFNLLEAARAYWQQMPSE 122

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           + + FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 QYEAFRFHHISTDEVYGDLSGTDDLFTETAPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYG YHFPEKLIPL I   ++G  + +YGDG  +RDWL+VEDH RALY V+ +
Sbjct: 183 IVTNCSNNYGLYHFPEKLIPLMILNALDGKPLPVYGDGMQIRDWLFVEDHARALYQVVTE 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NE+ NI++V  I  LL+ L P+  +    + +LI F++DRPGHD RYA
Sbjct: 243 GVVGETYNIGGHNEKANIEVVKTICALLEELAPEKPAGVARYEDLITFVQDRPGHDVRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           +D++KI+ ++GW P E  ESGL KTV WYLDN  WW+
Sbjct: 303 VDAAKIRRDLGWLPLETFESGLRKTVQWYLDNKTWWQ 339


>gi|33151864|ref|NP_873217.1| dTDP-D-glucose 4,6-dehydratase [Haemophilus ducreyi 35000HP]
 gi|4741795|gb|AAD28704.1|AF101047_5 putative dTDP-D-glucose 4,6-dehydratase [Haemophilus ducreyi]
 gi|33148085|gb|AAP95606.1| dTDP-D-glucose 4,6-dehydratase [Haemophilus ducreyi 35000HP]
          Length = 346

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 192/340 (56%), Positives = 240/340 (70%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+L++TGGAGFIGSA+ RY++N    +V+ +DKLTYAGNL SL  +SQ   ++F QVDI 
Sbjct: 1   MKLLITGGAGFIGSAVIRYIINHTDDEVINVDKLTYAGNLASLSSVSQHKRYTFEQVDIN 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   I      +QPD +++ AAESHVDRSI G+  FI TNIIGT+ LLE  R +W  L Q
Sbjct: 61  DSGRIAEIFYHYQPDKVMHLAAESHVDRSIEGSAPFIQTNIIGTYTLLETARSYWQSLDQ 120

Query: 121 DKKDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            KK QF F  ISTDEV+G L      F+E   Y PSSPYSA+KA+SD+LV AW  TYG+P
Sbjct: 121 QKKAQFLFHHISTDEVFGDLAHQPQRFTEQSAYMPSSPYSASKAASDHLVQAWYRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            ++S+CSNNYGPYHFPEKLIPL I   + G  + +YGDG  VRDWL+VEDH RALY V+K
Sbjct: 181 TVISHCSNNYGPYHFPEKLIPLTILNALSGKPLPVYGDGLQVRDWLFVEDHARALYKVIK 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIP------KSYSHTELIRFIEDRPGHDR 292
           +GR+GE YNIG +NER NI++V  I  LLD L+P      K+Y    LI  + DRPGHD 
Sbjct: 241 QGRVGESYNIGASNERTNIEVVQAICQLLDELVPVKPNGIKTYQ--ALITHVADRPGHDL 298

Query: 293 RYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           RYAID+SKI  ++GW PQE+  +GL KTV WYL +  WW+
Sbjct: 299 RYAIDASKITQQLGWQPQESFATGLRKTVEWYLAHKNWWQ 338


>gi|218550988|ref|YP_002384779.1| dTDP-glucose 4,6-dehydratase [Escherichia fergusonii ATCC 35469]
 gi|218358529|emb|CAQ91176.1| dTDP-glucose 4,6-dehydratase [Escherichia fergusonii ATCC 35469]
          Length = 355

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 196/337 (58%), Positives = 248/337 (73%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++++TGGAGFIGSAL RY++N+    V+V+DKLTYAGNL SL  ++QS+ F+F +VDICD
Sbjct: 3   KILITGGAGFIGSALVRYIINETNDAVVVVDKLTYAGNLMSLAPVAQSDRFAFEKVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++D
Sbjct: 63  RAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNALAED 122

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L      F+E  PY+PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSAFRFHHISTDEVYGDLHSTDDFFTETTPYSPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V+  
Sbjct: 183 LITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVVTT 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NERKN+++V  I  LL+ L P        + +LI F+ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNERKNLEVVETICELLEELAPNKPHGVAHYRDLITFVADRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID++KI  E+GW PQE  ESG+ KTV WYL N  WW+
Sbjct: 303 IDAAKIARELGWLPQETFESGMRKTVQWYLANESWWK 339


>gi|220935274|ref|YP_002514173.1| dTDP-glucose 4,6-dehydratase [Thioalkalivibrio sp. HL-EbGR7]
 gi|219996584|gb|ACL73186.1| dTDP-glucose 4,6-dehydratase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 350

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 182/333 (54%), Positives = 251/333 (75%), Gaps = 3/333 (0%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           L++TGGAGFIGSA+ R+L+++   +V+ +D+LTYAGNL+S+ E+S S+ ++F QVDI DR
Sbjct: 5   LLITGGAGFIGSAVVRHLIHNTDYRVVNLDRLTYAGNLDSVAEVSNSSRYAFEQVDIRDR 64

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             +    +E +P  +++ AAESHVDRSI G  +FI TNI+GT+ LLE +R +W+ L    
Sbjct: 65  RELDRVFREHRPAGVMHLAAESHVDRSIEGPADFIDTNIVGTYTLLEASRAYWNELEGQS 124

Query: 123 KDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLL 181
           K  FR+  ISTDEVYGSL + GLF+E+ PY P+SPYSA+KA+SD+LV AW HTYG+PV+ 
Sbjct: 125 KADFRYHHISTDEVYGSLGETGLFTEETPYAPNSPYSASKAASDHLVRAWHHTYGLPVVT 184

Query: 182 SNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKGR 241
           SNCSNNYGPY FPEKLIP  I   ++G  + +YGDG N+RDWLYV+DHVRAL  + ++GR
Sbjct: 185 SNCSNNYGPYQFPEKLIPHMILNALDGKPLPIYGDGSNIRDWLYVDDHVRALVRIFERGR 244

Query: 242 IGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY--SHTELIRFIEDRPGHDRRYAIDSS 299
           +GE YN+GG+NER N+++V  +  LL+ L+P+S    H +LI F++DRPGHDRRY +D +
Sbjct: 245 LGENYNVGGHNERTNLEVVNTLCDLLNELLPESVHRPHRKLISFVKDRPGHDRRYGMDIN 304

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           K++ E+GW P+   E+GL  TV WYL+N  W R
Sbjct: 305 KVRQELGWRPEWEFEAGLKMTVNWYLENGPWVR 337


>gi|302028136|gb|ADK90950.1| RfbB [Neisseria meningitidis]
          Length = 341

 Score =  392 bits (1006), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 183/332 (55%), Positives = 246/332 (74%), Gaps = 6/332 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           +++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL +I+ +  ++F QVDICD
Sbjct: 3   KILVTGGAGFIGSAVVRHIIRNTQDSVVNLDKLTYAGNLESLTDIADNPRYAFEQVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     + +PDA+++ AAESHVDRSI  A EFI TNI+GTF LLE  R +W  +  +
Sbjct: 63  RAELDRVFAQHRPDAVMHLAAESHVDRSIGSAGEFIQTNIVGTFNLLEAARAYWQQMPSE 122

Query: 122 KKDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           K++ FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KREAFRFHHISTDEVYGDLGGTDDLFTETAPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I   ++G  + +YGDG  +RDWL+VEDH RALY V+ +
Sbjct: 183 IVTNCSNNYGPYHFPEKLIPLMILNALDGKPLPVYGDGMQIRDWLFVEDHARALYQVVTE 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
           G  GE YNIGG+NE+ N++++  I  LL+ L+P+  +    + +LI F++DRPGHD RYA
Sbjct: 243 GVAGETYNIGGHNEKANLEVIKTICALLEELVPEKPAGVARYEDLITFVQDRPGHDARYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDN 327
           +D++KI+ ++GW P E  ESGL KTV WYLDN
Sbjct: 303 VDTAKIRRDLGWQPLETFESGLRKTVQWYLDN 334


>gi|149197652|ref|ZP_01874702.1| dTDP-D-glucose 4;6-dehydratase [Lentisphaera araneosa HTCC2155]
 gi|149139222|gb|EDM27625.1| dTDP-D-glucose 4;6-dehydratase [Lentisphaera araneosa HTCC2155]
          Length = 373

 Score =  392 bits (1006), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 196/357 (54%), Positives = 244/357 (68%), Gaps = 26/357 (7%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++IVTGGAGFIGSA+ R L+ +   +VL +DKLTYAGNL SL  +  S  + F QVDIC
Sbjct: 1   MKIIVTGGAGFIGSAVIRNLIENTNDEVLNLDKLTYAGNLESLTSVENSERYHFAQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCL-- 118
           DRE +    + FQPD I++ AAESHVDRSI G  EF+ TNIIGT+ LLE  R +W  L  
Sbjct: 61  DREAVEKVFEAFQPDIIMHLAAESHVDRSIDGPGEFMQTNIIGTYTLLEVARKYWEALPS 120

Query: 119 ----------SQDKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDY 166
                     S+  K  FRF  ISTDEVYG L+  + LF ED PY PSSPYSA+KASSD+
Sbjct: 121 RKVTGDRDQVSESTKKAFRFHHISTDEVYGDLEGPEDLFREDTPYAPSSPYSASKASSDH 180

Query: 167 LVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYV 226
           LV AW  TYG+PV+++NCSNNYGPYHFPEKLIPL     +    + +YGDG+ +RDWLYV
Sbjct: 181 LVRAWNRTYGLPVVITNCSNNYGPYHFPEKLIPLVTLNALAQKDLPVYGDGKQIRDWLYV 240

Query: 227 EDHVRALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIP------------KS 274
           +DH RAL LV KKG  GE YNIGG+NE++NI++V  I  +LD L P            K 
Sbjct: 241 DDHARALCLVAKKGSNGETYNIGGHNEKQNIEVVKTICSILDELAPLSENSSIQNSELKI 300

Query: 275 YSHTELIRFIEDRPGHDRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
            ++ +LI F++DRPGHD RYAID+ KI+ ++GW P+E  ESG+ KTV WYL N   W
Sbjct: 301 KNYEDLIVFVKDRPGHDLRYAIDADKIERDLGWTPEETFESGIRKTVEWYLANKDSW 357


>gi|85713614|ref|ZP_01044604.1| dTDP-glucose 4,6-dehydratase [Nitrobacter sp. Nb-311A]
 gi|85699518|gb|EAQ37385.1| dTDP-glucose 4,6-dehydratase [Nitrobacter sp. Nb-311A]
          Length = 354

 Score =  392 bits (1006), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 184/333 (55%), Positives = 243/333 (72%), Gaps = 1/333 (0%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           + VTGGAGFIGSA+ R+L+     +V+ IDK TYA NL+SL   +++  ++F +  ICD 
Sbjct: 8   IFVTGGAGFIGSAVVRHLLTHTHARVVNIDKCTYAANLDSLPGTNENLNYAFEKQCICDG 67

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             +R   ++++PDA++N AAESHVDRSI G  EFI TNI+GTF LL+E+   W  LS +K
Sbjct: 68  VGLRHLFEKYRPDAVMNLAAESHVDRSIDGPGEFIQTNIVGTFTLLQESLRHWRSLSHEK 127

Query: 123 KDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLL 181
           + +FRFL +STDEV+GSL D G F+E   Y P+SPYSA+KASSD+LV AW  TY +P L+
Sbjct: 128 RRKFRFLHVSTDEVFGSLGDDGFFTETTAYAPNSPYSASKASSDHLVRAWRETYELPTLV 187

Query: 182 SNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKGR 241
           +NCSNNYGPYHFPEKLIP  I + + G  + +YGDG+N+RDWLYV+DH RAL L L+ G 
Sbjct: 188 TNCSNNYGPYHFPEKLIPHMIIKGLAGEPLPVYGDGKNIRDWLYVDDHARALSLTLEHGA 247

Query: 242 IGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSSKI 301
           +GE YN+GG NER N+ +V  I  LLD + P +  H  LI F+ DRPGHDRRYAID+SK+
Sbjct: 248 VGETYNVGGRNERTNLHVVESICDLLDEIAPGATRHRNLITFVADRPGHDRRYAIDASKL 307

Query: 302 KSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           + E+GW  +EN ESG+ KTV WY++   WWR +
Sbjct: 308 ERELGWVAEENFESGIEKTVRWYVEEQPWWRAI 340


>gi|332306497|ref|YP_004434348.1| dTDP-glucose 4,6-dehydratase [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332173826|gb|AEE23080.1| dTDP-glucose 4,6-dehydratase [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 363

 Score =  391 bits (1005), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 186/347 (53%), Positives = 247/347 (71%), Gaps = 15/347 (4%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+L+ + +  V+ +D LTYAGN  S+ +  QS+ ++F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHLLENTQDSVINVDVLTYAGNTESIPDELQSDRYTFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   I+   +  QPDA+++ AAESHVDRSI G   FI TN++GT+ LL+  R +W  LSQ
Sbjct: 61  DAAEIKRVFETHQPDAVMHLAAESHVDRSIDGPGAFIQTNVVGTYTLLDAAREYWQNLSQ 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
            +K QF F  ISTDEVYG L          +  LF ED PY PSSPYSA+KASSD+LV +
Sbjct: 121 ARKAQFLFHHISTDEVYGDLPHPDELPSGSELPLFIEDTPYAPSSPYSASKASSDHLVRS 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKL+P  I   + G  + +YGDG  +RDWL+VEDH 
Sbjct: 181 WQRTYGLPTVITNCSNNYGPYHFPEKLVPHVILNALAGKPLPVYGDGSQIRDWLFVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS-----HTELIRFIE 285
           RAL +V+K GR+GE +NIGG+NE++N+D+V  I  LLD L P+  S     + +LI F++
Sbjct: 241 RALCVVVKSGRVGETFNIGGHNEKRNLDVVRTICTLLDELAPEQRSPDISAYADLITFVK 300

Query: 286 DRPGHDRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           DRPGHD RYAID+S I+ E+GW P+E+  SG+ KTV WYL N  WW+
Sbjct: 301 DRPGHDARYAIDASHIQKELGWAPEEDFISGMRKTVQWYLANESWWQ 347


>gi|90425660|ref|YP_534030.1| dTDP-glucose 4,6-dehydratase [Rhodopseudomonas palustris BisB18]
 gi|90107674|gb|ABD89711.1| dTDP-glucose 4,6-dehydratase [Rhodopseudomonas palustris BisB18]
          Length = 344

 Score =  391 bits (1005), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 184/338 (54%), Positives = 241/338 (71%), Gaps = 3/338 (0%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           +I+TGGAGFIGSALCR++V+   ++V+ IDKLTYAG   SLK +  +  F F Q+DICD 
Sbjct: 5   VIITGGAGFIGSALCRHVVSSTDVKVVCIDKLTYAGTRTSLKTLEGNPRFVFEQLDICDA 64

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             +       QP  +++ AAESHVDRSI  A  FITTNI GTF+LLE  R +   L+   
Sbjct: 65  AAMAGVFATHQPRGVIHLAAESHVDRSIASAAPFITTNINGTFVLLEAARAYHGALAAAD 124

Query: 123 KDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLL 181
           +D F+F  +STDEVYG+L + G+F ED PY+P+SPYSA+KA+SD+LV AW HTYG+P + 
Sbjct: 125 RDGFKFHHVSTDEVYGALGETGVFKEDTPYSPNSPYSASKAASDHLVNAWLHTYGLPTVT 184

Query: 182 SNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKGR 241
           SNCSNNYGP+ FPEKL P+ I   +EG  + +YG G NVRDWL+VEDH RAL+ V  K  
Sbjct: 185 SNCSNNYGPHQFPEKLFPVMILNGLEGRPLPVYGQGANVRDWLFVEDHARALWTVFDKAA 244

Query: 242 IGERYNIGGNNERKNIDIVFEIGFLLDALIPK--SYSHTELIRFIEDRPGHDRRYAIDSS 299
           +GE+Y IGG++ER+NID+V  I  LL  L P+    S+  LI F+ DR GHD RY++D S
Sbjct: 245 VGEKYMIGGHSERRNIDVVHGICDLLTELRPRPDGSSYRSLISFVTDRAGHDFRYSVDCS 304

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKE 337
           KI+ E+GW PQ + E GL +TV WY+DN WWW+PL ++
Sbjct: 305 KIERELGWKPQHSFEDGLRRTVQWYIDNAWWWQPLRQK 342


>gi|331004826|ref|ZP_08328244.1| dTDP-glucose 4,6-dehydratase [gamma proteobacterium IMCC1989]
 gi|330421357|gb|EGG95605.1| dTDP-glucose 4,6-dehydratase [gamma proteobacterium IMCC1989]
          Length = 354

 Score =  391 bits (1005), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 188/335 (56%), Positives = 247/335 (73%), Gaps = 5/335 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           +++TGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL+SL+ +S SN + F QVDICD 
Sbjct: 5   VLITGGAGFIGSAVVRHIIGNTQDNVINLDKLTYAGNLSSLESVSGSNRYVFEQVDICDA 64

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             ++      +P+ +++ AAESHVDRSI G D FITTNI+GT+ LLE +R ++  L + +
Sbjct: 65  YELQRVFDVHKPNKVMHLAAESHVDRSIDGPDTFITTNIVGTYTLLEASRRFYMSLGKSE 124

Query: 123 KDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLL 181
           K +F F  ISTDEVYG L  +GLF+E   Y PSSPYSATKASSD+LV AW  T+G+P L+
Sbjct: 125 KARFLFHHISTDEVYGDLGTEGLFTETTSYAPSSPYSATKASSDHLVRAWHRTFGLPTLV 184

Query: 182 SNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKGR 241
           +NCSNNYGPYHFPEKLIPL I   + G  + +YGDG  VRDWLYVEDH RALY V+ +G 
Sbjct: 185 TNCSNNYGPYHFPEKLIPLTILNALAGKPLPVYGDGSQVRDWLYVEDHARALYDVISRGV 244

Query: 242 IGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYAID 297
            GE YNIGG+NER+NI++V+ I  +L+ L P        + +LI F+EDRPGHD RYAID
Sbjct: 245 AGETYNIGGHNERQNIEVVYAICDILEKLRPDKPLGIQRYRDLIVFVEDRPGHDVRYAID 304

Query: 298 SSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           +SKI+ E+ W P E+ ESG++KTV WYL N  WW+
Sbjct: 305 ASKIQKELDWLPNESFESGISKTVQWYLSNESWWQ 339


>gi|148832474|gb|ABR14152.1| RfbB [Haemophilus influenzae]
          Length = 347

 Score =  391 bits (1005), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 187/334 (55%), Positives = 241/334 (72%), Gaps = 6/334 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIGSAL RYL+     +++ +DKLTYAGNL SLK +     ++F+Q DICD 
Sbjct: 8   ILVTGGAGFIGSALVRYLLEKTHNKIVNVDKLTYAGNLASLKTVENHPRYAFVQADICDT 67

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
           + +     ++QPDA+++ AAESHVDRSI  + EFI TNI+GT+ LLE T  +W  L   K
Sbjct: 68  KALSYIFAQYQPDAVIHLAAESHVDRSINASSEFIQTNIVGTYCLLESTLDYWHRLDNQK 127

Query: 123 KDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           K  FRFL ISTDEVYG L  ++GLF+E   Y PSSPYSA+KA+SD+LV AW  TYG+P +
Sbjct: 128 KSSFRFLHISTDEVYGDLKSNEGLFTETSAYKPSSPYSASKAASDHLVQAWYRTYGLPTI 187

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           +++ SNNYGPY +PEKLIPL I   IEG  + +YGDG  +RDWL+VEDH+ ALY VL KG
Sbjct: 188 ITHSSNNYGPYQYPEKLIPLMILNAIEGKTLPIYGDGLQIRDWLFVEDHIDALYNVLMKG 247

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHT----ELIRFIEDRPGHDRRYAI 296
            IGE YNIGGNNE+ NID+V  I  LL+  +P    H     +LI +++DRPGHD RYA+
Sbjct: 248 NIGETYNIGGNNEKSNIDVVRSICSLLEEFLPNKPKHINKYEDLICYVQDRPGHDLRYAL 307

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           D+SKI  ++GW P+E  ESGL KTV WYL++  W
Sbjct: 308 DTSKINHKLGWIPKETFESGLRKTVIWYLNHQEW 341


>gi|146343782|ref|YP_001208830.1| dTDP-D-glucose 4,6-dehydratase [Bradyrhizobium sp. ORS278]
 gi|146196588|emb|CAL80615.1| dTDP-D-glucose 4,6-dehydratase [Bradyrhizobium sp. ORS278]
          Length = 357

 Score =  391 bits (1004), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 186/336 (55%), Positives = 244/336 (72%), Gaps = 2/336 (0%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           + VTGGAGFIGSA+ R+L+ D   +V+ IDKLTYA NL+SL   + +  ++F Q DICD 
Sbjct: 8   IFVTGGAGFIGSAVVRHLLRDTHARVVNIDKLTYAANLDSLPGAAGNPHYAFEQADICDA 67

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             +R    ++QPDA++N AAESHVDRSI G  EFI TNI+GTF LL+E    +  LS +K
Sbjct: 68  AALRKLFDKYQPDAVMNLAAESHVDRSIDGPGEFIQTNIVGTFTLLQEALRHFRSLSPEK 127

Query: 123 KDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLL 181
           +  FRFL ISTDEV+G+L D GLF+E   Y P+SPYSA+KASSD+LV AW  TY +P ++
Sbjct: 128 RAGFRFLHISTDEVFGTLGDTGLFTETTAYAPNSPYSASKASSDHLVRAWRETYELPTMI 187

Query: 182 SNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKGR 241
           +NCSNNYGPYHFPEKLIP  I + +    + +YGDGQN+RDWL+VEDH RAL LVL++G+
Sbjct: 188 TNCSNNYGPYHFPEKLIPHMIIKGLGFETLPVYGDGQNIRDWLFVEDHARALTLVLERGQ 247

Query: 242 IGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY-SHTELIRFIEDRPGHDRRYAIDSSK 300
           +GE YN+GG NER N+ +V  I  LLDA+ P       +LI F+ DRPGHDRRYAID+SK
Sbjct: 248 VGETYNVGGRNERTNLHVVETICDLLDAVAPGPQGGRRQLISFVTDRPGHDRRYAIDASK 307

Query: 301 IKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYK 336
           ++ E+GW  +E  E+G+ KTV WY+    WW+ + +
Sbjct: 308 LERELGWRAEETFETGIAKTVRWYVQEKPWWQAILQ 343


>gi|581659|emb|CAA50767.1| rfbB [Shigella flexneri]
          Length = 361

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 185/340 (54%), Positives = 237/340 (69%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++ VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  ++F   DIC
Sbjct: 1   MKIPVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYAFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +    +      +++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L+ 
Sbjct: 61  DAVAMSRIFRTAPARRVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALND 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           +KK  FRF  ISTDEVYG L             LF+E      +SPYSA+KAS+D+LV A
Sbjct: 121 EKKKSFRFHHISTDEVYGDLPHPDEANNNETLPLFTETTTKRQNSPYSASKASNDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDADKISRELGWKPQETFESGIRKTVEWYLANTNW 340


>gi|3832507|gb|AAC70775.1| dTDP-D-glucose 4,6 dehydratase [Klebsiella pneumoniae]
          Length = 354

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 185/339 (54%), Positives = 245/339 (72%), Gaps = 7/339 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ +   +V V+D LTYAGNL SL  ++ S  +SF Q DI 
Sbjct: 1   MKILVTGGAGFIGSAVVRHIIENTLDEVRVMDCLTYAGNLESLAPVAGSERYSFSQTDIT 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   + +   EF+PD +++ AAESHVDRSI G   FI TN+IGTF LLE  R +WS L +
Sbjct: 61  DAAAVAAQFSEFRPDIVMHLAAESHVDRSIDGPAAFIHTNVIGTFTLLEAARHYWSGLVE 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKGLFS---EDMPYNPSSPYSATKASSDYLVLAWGHTYGI 177
           ++K  FRF  ISTDEVYG L +   +   +   Y PSSPYSA+KA SD+LV AW  TYG+
Sbjct: 121 EQKQAFRFHHISTDEVYGDLHRSQSTCPPKKTSYAPSSPYSASKAGSDHLVRAWNRTYGL 180

Query: 178 PVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVL 237
           P++++NCSNNYGPYHFPEKLIPL I   + G  + +YG+G+ +RDWLYVE+H RALY V 
Sbjct: 181 PLVVTNCSNNYGPYHFPEKLIPLTILNALAGKPLPVYGNGEQIRDWLYVEEHARALYKVA 240

Query: 238 KKGRIGERYNIGGNNERKNIDIVFEIGFLLDALI---PKSYSH-TELIRFIEDRPGHDRR 293
            +G+ GE YNIGG+NERKNID+V  I  +LD ++   P + +H  +LI F+ DRPGHD R
Sbjct: 241 TEGKSGETYNIGGHNERKNIDVVRTICTILDKVVAQKPGNITHFADLITFVTDRPGHDLR 300

Query: 294 YAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           YAID++KI+ ++GW PQE  ESG+ KTV WYL+N  WW+
Sbjct: 301 YAIDATKIQRDLGWVPQETFESGIEKTVHWYLNNQTWWQ 339


>gi|254362238|ref|ZP_04978352.1| dTDP-glucose 4,6-dehydratase [Mannheimia haemolytica PHL213]
 gi|153093813|gb|EDN74748.1| dTDP-glucose 4,6-dehydratase [Mannheimia haemolytica PHL213]
          Length = 335

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 185/333 (55%), Positives = 241/333 (72%), Gaps = 6/333 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M +++TGGAGFIGSAL RYL+      V+ +DKLTYAGNL SL+ ++    + F + DIC
Sbjct: 1   MIILITGGAGFIGSALVRYLIEHTPHTVINVDKLTYAGNLASLESVAHHERYHFEKADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
               I     ++QPD +++ AAESHVDRSI GA +FI TNI+GT+ LLE  R +W  L +
Sbjct: 61  ASGQISEIFGKYQPDVVMHLAAESHVDRSISGAADFIQTNIVGTYTLLEAARAYWDTLPE 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K  FRFL ISTDEVYG L K   LF+E  PYNPSSPYSA+KA+SD+L  AW  TYG+P
Sbjct: 121 PRKSAFRFLHISTDEVYGDLAKSEELFTEKTPYNPSSPYSASKAASDHLARAWHRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYG Y +PEKLIPL I   +EG  + +YG+G  VRDWL+VEDH+RALYLVL+
Sbjct: 181 TVITNCSNNYGAYQYPEKLIPLMILNALEGKSLPVYGNGLQVRDWLFVEDHIRALYLVLQ 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY----SHTELIRFIEDRPGHDRRY 294
           KG+IGE YNIGG+NE+ NI++V  I  +L  ++P +      + +LI +++DRPGHD RY
Sbjct: 241 KGQIGETYNIGGHNEKTNIEVVRSICSILQEMVPNNPLVVGQYADLITYVQDRPGHDFRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDN 327
           AID+SKI+ E+ W P+E  ESGL KTV WYL N
Sbjct: 301 AIDTSKIEKELDWKPKETFESGLRKTVEWYLAN 333


>gi|13476273|ref|NP_107843.1| dTDP-D-glucose-4,6-dehydratase [Mesorhizobium loti MAFF303099]
 gi|14027034|dbj|BAB53988.1| dTDP-D-glucose-4,6-dehydratase [Mesorhizobium loti MAFF303099]
          Length = 356

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 188/341 (55%), Positives = 241/341 (70%), Gaps = 4/341 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M  +VTGGAGFIGSA+CR+L  +   +V  +DKLTYAGNL SL++I  ++ + F   DIC
Sbjct: 1   MNFLVTGGAGFIGSAVCRHLCANPAYRVTNLDKLTYAGNLASLRQIENAHNYRFAHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +   ++    D ++N AAESHVDRSI G   FI TNI+GT+ +L     +W  L  
Sbjct: 61  DERAVLDIMRRDDIDIVMNLAAESHVDRSIDGPGAFIETNIVGTYRILNAALEYWRGLPD 120

Query: 121 DKKDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           D+K +FRF  +STDEV+G L  D G+F E+ PY PSSPYSA+KA+SD+LV AW  TYG+P
Sbjct: 121 DRKSRFRFHHVSTDEVFGDLPFDGGMFVEETPYAPSSPYSASKAASDHLVRAWHETYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+LSNCSNNYGPYHFPEKLIPL I   ++   + +YG G NVRDWL+VEDH RAL LV  
Sbjct: 181 VVLSNCSNNYGPYHFPEKLIPLVILNALDEKPLPVYGAGANVRDWLFVEDHARALELVAT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS--YSHTELIRFIEDRPGHDRRYAI 296
           KG  GE YN+GGN+ER N+ +V  I  LLD   P++    + +LI F+ DRPGHDRRYAI
Sbjct: 241 KGTPGESYNVGGNSERTNLAVVETICDLLDIRRPRAGGRCYRDLISFVTDRPGHDRRYAI 300

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKE 337
           D+SKI  E+GW P EN +SGL +TV W+LDN WWW P+ ++
Sbjct: 301 DASKIGRELGWAPSENFDSGLARTVDWFLDNKWWWGPIREQ 341


>gi|281603178|gb|ADA76162.1| DTDP-glucose 4,6-dehydratase [Shigella flexneri 2002017]
          Length = 338

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 187/321 (58%), Positives = 231/321 (71%), Gaps = 6/321 (1%)

Query: 18  RYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAI 77
           RY++N+    V+V+DKLTYAGNL SL  ++QS  F+F +VDICDR  +     E QPD +
Sbjct: 2   RYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDICDRAELARVFTEHQPDCV 61

Query: 78  VNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVY 137
           ++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L++DKK  FRF  ISTDEVY
Sbjct: 62  MHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNTLTEDKKSAFRFHHISTDEVY 121

Query: 138 GSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPE 195
           G L      F+E  PY PSSPYSA+KASSD+LV AW  TYG+P L++NCSNNYGPYHFPE
Sbjct: 122 GDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPTLITNCSNNYGPYHFPE 181

Query: 196 KLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKGRIGERYNIGGNNERK 255
           KLIPL I   + G  + +YG+GQ +RDWLYVEDH RALY V   G++GE YNIGG+NERK
Sbjct: 182 KLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVATTGKVGETYNIGGHNERK 241

Query: 256 NIDIVFEIGFLLDALI---PKSYS-HTELIRFIEDRPGHDRRYAIDSSKIKSEIGWFPQE 311
           N+D+V  I  LL+ L    P   + + +LI F+ DRPGHD RYAID+SKI  E+GW PQE
Sbjct: 242 NLDVVETICELLEELASNKPHGVAYYRDLITFVADRPGHDLRYAIDASKIARELGWLPQE 301

Query: 312 NMESGLNKTVCWYLDNNWWWR 332
             ESG+ KTV WYL N  WW+
Sbjct: 302 TFESGMRKTVQWYLANESWWK 322


>gi|269959355|ref|ZP_06173738.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269835792|gb|EEZ89868.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 354

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 186/338 (55%), Positives = 241/338 (71%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ D +  V+ +DKLTYAGNL SL E+S S  + F  VDIC
Sbjct: 1   MKILVTGGAGFIGSAVIRHIIRDTQDTVINLDKLTYAGNLESLAEVSDSERYHFEHVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
            R+ +     + QPD +++ AAESHVDRSI G   FI TN++GT+ +LE  R +WS L +
Sbjct: 61  QRDELDRVFAKHQPDLVMHLAAESHVDRSIDGPAAFIETNVMGTYHILESARQYWSTLDE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K  FRF  ISTDEVYG L+    LF+E   Y PSSPYSA+KASSD+LV AW  TYG P
Sbjct: 121 TRKAAFRFHHISTDEVYGDLEGTDDLFTETTSYAPSSPYSASKASSDHLVRAWQRTYGFP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            L++NCSNNYGPYHFPEKLIPL I   ++G  + +YGDG  +RDWL+VEDH RALY V+ 
Sbjct: 181 TLVTNCSNNYGPYHFPEKLIPLMILNALDGKPLPVYGDGMQIRDWLFVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRY 294
           +G IGE YNIGG+NE+ NI++V  I  LL+   P       S+  LI +++DRPGHD RY
Sbjct: 241 EGEIGETYNIGGHNEKANIEVVKTICSLLEEFRPNKPAGVESYESLIIYVKDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID++KI  E+ W P+E  ESG+ KTV WYL+N  WW+
Sbjct: 301 AIDATKIARELNWTPEETFESGIRKTVEWYLNNQQWWQ 338


>gi|158605287|gb|ABW74897.1| dTDP-D-glucose-4,6-dehydratase [Sphingomonas sp. ATCC 53159]
          Length = 353

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 184/336 (54%), Positives = 241/336 (71%), Gaps = 5/336 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
            +VTGGAGFIGSA+ R+LV     +V+ +DKLTYAGN  SL  I  +  + F+  DI D 
Sbjct: 5   FLVTGGAGFIGSAVVRHLVRQ-GARVINLDKLTYAGNPASLTAIENAPNYRFVHADIADT 63

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             I   L+E Q D +++ AAESHVDRSI G  EFI TN++GTF LL+    +W  L  +K
Sbjct: 64  ATILPLLREEQVDVVMHLAAESHVDRSIDGPGEFIETNVVGTFKLLQSALQYWRELEGEK 123

Query: 123 KDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           +D FRF  ISTDEV+G L  D G+F+E+ PY+PSSPYSA+KA+SD+LV AWGHTYG+PV+
Sbjct: 124 RDAFRFHHISTDEVFGDLPFDSGIFTEETPYDPSSPYSASKAASDHLVRAWGHTYGLPVV 183

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           LSNCSNNYGP+HFPEKLIPL I   +EG  + +YG G+N+RDWLYV+DH +AL  +   G
Sbjct: 184 LSNCSNNYGPFHFPEKLIPLTILNALEGKPLPVYGKGENIRDWLYVDDHAKALATIATTG 243

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIP--KSYSHTELIRFIEDRPGHDRRYAIDS 298
           ++G+ YN+GG NER N+ +V  I  LLD  IP        ELI F+ DRPGHDRRYAID+
Sbjct: 244 KVGQSYNVGGRNERTNLQVVETICDLLDQRIPLADGRKRRELITFVTDRPGHDRRYAIDA 303

Query: 299 SKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           +K+++E+GW  +EN ++G+  T+ WYL N WWW P+
Sbjct: 304 TKLETELGWKAEENFDTGIAATIDWYLANEWWWGPI 339


>gi|92116637|ref|YP_576366.1| dTDP-glucose 4,6-dehydratase [Nitrobacter hamburgensis X14]
 gi|91799531|gb|ABE61906.1| dTDP-glucose 4,6-dehydratase [Nitrobacter hamburgensis X14]
          Length = 355

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 187/334 (55%), Positives = 245/334 (73%), Gaps = 2/334 (0%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           + VTGGAGFIGSA+ R+L+++   +V+ IDK TYA NL+SL   +++  ++F +  ICD 
Sbjct: 8   IFVTGGAGFIGSAVIRHLLHNTHARVVNIDKCTYAANLDSLPGTNENLNYAFEKQCICDG 67

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             +R   + ++PDA++N AAESHVDRSI G  EFI TNI+GTF LL+ET   W  LS +K
Sbjct: 68  TGLRHLFERYRPDAVMNLAAESHVDRSIDGPGEFIQTNIVGTFTLLQETLRHWRTLSPEK 127

Query: 123 KDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLL 181
           +  FRFL +STDEV+GSL D G F+E   Y P+SPYSA+KASSD+LV AW  TY +P L+
Sbjct: 128 RKTFRFLHVSTDEVFGSLGDDGFFTETTAYAPNSPYSASKASSDHLVRAWRETYELPTLV 187

Query: 182 SNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKGR 241
           +NCSNNYGPYHFPEKLIP  I + + G  + +YGDG+N+RDWLYVEDH +AL LVL+ G 
Sbjct: 188 TNCSNNYGPYHFPEKLIPHMIIKGLAGEPLPVYGDGKNIRDWLYVEDHAKALTLVLEHGL 247

Query: 242 IGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY-SHTELIRFIEDRPGHDRRYAIDSSK 300
           +GE YN+GG NER N+ +V  I  LLD + P +  +  ELI F+ DRPGHDRRYAID+SK
Sbjct: 248 VGETYNVGGRNERTNLHVVESICNLLDEVAPGARGARRELITFVADRPGHDRRYAIDASK 307

Query: 301 IKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           ++ E+GW  +EN ESG+ KTV WY+D   WWR +
Sbjct: 308 LERELGWRAEENFESGIEKTVRWYVDEQPWWRAI 341


>gi|152994869|ref|YP_001339704.1| dTDP-glucose 4,6-dehydratase [Marinomonas sp. MWYL1]
 gi|150835793|gb|ABR69769.1| dTDP-glucose 4,6-dehydratase [Marinomonas sp. MWYL1]
          Length = 361

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 188/343 (54%), Positives = 247/343 (72%), Gaps = 12/343 (3%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           + ++TGGAGFIGSA+ RYL++  +  V+ +DKLTYAGNL S+ E  +++ + F  VDICD
Sbjct: 3   KFLITGGAGFIGSAVVRYLLSCTQHNVVNLDKLTYAGNLESIPESFKNDRYVFELVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
              +   L+  +PD +++ AAESHVDRSI G  EFI TN++GT+ LLE +R +W  L++D
Sbjct: 63  AVELDRVLQTHKPDVVMHLAAESHVDRSIDGPGEFILTNVVGTYTLLEASRKYWMGLTED 122

Query: 122 KKDQFRFLQISTDEVYGSL--------DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGH 173
           KK  FRF  ISTDEVYG L        D  LF+E  PY PSSPYSA+KASSD+LV AW  
Sbjct: 123 KKAAFRFHHISTDEVYGDLPHPDEVVGDLPLFTETTPYAPSSPYSASKASSDHLVRAWLR 182

Query: 174 TYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRAL 233
           TYG+P +++NCSNNYGPYHFPEKLIP  I   + G  + +YGDG  +RDWLYVEDH RAL
Sbjct: 183 TYGLPTIVTNCSNNYGPYHFPEKLIPHVILNALSGKALPVYGDGSQIRDWLYVEDHARAL 242

Query: 234 YLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIP----KSYSHTELIRFIEDRPG 289
             V  +G+IGE YNIGG+NE++NID+V  I  LL+ L+P       ++ +LI +++DRPG
Sbjct: 243 VKVATEGKIGETYNIGGHNEKRNIDVVKTICALLEELVPIKPQGVNAYQDLITYVKDRPG 302

Query: 290 HDRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           HD RYAID+SKI +E+GW P+E  E+G+ KTV WYLDN  WW+
Sbjct: 303 HDVRYAIDASKIANELGWQPEETFETGMRKTVQWYLDNQDWWQ 345


>gi|87307567|ref|ZP_01089711.1| dTDP-glucose 4,6-dehydratase [Blastopirellula marina DSM 3645]
 gi|87289737|gb|EAQ81627.1| dTDP-glucose 4,6-dehydratase [Blastopirellula marina DSM 3645]
          Length = 358

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 190/332 (57%), Positives = 245/332 (73%), Gaps = 5/332 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIGS L R LV    + V+ +DKLTYAGNL+SL E++  +    ++ DICD 
Sbjct: 5   VLVTGGAGFIGSCLVRQLVLQDDLTVINLDKLTYAGNLDSLAELADDSRHILVEGDICDA 64

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
           + I   L EF+P+AI N AAESHVDRSI G  EF+ TN++GTF LLE  R +W  L+ D+
Sbjct: 65  DLIARLLAEFRPNAIFNLAAESHVDRSIDGPAEFVATNVVGTFTLLEAARNYWRELAADR 124

Query: 123 KDQFRFLQISTDEVYGSLDK-GLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLL 181
             +FRFLQ+STDEVYGSL K GLF+E  PY+P+SPYSA+KAS+D+ V A+ HT+G+P L 
Sbjct: 125 AAEFRFLQVSTDEVYGSLGKTGLFTEATPYSPNSPYSASKASADHFVRAYFHTFGLPTLT 184

Query: 182 SNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKGR 241
           +NCSNNYGP  FPEKLIP+ I   +EG  + +YGDGQNVRDWL+VEDH RA+  VL++GR
Sbjct: 185 TNCSNNYGPRQFPEKLIPVMILNALEGKPLPIYGDGQNVRDWLFVEDHCRAIRRVLQQGR 244

Query: 242 IGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSH---TELIRFIEDRPGHDRRYAIDS 298
            GE YNIGGN ER N++IV  +   LD L P   +H    +LI F++DRPGHDRRYAID+
Sbjct: 245 PGEVYNIGGNCERTNLEIVTAVCAALDRLCP-DLAHRPCEKLITFVKDRPGHDRRYAIDA 303

Query: 299 SKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           +K+KSE+ W P E  E+GL KT+ WYL++  W
Sbjct: 304 AKMKSELQWSPVETFETGLEKTIRWYLEHRTW 335


>gi|1314581|gb|AAC44074.1| dTDP-D-glucose-4,6-dehydratase [Sphingomonas sp. S88]
          Length = 353

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 183/336 (54%), Positives = 242/336 (72%), Gaps = 5/336 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
            +VTGGAGFIGSA+ R+LV     +V+ +DKLTYAGN  SL  I  +  + F+  DI D 
Sbjct: 5   FLVTGGAGFIGSAVVRHLVRQ-GARVINLDKLTYAGNPASLTAIENAPNYRFVHADIADT 63

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             I   L+E Q D +++ AAESHVDRSI G  EFI TN++GTF LL+    +W  L  +K
Sbjct: 64  ATILPLLREEQVDVVMHLAAESHVDRSIDGPGEFIETNVVGTFKLLQAALQYWRELEGEK 123

Query: 123 KDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           ++ FRF  ISTDEV+G L  D G+F+E+ PY+PSSPYSA+KA+SD+LV AWGHTYG+PV+
Sbjct: 124 REAFRFHHISTDEVFGDLPFDSGIFTEETPYDPSSPYSASKAASDHLVRAWGHTYGLPVV 183

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           LSNCSNNYGP+HFPEKLIPL I   +EG  + +YG G+N+RDWLYV+DH +AL  +   G
Sbjct: 184 LSNCSNNYGPFHFPEKLIPLTILNALEGKPLPVYGKGENIRDWLYVDDHAKALATIATTG 243

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIP--KSYSHTELIRFIEDRPGHDRRYAIDS 298
           ++G+ YN+GG NER N+ +V  I  LLD  IP        ELI F+ DRPGHDRRYAID+
Sbjct: 244 KVGQSYNVGGRNERTNLQVVETICDLLDQRIPLKDGKKRRELITFVTDRPGHDRRYAIDA 303

Query: 299 SKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           +K+++E+GW  +EN ++G+  T+ WYL+N WWW P+
Sbjct: 304 TKLETELGWKAEENFDTGIAATIDWYLENEWWWGPI 339


>gi|16127859|ref|NP_422423.1| dTDP-D-glucose-4,6-dehydratase [Caulobacter crescentus CB15]
 gi|221236680|ref|YP_002519117.1| dTDP-glucose 4,6-dehydratase [Caulobacter crescentus NA1000]
 gi|13425381|gb|AAK25591.1| dTDP-D-glucose-4,6-dehydratase [Caulobacter crescentus CB15]
 gi|220965853|gb|ACL97209.1| dTDP-glucose 4,6-dehydratase [Caulobacter crescentus NA1000]
          Length = 356

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 182/336 (54%), Positives = 239/336 (71%), Gaps = 2/336 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           +R++VTGG+GFIGSA+CR+L     + +L  DKLTYA +  SL  +     + F+Q D+ 
Sbjct: 6   LRVMVTGGSGFIGSAVCRHLAGQNNVAILNYDKLTYAASQASLAMLEGKADYQFVQGDVA 65

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   + + +K F+PD +++ AAESHVDRSI G  +FI TNI+GT+++L+     W  L  
Sbjct: 66  DAARVCATIKAFRPDVVMHLAAESHVDRSITGPGDFIQTNIVGTYVMLQAALEHWRGLEG 125

Query: 121 DKKDQFRFLQISTDEVYGSLD-KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           + K +FRF  ISTDEV+GSL  +GLFSE  PY+P SPYSA+KASSD+L  AW HTYG+PV
Sbjct: 126 EAKGRFRFHHISTDEVFGSLGAEGLFSETTPYDPRSPYSASKASSDHLARAWQHTYGLPV 185

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           ++SNCSNNYGPYHFPEKLIPL     +EG  + +YG G NVRDWL+VEDH RAL+L+  K
Sbjct: 186 VVSNCSNNYGPYHFPEKLIPLVTLNALEGKPLPVYGKGDNVRDWLHVEDHARALHLIATK 245

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIP-KSYSHTELIRFIEDRPGHDRRYAIDS 298
           G  GE YN+GG NER N+ +V  I  +LD L P    S  +LI F+ DRPGHD RYAID+
Sbjct: 246 GVPGESYNVGGRNERTNLQVVEAICDILDELRPIPGQSRRDLITFVADRPGHDARYAIDA 305

Query: 299 SKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           +K+++E+GW  QE  ++GL KT+ WYLDN  WW PL
Sbjct: 306 TKLETELGWTAQETFDTGLRKTIQWYLDNEAWWAPL 341


>gi|300114910|ref|YP_003761485.1| dTDP-glucose 4,6-dehydratase [Nitrosococcus watsonii C-113]
 gi|299540847|gb|ADJ29164.1| dTDP-glucose 4,6-dehydratase [Nitrosococcus watsonii C-113]
          Length = 358

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 187/333 (56%), Positives = 238/333 (71%), Gaps = 3/333 (0%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           L++TGGAGFIGSA+ R+ +      V+ +DKLTYAGN  SL++++    + F+  DIC R
Sbjct: 6   LLITGGAGFIGSAVVRHFLAATDRGVINVDKLTYAGNPESLEDLASHPRYEFVHADICQR 65

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
           E +      +QP+A+++ AAESHVDRSI     FI TN+ GT+ILLE    +W  L++  
Sbjct: 66  ESMAQIFARYQPEAVLHLAAESHVDRSIDSPAAFIDTNVTGTYILLEAALEYWRKLAKSA 125

Query: 123 KDQFRFLQISTDEVYGSLDK-GLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLL 181
           + +FRF  +STDEV+GSL   GLF ED PY P+SPY+A+KA+SD+LV AW HTYG+PVL+
Sbjct: 126 QARFRFHHVSTDEVFGSLGATGLFREDSPYQPNSPYAASKAASDHLVRAWHHTYGLPVLI 185

Query: 182 SNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKGR 241
           +NCSNNYGP  FPEKLIPL +   IEG  + +YG G NVRDWLYVEDHVRAL +VL KGR
Sbjct: 186 TNCSNNYGPRQFPEKLIPLMVLNGIEGKSLPVYGAGDNVRDWLYVEDHVRALEIVLDKGR 245

Query: 242 IGERYNIGGNNERKNIDIVFEIGFLLDALIPKS--YSHTELIRFIEDRPGHDRRYAIDSS 299
            GE YNIGG+NE+ N+++V  I  LLD L  +S    H  LI F+ DRPGHDRRYAID+ 
Sbjct: 246 PGETYNIGGHNEKTNVEVVELICQLLDELFSQSSHRPHRSLITFVADRPGHDRRYAIDAG 305

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           KI  E+GW P+E  E+GL KTV WYLDN  W R
Sbjct: 306 KIARELGWRPRETFETGLRKTVQWYLDNQNWCR 338


>gi|68249461|ref|YP_248573.1| dTDP-glucose 4,6-dehydratase [Haemophilus influenzae 86-028NP]
 gi|68057660|gb|AAX87913.1| dTDP-glucose 4,6-dehydratase [Haemophilus influenzae 86-028NP]
          Length = 347

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 186/334 (55%), Positives = 240/334 (71%), Gaps = 6/334 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIGSAL  YL+     +++ +DKLTYAGNL SLK +     ++F+Q DICD 
Sbjct: 8   ILVTGGAGFIGSALVHYLLEKTHNKIVNVDKLTYAGNLASLKTVENHPRYAFVQADICDT 67

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
           + +     ++QPDA+++ AAESHVDRSI  + EFI TNI+GT+ LLE T  +W  L   K
Sbjct: 68  KALSYIFSQYQPDAVIHLAAESHVDRSINASSEFIQTNIVGTYCLLESTLDYWHRLDNQK 127

Query: 123 KDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           K  FRFL ISTDEVYG L  ++GLF+E   Y PSSPYSA+KA+SD+LV AW  TYG+P +
Sbjct: 128 KSSFRFLHISTDEVYGDLKSNEGLFTETSAYKPSSPYSASKAASDHLVQAWYRTYGLPTI 187

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           +++ SNNYGPY +PEKLIPL I   IEG  + +YGDG  +RDWL+VEDH+ ALY VL KG
Sbjct: 188 ITHSSNNYGPYQYPEKLIPLMILNAIEGKTLPIYGDGLQIRDWLFVEDHIDALYNVLMKG 247

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHT----ELIRFIEDRPGHDRRYAI 296
            IGE YNIGGNNE+ NID+V  I  LL+  +P    H     +LI +++DRPGHD RYA+
Sbjct: 248 NIGETYNIGGNNEKSNIDVVRSICSLLEEFLPNKPKHIDKYEDLICYVQDRPGHDLRYAL 307

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           D+SKI  ++GW P+E  ESGL KTV WYL++  W
Sbjct: 308 DTSKINHKLGWIPKETFESGLRKTVIWYLNHQEW 341


>gi|300022033|ref|YP_003754644.1| dTDP-glucose 4,6-dehydratase [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299523854|gb|ADJ22323.1| dTDP-glucose 4,6-dehydratase [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 363

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 185/335 (55%), Positives = 236/335 (70%), Gaps = 1/335 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++I+TGGAGFIGSAL R+LV D   QV  +DKLTYA NL+SLK +S +    F   DIC
Sbjct: 1   MKVIITGGAGFIGSALVRHLVRDRDWQVANVDKLTYAANLDSLKSVSSAPNHRFFPADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   + +   + +PDAI++ AAE+HVDRSI G+ EFITTNI+GT +LLE  R + S L  
Sbjct: 61  DASAMDAIFADIEPDAIIHLAAETHVDRSINGSAEFITTNILGTHVLLESARRYLSNLDA 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG-LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
             +  FRF+ +STDEV+GSL  G  F+E   Y+P SPYSA+KA+SD+L  AW  TYG+P 
Sbjct: 121 SAQSHFRFVHVSTDEVFGSLPPGGFFTESTAYDPRSPYSASKAASDHLASAWHATYGLPT 180

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           + +NCSNNYGP+ FPEKLIPL I   +EG  + +YGDG+ VRDWL+V+DHV AL  V++ 
Sbjct: 181 ITTNCSNNYGPHQFPEKLIPLVILNALEGKPLPVYGDGRQVRDWLHVDDHVTALTRVVEH 240

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSS 299
           GRIGE YNIGG    +NI +V  I   LD L P  +   +LI  +EDRPGHDRRYAID S
Sbjct: 241 GRIGETYNIGGRAPMENIAVVEAICKALDTLRPAQHPRRDLIVHVEDRPGHDRRYAIDPS 300

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           KI+SE+GW  + +  +G+  TV WYLDN  WWRPL
Sbjct: 301 KIESELGWRAERSFATGIADTVQWYLDNESWWRPL 335


>gi|163803282|ref|ZP_02197161.1| dTDP-D-glucose 4;6-dehydratase [Vibrio sp. AND4]
 gi|159172919|gb|EDP57757.1| dTDP-D-glucose 4;6-dehydratase [Vibrio sp. AND4]
          Length = 349

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 189/349 (54%), Positives = 241/349 (69%), Gaps = 6/349 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ D +  V+ +DKLTYAGNL SL E++ S  + F  VDIC
Sbjct: 1   MKILVTGGAGFIGSAVIRHIIRDTQDSVINLDKLTYAGNLESLAEVADSERYHFEHVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
            R  +     E QPD +++ AAESHVDRSI G   FI TNI+GT+ LLE  R +WS L +
Sbjct: 61  QRNELERVFAEHQPDLVMHLAAESHVDRSIDGPAAFIDTNIMGTYYLLESARQYWSRLDE 120

Query: 121 DKKDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K  FRF  ISTDEVYG L   + LF+E   Y PSSPYSA+KASSD+LV AW  TYG P
Sbjct: 121 TRKAVFRFHHISTDEVYGDLAGSEDLFTETTSYAPSSPYSASKASSDHLVRAWQRTYGFP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            L++NCSNNYGPYHFPEKL+PL I   + G  + +YGDG  +RDWL+VEDH RALY V+ 
Sbjct: 181 TLVTNCSNNYGPYHFPEKLVPLMILNALAGKPLPVYGDGNQIRDWLFVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRY 294
           +G IGE YNIGG+NE+ NI++V  I  LL+ L P       S+  LI  ++DRPGHD RY
Sbjct: 241 EGEIGETYNIGGHNEKANIEVVKTICSLLEGLRPNKPAGVESYESLITHVKDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKELKPDND 343
           AID++KI   + W P+E  ESG+ KTV WYL+N  WW+ +       ND
Sbjct: 301 AIDATKIAQALNWTPEETFESGIRKTVEWYLNNQQWWQSVLDGSYSPND 349


>gi|29420389|gb|AAO39692.1| putative dTDP-glucose-4,6-dehydratase [Escherichia coli]
 gi|40950658|gb|AAR97956.1| RmlB [Shigella dysenteriae]
          Length = 362

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 196/358 (54%), Positives = 251/358 (70%), Gaps = 16/358 (4%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++++TGGAGFIGSA+ RY++N     V+ +DKLTYAGNL SLK+I ++  + F   DIC
Sbjct: 1   MKILITGGAGFIGSAVIRYIINHTNDSVVNVDKLTYAGNLQSLKDIEKNTRYKFECADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   ++      QPDA+++ AAESHVDRSI G  EFI TNIIGTFILLE  + +W  LS+
Sbjct: 61  DSAKMQEIFTNHQPDAVMHLAAESHVDRSINGPFEFIQTNIIGTFILLEIAKSYWLQLSE 120

Query: 121 DKKDQFRFLQISTDEVYGSL------DKG----LFSEDMPYNPSSPYSATKASSDYLVLA 170
            KK +F F  +STDEVYG L      D+G    LF+E   Y PSSPYSA+KASSD+LV A
Sbjct: 121 SKKKKFIFHHVSTDEVYGDLAHPDVLDEGSPLPLFTEKNGYAPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  T+G+PV+++NCSNNYGPYHFPEKLIPL I   ++G  + +YG G  +RDWLYVEDH 
Sbjct: 181 WYRTWGLPVIVTNCSNNYGPYHFPEKLIPLTILNALQGQPLPVYGTGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY-SHTELIRFIEDRPG 289
           RAL+LV+   R+GE YNIGG NE KNID+V ++  +LD + P S  S+ +LI F++DRPG
Sbjct: 241 RALHLVISSKRVGETYNIGGYNEMKNIDVVQKVCEILDEIQPLSEGSYKKLINFVKDRPG 300

Query: 290 HDRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKELKPDNDYSKW 347
           HDRRYAID++KI   +GW P E  ESG+ KTV WYL N  W      E   + +Y KW
Sbjct: 301 HDRRYAIDATKITEHLGWQPIETFESGIRKTVHWYLQNKAW-----VESVKNGNYKKW 353


>gi|83955937|ref|ZP_00964448.1| dTDP-glucose 4,6-dehydratase [Sulfitobacter sp. NAS-14.1]
 gi|83839701|gb|EAP78879.1| dTDP-glucose 4,6-dehydratase [Sulfitobacter sp. NAS-14.1]
          Length = 345

 Score =  389 bits (998), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 185/335 (55%), Positives = 236/335 (70%), Gaps = 4/335 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+L+VTGGAGFIGSA+ R  +      V+ +D LTYA  L ++  ++ S L+ F Q DIC
Sbjct: 1   MKLLVTGGAGFIGSAVVRLAIAQGH-SVVNLDALTYAACLENVASVADSPLYVFEQADIC 59

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DRE +       QPDA+++ AAESHVDRSI G   FI TN+ GT+ LLE  R +W     
Sbjct: 60  DREALDRIFTTHQPDAVMHLAAESHVDRSIDGPGAFIQTNVTGTYTLLEAARAYWQ--GA 117

Query: 121 DKKDQFRFLQISTDEVYGSLD-KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            K D FRF  ISTDEVYGSL   G F+ED PY+P SPYSA+KA+SD+LV AWG TYG+P+
Sbjct: 118 GKPDGFRFHHISTDEVYGSLGPTGQFTEDTPYDPRSPYSASKAASDHLVRAWGETYGLPI 177

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +L+NCSNNYGPYHFPEKL+P+ I + + G  + +YGDG NVRDWL+VEDH  AL  VL K
Sbjct: 178 VLTNCSNNYGPYHFPEKLVPVVILKALAGEPIPVYGDGANVRDWLFVEDHADALLTVLTK 237

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSS 299
           G++G  YNIGG NE  N+++V  I  LLD L P+   H +LI F+ DRPGHD+RYAID +
Sbjct: 238 GKLGRSYNIGGENEVSNLEMVKMICALLDDLHPEGAPHADLITFVADRPGHDQRYAIDPT 297

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           +I++E+GW P   +E GL +TV WYL+N  WWR L
Sbjct: 298 RIRTELGWRPSVTVEEGLARTVDWYLENKDWWRAL 332


>gi|218767223|ref|YP_002341735.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis Z2491]
 gi|218767235|ref|YP_002341747.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis Z2491]
 gi|12230535|sp|Q9S642|RFBB_NEIMA RecName: Full=dTDP-glucose 4,6-dehydratase
 gi|4574160|gb|AAD23919.1|AF083467_3 dTDP-D-glucose 4,6-dehydratase [Neisseria meningitidis]
 gi|121051231|emb|CAM07504.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis Z2491]
 gi|121051243|emb|CAM07518.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis Z2491]
 gi|302028157|gb|ADK90970.1| RfbB [Neisseria meningitidis]
 gi|319411430|emb|CBY91842.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis WUE 2594]
 gi|319411441|emb|CBY91856.1| dTDP-glucose 4,6-dehydratase [Neisseria meningitidis WUE 2594]
          Length = 341

 Score =  389 bits (998), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 184/332 (55%), Positives = 244/332 (73%), Gaps = 6/332 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           +++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL +I+ +  ++F QVDICD
Sbjct: 3   KILVTGGAGFIGSAVVRHIIRNTQDSVVNLDKLTYAGNLESLTDIADNPRYAFEQVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     + +PDA+++ AAESHVDRSI  A EFI TNI+GTF LLE  R +   +  +
Sbjct: 63  RAELDRVFAQHRPDAVMHLAAESHVDRSIGSAGEFIQTNIVGTFNLLEAARAYRQQMPSE 122

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           K + FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KHEAFRFHHISTDEVYGDLSGTDDLFTETAPYAPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I   ++G  + +YGDG  +RDWL+VEDH RALY V+ +
Sbjct: 183 IVTNCSNNYGPYHFPEKLIPLMILNALDGKPLPVYGDGMQIRDWLFVEDHARALYQVVTE 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NE+ NI++V  I  LL+ L P+  +    + +LI F++DRPGHD RYA
Sbjct: 243 GVVGETYNIGGHNEKANIEVVKTICALLEELAPEKPAGVARYEDLITFVQDRPGHDARYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDN 327
           +D++KI+ ++GW P E  ESGL KTV WYLDN
Sbjct: 303 VDTAKIRRDLGWQPLETFESGLRKTVQWYLDN 334


>gi|319897638|ref|YP_004135835.1| tdp-glucose 4,6-dehydratase [Haemophilus influenzae F3031]
 gi|317433144|emb|CBY81518.1| TDP-glucose 4,6-dehydratase [Haemophilus influenzae F3031]
          Length = 347

 Score =  388 bits (997), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 186/334 (55%), Positives = 241/334 (72%), Gaps = 6/334 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIGSAL RYL+     +++ +DKLTYAGNL SLK +     ++F+Q DICD 
Sbjct: 8   ILVTGGAGFIGSALVRYLLEKTHNKIVNVDKLTYAGNLASLKTVENHPRYAFVQADICDT 67

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
           + +     ++QPDA+++ AAESHVDRSI  + EFI TNI+GT+ LLE T  +W  L   K
Sbjct: 68  KALSYIFAQYQPDAVIHLAAESHVDRSINASSEFIQTNIVGTYRLLESTLDYWHRLDNQK 127

Query: 123 KDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           K  FRFL ISTDEVYG L  ++GLF+E   Y PSSPYSA+KA+SD+LV AW  TYG+P +
Sbjct: 128 KSSFRFLHISTDEVYGDLKSNEGLFTETSAYKPSSPYSASKAASDHLVQAWYRTYGLPTI 187

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           +++ SNNYGPY +PEKLIPL I   IEG  + +YGDG  +RDWL+VEDH+ ALY VL KG
Sbjct: 188 ITHSSNNYGPYQYPEKLIPLMILNAIEGKTLPIYGDGLQIRDWLFVEDHIDALYNVLMKG 247

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHT----ELIRFIEDRPGHDRRYAI 296
            IGE YNIGGNNE+ NID+V  I  LL+  +P    +     +LI +++DRPGHD RYA+
Sbjct: 248 NIGEAYNIGGNNEKSNIDVVRSICSLLEEFLPNKPKYIDKYEDLICYVQDRPGHDLRYAL 307

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           D+SKI  ++GW P+E  ESGL KTV WYL++  W
Sbjct: 308 DTSKINHKLGWIPKETFESGLRKTVIWYLNHQEW 341


>gi|332286411|ref|YP_004418322.1| dTDP-glucose 4,6-dehydratase [Pusillimonas sp. T7-7]
 gi|330430364|gb|AEC21698.1| dTDP-glucose 4,6-dehydratase [Pusillimonas sp. T7-7]
          Length = 340

 Score =  388 bits (997), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 187/331 (56%), Positives = 238/331 (71%), Gaps = 6/331 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           +++VTGGAGFIGS L R+++ +    V+ IDKLTYAGNL SL  +S SN ++F   DIC+
Sbjct: 3   KILVTGGAGFIGSTLIRHIIGNTGDFVVNIDKLTYAGNLQSLTSVSSSNRYAFEHADICN 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +    +++QPDA+V+ AAESHVDRSI G   FI TNI+GT+ LLE  R  WS L   
Sbjct: 63  RADLGHIFEQYQPDAVVHLAAESHVDRSIDGPAAFIQTNIVGTYTLLEVARQHWSALGSA 122

Query: 122 KKDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            K  FRF  +STDEVYG L   +G F+E  PY PSSPYSA+KA SD+LV AW  TYG+PV
Sbjct: 123 AKAGFRFHHVSTDEVYGDLAGPQGRFTEATPYAPSSPYSASKAGSDHLVRAWNRTYGLPV 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           ++S+ SNN+GP+ +PEKLIPL I   +EG  + +YG GQ+VRDWLYVEDH RALY +L +
Sbjct: 183 VVSHSSNNHGPWQYPEKLIPLMILNALEGKPLPVYGQGQHVRDWLYVEDHARALYQILSE 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
           G +GE YN+GG NE++NID+V  I  LL+ L P   +    + ELI+F++DRPGHD RYA
Sbjct: 243 GVVGETYNVGGRNEKRNIDVVRAICALLEELAPAKPAGVGRYDELIKFVKDRPGHDMRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLD 326
           ID+ KI  E+GW PQE  ESGL KTV WYLD
Sbjct: 303 IDAGKIHRELGWTPQETFESGLRKTVQWYLD 333


>gi|163748893|ref|ZP_02156145.1| dTDP-glucose 4,6-dehydratase [Shewanella benthica KT99]
 gi|161331667|gb|EDQ02472.1| dTDP-glucose 4,6-dehydratase [Shewanella benthica KT99]
          Length = 357

 Score =  388 bits (997), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 186/337 (55%), Positives = 246/337 (72%), Gaps = 5/337 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIGSAL R L+N+    V+ +DKLTYAGNL SL  IS +  + F+  DIC+ 
Sbjct: 9   ILVTGGAGFIGSALIRLLINETSHTVINLDKLTYAGNLKSLTSISANRRYHFIHGDICNS 68

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
           E I+  L ++ PD +++ AAESHVDRSI G+ EFI TNI+GT+ LLE  R +++ L  +K
Sbjct: 69  ELIQRLLSQYNPDIVMHLAAESHVDRSIDGSAEFIQTNIVGTYCLLEACRNYFARLDTEK 128

Query: 123 KDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLL 181
           +  FRF  +STDEV+G L D GLF+E+ PY PSSPYSA+KA++D+LV AW  TY +PV+L
Sbjct: 129 QATFRFHHVSTDEVFGELGDTGLFTENSPYQPSSPYSASKAAADHLVRAWSRTYKLPVVL 188

Query: 182 SNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKGR 241
           SNCSNNYGPY +PEKLIPL + + + G  + +YGDGQ +RDWL+VEDHVRALYLV  +G+
Sbjct: 189 SNCSNNYGPYQYPEKLIPLVLHKALAGESLPIYGDGQQIRDWLHVEDHVRALYLVALRGK 248

Query: 242 IGERYNIGGNNERKNIDIVFEIGFLLDALI----PKSYSHTELIRFIEDRPGHDRRYAID 297
           +GE YNIGG NE+ N+ +V EI   L+  I    P      +LI F+ DRPGHDRRYAID
Sbjct: 249 LGETYNIGGGNEKTNLAVVTEICERLNTCILDKPPGIDDFKQLITFVADRPGHDRRYAID 308

Query: 298 SSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           +SKI+ E+ W P +N ESGL  T+ WY++N  W++ L
Sbjct: 309 ASKIEQELSWQPLQNFESGLASTLNWYINNPEWYQGL 345


>gi|332290202|ref|YP_004421054.1| dTDP-glucose 4,6 dehydratase [Gallibacterium anatis UMN179]
 gi|330433098|gb|AEC18157.1| dTDP-glucose 4,6 dehydratase [Gallibacterium anatis UMN179]
          Length = 344

 Score =  388 bits (997), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 187/336 (55%), Positives = 242/336 (72%), Gaps = 6/336 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++ +TGGAGFIGSA+ RY++N+ +  V+ +DKLTYAGN+ SL E+S+S  + F QVDIC
Sbjct: 1   MKIFITGGAGFIGSAVIRYIINNTQNSVINVDKLTYAGNIESLIEVSKSKRYFFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +      ++PDA+++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W  L++
Sbjct: 61  DSAALERIFSHYKPDAVMHLAAESHVDRSIDGPAGFIKTNIVGTYTLLEAARKYWLQLNE 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           ++K QFRF  ISTDEVYG L   + LF+E   Y PSSPYSA+KASSD+LV AW  T+G+P
Sbjct: 121 NQKQQFRFHHISTDEVYGDLQGKEKLFTETTAYAPSSPYSASKASSDHLVRAWHRTFGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYGPY   EKLIPL I   + G  + +YG+G  +RDWL+VEDH RALY V+ 
Sbjct: 181 TIVTNCSNNYGPYQHSEKLIPLMILNALSGKKLPIYGNGMQIRDWLFVEDHTRALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRY 294
           +G+IGE YNIGG+ E+ NID+V  I  LL+ L P       ++ +LI F+ DRPGHD RY
Sbjct: 241 EGKIGETYNIGGHCEKANIDVVKMICELLEKLAPNKPDGVKNYADLITFVTDRPGHDFRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           AIDSSKI+ E+GW PQE  ESGL KTV WYL N  W
Sbjct: 301 AIDSSKIQKELGWHPQETFESGLRKTVEWYLANRDW 336


>gi|325577350|ref|ZP_08147798.1| dTDP-glucose 4,6-dehydratase [Haemophilus parainfluenzae ATCC
           33392]
 gi|325160674|gb|EGC72796.1| dTDP-glucose 4,6-dehydratase [Haemophilus parainfluenzae ATCC
           33392]
          Length = 337

 Score =  388 bits (997), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 184/333 (55%), Positives = 247/333 (74%), Gaps = 6/333 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R+++TGG+GFIGSAL RY++N  +  V+ IDKLTYA N +SLKE+  +  ++F Q+DICD
Sbjct: 4   RILITGGSGFIGSALIRYIINQTQYSVINIDKLTYAANQSSLKEVENNPRYAFEQIDICD 63

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
            + I +  +++QPDA+++ AAESHVDRSI GA +FI TNI+GT+ LLE  + +W  L + 
Sbjct: 64  LKAIGNIFEKYQPDAVMHLAAESHVDRSITGAADFIQTNIVGTYTLLEVVKNYWHTLDKA 123

Query: 122 KKDQFRFLQISTDEVYG--SLDKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG  S  +  F+E  PY+PSSPYSA+KA+SD+LV AW  TYG+PV
Sbjct: 124 KKTTFRFHHISTDEVYGDLSFSEPAFTEHSPYHPSSPYSASKAASDHLVHAWHRTYGLPV 183

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++N SNNYG Y   EKLIPL I+  + G  + +YGDG+ +RDWL+VEDHV+ALYLVL K
Sbjct: 184 IITNSSNNYGAYQHAEKLIPLMISNAVMGKPLPIYGDGRQIRDWLFVEDHVQALYLVLTK 243

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHT----ELIRFIEDRPGHDRRYA 295
           GR+GE YNIGGN E+ N+++V  I  LL+ L+P   +H     +LI F++DRPGHD RY+
Sbjct: 244 GRVGESYNIGGNCEKTNLEVVKMICELLEELVPNKPNHIKYYEDLITFVKDRPGHDVRYS 303

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNN 328
           +D SKI +E+GW PQ   E GL +TV WYL+NN
Sbjct: 304 LDCSKIHAELGWQPQITFEQGLRQTVKWYLENN 336


>gi|315178435|gb|ADT85349.1| dTDP-glucose 4,6-dehydratase [Vibrio furnissii NCTC 11218]
          Length = 359

 Score =  388 bits (996), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 185/338 (54%), Positives = 242/338 (71%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ RY++ +    V+ ID LTYAGNL SL  +  +  ++F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVVRYIIENTSDSVVNIDCLTYAGNLESLSMVDSNERYAFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +R  +     E +P+A+++ AAESHVDRSI G+  FI TNI GT+ LLE  R +W+ L +
Sbjct: 61  NRYELDRVFFEHKPEAVMHLAAESHVDRSITGSSTFIETNISGTYTLLEAAREYWNTLEK 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
             K++FRF  ISTDEVYG L+    LF+E+  Y+PSSPYSA+KA+SD+LV AW  TYG P
Sbjct: 121 SAKERFRFHHISTDEVYGDLEGTDDLFTEETSYHPSSPYSASKAASDHLVRAWHRTYGFP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            L++NCSNNYGPY FPEKLIPL I   +EG  + +YG+G  +RDWL+VEDH RALY VL 
Sbjct: 181 TLVTNCSNNYGPYQFPEKLIPLVILNALEGKKLPVYGNGLQIRDWLFVEDHARALYRVLT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRY 294
            G  G+ YNIGG+NE+ NID+V  I  LL+ L P+      ++ +LI ++ DRPGHD RY
Sbjct: 241 AGTTGQTYNIGGHNEKANIDVVKSICLLLEELAPEKPLGVNAYQDLIEYVSDRPGHDMRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID+SKI+ E+ W P+E   SGL KTV WYLDN  WW+
Sbjct: 301 AIDASKIERELSWKPEETFISGLRKTVLWYLDNKSWWQ 338


>gi|329119281|ref|ZP_08247968.1| dTDP-glucose 4,6-dehydratase [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327464628|gb|EGF10926.1| dTDP-glucose 4,6-dehydratase [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 353

 Score =  388 bits (996), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 183/338 (54%), Positives = 239/338 (70%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M L++TGGAGFIGSAL R+L+ +   +V+ +DKLTYAGNL SL  ++ S  ++F   DIC
Sbjct: 1   MTLLITGGAGFIGSALIRHLIQNTSERVVNLDKLTYAGNLQSLAAVAGSPRYTFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     + QP A+++ AAESHVDRSI  A EFI TNI+GTF LLE  R ++    +
Sbjct: 61  DRAALERIFAQHQPRAVMHLAAESHVDRSIDSAGEFIQTNIVGTFTLLEAARAYFEKQPE 120

Query: 121 DKKDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           +++  FRF  ISTDEVYG L    GLF+E  PY PSSPYSA+KAS D+LV AW  TY +P
Sbjct: 121 NQRAAFRFHHISTDEVYGDLHDSDGLFTETTPYAPSSPYSASKASGDHLVRAWQRTYRLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            L++NCSNNYGP HFPEKLIP  I   + G  + +YGDG  +RDWLYVEDH RAL+ V+ 
Sbjct: 181 TLITNCSNNYGPCHFPEKLIPHIILNALAGRPLPIYGDGSQIRDWLYVEDHARALHTVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
            G+ GE YNIGG+NE+ N+++V  +  LL+ L P+  +    +T+LI  + DRPGHD RY
Sbjct: 241 HGKTGETYNIGGHNEKTNLEVVRTVCALLEELAPRKPAGIARYTDLITHVPDRPGHDTRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID++KI+ E+GW PQE  +SG+ KTV WYLDN  WW+
Sbjct: 301 AIDAAKIQRELGWAPQETFDSGIRKTVQWYLDNPDWWQ 338


>gi|157373248|ref|YP_001471848.1| dTDP-glucose 4,6-dehydratase [Shewanella sediminis HAW-EB3]
 gi|157315622|gb|ABV34720.1| dTDP-glucose 4,6-dehydratase [Shewanella sediminis HAW-EB3]
          Length = 367

 Score =  388 bits (996), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 191/335 (57%), Positives = 244/335 (72%), Gaps = 5/335 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIGSAL R+L+N+   +V+ +DKLTYAGNL SL  I  +  + F+  DICDR
Sbjct: 9   VLVTGGAGFIGSALVRFLINETSHRVINLDKLTYAGNLESLTSIESNERYHFILGDICDR 68

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             +   LK +QPD I++ AAESHVDRSI G DEFI TNI+GT+ LLE +R + + L   K
Sbjct: 69  PLVDDILKRYQPDIIMHLAAESHVDRSIDGPDEFIQTNILGTYTLLEASRSYLAELEGCK 128

Query: 123 KDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLL 181
           +  FRF  ISTDEVYG L + GLF+E  PYNPSSPYSA+KA+SD+LV AW  T+ +PV++
Sbjct: 129 QQDFRFHHISTDEVYGDLGETGLFTEQSPYNPSSPYSASKAASDHLVRAWCRTFQLPVVI 188

Query: 182 SNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKGR 241
           +NCSNNYGP+ FPEKLIPL I   +EG  + +YGDG+ VRDWLYV+DH RALY V   G+
Sbjct: 189 TNCSNNYGPFQFPEKLIPLVILNALEGKPLPVYGDGKQVRDWLYVDDHARALYKVATDGK 248

Query: 242 IGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTE----LIRFIEDRPGHDRRYAID 297
            G  YNIGG NE++NID++  I   L++LI    S  E    LI +++DRPGHD RYAID
Sbjct: 249 PGSTYNIGGYNEKQNIDVITTICDQLNSLIESKPSGIEEFNQLITYVKDRPGHDLRYAID 308

Query: 298 SSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ++KIK+E+GW P E  ESG+ KT+ WYLDN  W R
Sbjct: 309 ATKIKNELGWKPVETFESGIVKTIQWYLDNLEWCR 343


>gi|261492901|ref|ZP_05989447.1| dTDP-glucose 4,6-dehydratase [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|261496749|ref|ZP_05993124.1| dTDP-glucose 4,6-dehydratase [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261307588|gb|EEY08916.1| dTDP-glucose 4,6-dehydratase [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261311442|gb|EEY12599.1| dTDP-glucose 4,6-dehydratase [Mannheimia haemolytica serotype A2
           str. BOVINE]
          Length = 342

 Score =  388 bits (996), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 181/337 (53%), Positives = 243/337 (72%), Gaps = 6/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           + +++TGGAGFIGSAL R+L       ++ +DKLTYA NL S+K +  S  + F QVDIC
Sbjct: 3   LNVLITGGAGFIGSALIRFLAKQTDHHIINVDKLTYAANLASIKTVQNSERYYFEQVDIC 62

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
               I     ++QPDA+++ AAESHVDRSI  A EFI TNI+GT+ LLE TR +W  L +
Sbjct: 63  ASGQISEIFCKYQPDAVMHLAAESHVDRSIKSAGEFIQTNIVGTYSLLEVTRQYWEHLPE 122

Query: 121 DKKDQFRFLQISTDEVYG--SLDKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            +K  FRF+ ISTDEVYG   L     +E++PY PS+PYSA+KAS+D+LV AW  TYG+P
Sbjct: 123 PRKSAFRFIHISTDEVYGDLPLTAEPSAENLPYAPSNPYSASKASADHLVRAWYRTYGLP 182

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNN+GPY +PEKLIPL I+  ++G  + +YGDG  +RDW++VEDH+RALY VL 
Sbjct: 183 AIITNCSNNFGPYQYPEKLIPLMISNALQGKALPIYGDGLQIRDWIFVEDHIRALYDVLI 242

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRY 294
           KG++G  YNIG + E+ NI++V+ I  LL+ L+P        + +LIR+++DRPGHD RY
Sbjct: 243 KGKLGASYNIGSHQEKSNIEVVYSICELLEELVPNKPKNVKKYVDLIRYVQDRPGHDVRY 302

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           A+DS+KI+ E+GW PQE  ESGL KTV WYLDN  WW
Sbjct: 303 ALDSTKIQKELGWKPQETFESGLRKTVNWYLDNKEWW 339


>gi|114769672|ref|ZP_01447282.1| dTDP-D-glucose-4,6-dehydratase [alpha proteobacterium HTCC2255]
 gi|114549377|gb|EAU52259.1| dTDP-D-glucose-4,6-dehydratase [alpha proteobacterium HTCC2255]
          Length = 340

 Score =  388 bits (996), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 186/337 (55%), Positives = 245/337 (72%), Gaps = 2/337 (0%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           +++VTGGAGFIGSA+ R+++ +    V+ ID LTYAGNL SL+  + ++ ++F QVDIC+
Sbjct: 4   KVLVTGGAGFIGSAVIRFILQNTDDCVVNIDALTYAGNLESLQGTASNSAYTFEQVDICN 63

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           ++ +     E  PD +++ AAESHVDRSI    +FI TN++GT+ +LE  + +WS L ++
Sbjct: 64  KKELVRVFSEHSPDVVMHLAAESHVDRSINSPSDFILTNVVGTYNMLEVAKAYWSNLDKN 123

Query: 122 KKDQFRFLQISTDEVYGSLDKG-LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           K+D+F F  ISTDEVYG L+ G LF+E+ PY PSSPYSA+KA+SD+LV AW  TY  PV+
Sbjct: 124 KQDRFIFHHISTDEVYGDLEDGELFTEETPYCPSSPYSASKAASDHLVRAWFRTYDFPVV 183

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           +SNCSNNYGPY FPEKLIPL I   IEG  + +YG G  VRDWLYVEDH  ALY V+ KG
Sbjct: 184 ISNCSNNYGPYQFPEKLIPLIINNAIEGKKLPIYGAGDQVRDWLYVEDHAEALYKVVTKG 243

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIP-KSYSHTELIRFIEDRPGHDRRYAIDSS 299
           ++G+ YNIGG+NE+KNID+V  I  LLD LIP    S+T  I  +EDRPGHD+RYAID++
Sbjct: 244 KLGQTYNIGGHNEKKNIDVVMTICNLLDELIPLADRSYTSQITHVEDRPGHDKRYAIDAA 303

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYK 336
           KI  ++ W P E  ESG+ KTV WYLDN  W   + K
Sbjct: 304 KISRDLSWQPSETFESGIRKTVLWYLDNKEWCVAVTK 340


>gi|51246072|ref|YP_065956.1| dTDP-glucose 4,6-dehydratase [Desulfotalea psychrophila LSv54]
 gi|50877109|emb|CAG36949.2| probable dTDP-glucose 4,6-dehydratase [Desulfotalea psychrophila
           LSv54]
          Length = 351

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 185/334 (55%), Positives = 244/334 (73%), Gaps = 3/334 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++++TGGAGFIGSA+ R+++ +    V+ + +LTYAGNL SL EI +S  +SF QVDI 
Sbjct: 1   MKILITGGAGFIGSAVIRHIIQNTNDSVINLUQLTYAGNLESLSEIEKSPRYSFAQVDIU 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +   +     + QPDA+++ AAESHVDRSI G  +FI TNI+GT  LLE TR  W  L+ 
Sbjct: 61  EATSLNDLFTKTQPDAVMHLAAESHVDRSIDGPKDFIETNIVGTCNLLEATRQHWLTLAI 120

Query: 121 DKKDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
             +++FRF  ISTDEVYG L  D   F ED  Y PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 ADRNKFRFHHISTDEVYGDLKKDDPAFCEDNSYAPSSPYSASKASSDHLVRAWHRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V++SNCSNNYGP+ FPEKLIPL I   +EG  + +YG G+ +RDWLYVEDH RALY VL 
Sbjct: 181 VVISNCSNNYGPFQFPEKLIPLVILNALEGKKIPVYGTGEQIRDWLYVEDHARALYAVLS 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIP-KSYSHTELIRFIEDRPGHDRRYAID 297
           +G++G+ YNIGG+NE+ NI+++  I  LL  +IP KS ++ +LI  +EDRPGHD RYAID
Sbjct: 241 RGKVGDTYNIGGHNEKTNIEVIETICQLLQEIIPGKSSNYLDLISHVEDRPGHDLRYAID 300

Query: 298 SSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           ++KI +++ W PQE  E+GL KTV WY++N  WW
Sbjct: 301 ATKISTDLDWRPQETFETGLRKTVTWYVNNKKWW 334


>gi|163793776|ref|ZP_02187750.1| dTDP-glucose 4,6-dehydratase [alpha proteobacterium BAL199]
 gi|159180887|gb|EDP65404.1| dTDP-glucose 4,6-dehydratase [alpha proteobacterium BAL199]
          Length = 359

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 183/337 (54%), Positives = 239/337 (70%), Gaps = 3/337 (0%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIGSA+ R L+ +  + V+ +D +TYA +  +L  +  +  ++F Q DI D 
Sbjct: 7   ILVTGGAGFIGSAVVRLLIAETDVSVVNLDVMTYAASGTALAAVEGNPRYAFEQADIRDA 66

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
           + +       +PDA+++ AAESHVDRSI G ++FI TN++GTF LL+  R  W  LS   
Sbjct: 67  DALADVFARHRPDAVMHLAAESHVDRSIDGPEDFIMTNVVGTFRLLQAARAHWETLSGSA 126

Query: 123 KDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLL 181
           K  FRF  ISTDEV+GSL D G F+E+  Y+P SPYSA+KASSD+LV AWG TYG+P+LL
Sbjct: 127 KADFRFHHISTDEVFGSLGDDGYFTEETAYDPRSPYSASKASSDHLVRAWGETYGLPILL 186

Query: 182 SNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKGR 241
           SNCSNNYGPYHFPEKLIPL I + + G  + +YGDG N+RDWLYVEDH RAL+ VL KG 
Sbjct: 187 SNCSNNYGPYHFPEKLIPLMILKGLRGDPLPVYGDGSNIRDWLYVEDHARALWTVLSKGV 246

Query: 242 IGERYNIGGNNERKNIDIVFEIGFLLDALIPKS--YSHTELIRFIEDRPGHDRRYAIDSS 299
            G+ YN+GG+NE+ N+D+V  I  LLD   P+S   S  + I F+ DRPGHD RYAID  
Sbjct: 247 PGDSYNVGGHNEKTNLDVVHTICDLLDKHAPRSDGVSRRDQISFVTDRPGHDFRYAIDPG 306

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYK 336
           KI  ++GW P+E  ESG+ KTV WYLDN  WW+P+ +
Sbjct: 307 KIDRDLGWTPRETFESGIEKTVRWYLDNASWWQPIVQ 343


>gi|225077088|ref|ZP_03720287.1| hypothetical protein NEIFLAOT_02141 [Neisseria flavescens
           NRL30031/H210]
 gi|224951645|gb|EEG32854.1| hypothetical protein NEIFLAOT_02141 [Neisseria flavescens
           NRL30031/H210]
          Length = 354

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 182/338 (53%), Positives = 245/338 (72%), Gaps = 6/338 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M +++TGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL E++ +  ++F QVDIC
Sbjct: 1   MTVLITGGAGFIGSAVVRHIIQNTQDSVVNVDKLTYAGNLESLTEVAGNPRYAFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     + +PDA+++ AAESHVDRSI  A EFI TNI+GTF LLE  R +W  +  
Sbjct: 61  DRAELDRIFAQHRPDAVMHLAAESHVDRSIDSAGEFIQTNIVGTFNLLEAARAYWQQMPS 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           ++++ FRF  ISTDEVYG L     L +E  PY PS+PY+A+KASSD+LV AW  TYG+P
Sbjct: 121 EQREAFRFHHISTDEVYGDLHGTDDLSAETAPYAPSNPYAASKASSDHLVRAWQRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            ++SNCSNNYGP  FPEKLIPL I   + G  + +YGDG  +RDWL+VEDH RALY V+ 
Sbjct: 181 AIVSNCSNNYGPRQFPEKLIPLTILNALGGKPLPVYGDGAQIRDWLFVEDHARALYQVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G +GE YNIGG+NE+ NI++V  I  LL+ L+P+  +    + +LI F+ DRPGHD RY
Sbjct: 241 EGVVGETYNIGGHNEKVNIEVVKTICALLEELVPEKPAGVARYEDLITFVPDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           AID++KI+ ++GW P E  ESG+ KTV WYLDN  WW+
Sbjct: 301 AIDAAKIRRDLGWQPLETFESGIRKTVQWYLDNKTWWQ 338


>gi|307261952|ref|ZP_07543610.1| dTDP-glucose 4,6-dehydratase [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|306868363|gb|EFN00182.1| dTDP-glucose 4,6-dehydratase [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
          Length = 357

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 188/338 (55%), Positives = 243/338 (71%), Gaps = 6/338 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           + +TGGAGFIGSA+ RY++ + + +V+ +DKLTYAGNL SL  +S S+ + F QVDICD 
Sbjct: 4   VFITGGAGFIGSAVIRYIIQNTQDRVVNVDKLTYAGNLTSLASVSNSSRYHFEQVDICDS 63

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             I     ++QPDA+++ AAESHVDRSI G   F+ TNIIGT+ LLE +R +W  L  ++
Sbjct: 64  GRISQLFCKYQPDAVMHLAAESHVDRSIGGPATFMQTNIIGTYTLLEASRRYWLSLPLER 123

Query: 123 KDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           K  FRF  ISTDEVYG L     LF+E   Y PSSPYSA+KA+SD+LV AW  TYG+P L
Sbjct: 124 KQIFRFHHISTDEVYGDLKSSDELFTEKTAYAPSSPYSASKAASDHLVRAWFRTYGLPTL 183

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           ++NCSNNYGP+ FPEKLIPL I + + GS + +YG+G  +RDWL+VEDH  ALY VL +G
Sbjct: 184 VTNCSNNYGPFQFPEKLIPLMILKALSGSPLPIYGNGLQIRDWLFVEDHAIALYKVLCEG 243

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYAI 296
           ++GE YNIGG+NE+ NI++V  I  LLD  +P   +    + ELI +I+DRPGHD RYAI
Sbjct: 244 KVGETYNIGGHNEKTNIEVVRMICRLLDEFVPSRLNGVSKYEELITYIQDRPGHDIRYAI 303

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           D+ KI  E+GW PQE  ESGL KTV WYL N  WW+ +
Sbjct: 304 DARKITDELGWQPQETFESGLRKTVEWYLSNKDWWQSI 341


>gi|75674742|ref|YP_317163.1| dTDP-glucose 4,6-dehydratase [Nitrobacter winogradskyi Nb-255]
 gi|74419612|gb|ABA03811.1| dTDP-glucose 4,6-dehydratase [Nitrobacter winogradskyi Nb-255]
          Length = 355

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 184/334 (55%), Positives = 247/334 (73%), Gaps = 2/334 (0%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           + VTGGAGFIGSA+ R+L++D   +V+ IDK TYA NL+SL   +++  ++F +  ICD 
Sbjct: 8   IFVTGGAGFIGSAVVRHLLHDTHARVVNIDKCTYAANLDSLPGTNENLNYAFEKQCICDS 67

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             +R   ++++PDA++N AAESHVDRSI G  EFI TNI+GTF LL+ET   W  LS +K
Sbjct: 68  AGLRHLFEKYRPDAVMNLAAESHVDRSIDGPGEFIQTNIVGTFTLLQETLRHWRSLSPEK 127

Query: 123 KDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLL 181
           +++FRFL +STDEV+GSL D G F+E   Y P+SPYSA+KASSD+LV AW  TY +P L+
Sbjct: 128 REKFRFLHVSTDEVFGSLGDSGYFTEATAYAPNSPYSASKASSDHLVRAWRETYELPTLI 187

Query: 182 SNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKGR 241
           +NCSNNYGPYHFPEKLIP  I + +    + +YGDG+N+RDWLYV+DH RAL LVL+ G 
Sbjct: 188 TNCSNNYGPYHFPEKLIPHMIIKGLACEPLPVYGDGRNIRDWLYVDDHARALSLVLEHGA 247

Query: 242 IGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS-HTELIRFIEDRPGHDRRYAIDSSK 300
           +G  YN+GG NER N+ +V  I  LLD + P + + H +LI F+ DRPGHDRRYAID+SK
Sbjct: 248 VGHTYNVGGRNERTNLHVVESICDLLDEIAPNTTNRHRDLITFVTDRPGHDRRYAIDASK 307

Query: 301 IKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           ++ E+GW  +E+ ESG+ KTV WY+D   WW+ +
Sbjct: 308 LERELGWRAKEDFESGIEKTVRWYVDEQPWWQAI 341


>gi|312115797|ref|YP_004013393.1| dTDP-glucose 4,6-dehydratase [Rhodomicrobium vannielii ATCC 17100]
 gi|311220926|gb|ADP72294.1| dTDP-glucose 4,6-dehydratase [Rhodomicrobium vannielii ATCC 17100]
          Length = 354

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 182/340 (53%), Positives = 243/340 (71%), Gaps = 3/340 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++IVTGGAGFIGSAL R+L+ +    VL +DKLTYA +L SL  ++ +  +SF+   IC
Sbjct: 1   MKIIVTGGAGFIGSALVRHLIEETTHTVLNLDKLTYAASLASLACVAHNPRYSFVHGSIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +   +  F PD  +N AAE+HVDRSI G   FI TNI GTF LL+  +     L  
Sbjct: 61  DSALLERVVATFDPDGFINLAAETHVDRSIDGPVAFIDTNINGTFRLLQAAQAHVERLPT 120

Query: 121 DKKDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           D++ +FRFL +STDEVYGSL + G F E  PY+P SPYSA+KA+SD+LV AWGHTYG+P+
Sbjct: 121 DRRARFRFLHVSTDEVYGSLGETGKFHEATPYDPRSPYSASKAASDHLVSAWGHTYGLPI 180

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPY FPEKLIPL I + + G  + +YG G+N+RDWLYV+DHVRAL  V ++
Sbjct: 181 LITNCSNNYGPYQFPEKLIPLCIIKALAGEALPVYGRGENIRDWLYVDDHVRALTTVFER 240

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS--HTELIRFIEDRPGHDRRYAID 297
           G  GE YNIGG+ ER+NID+V  I  +LD L P+     + +LI F+ DRPGHD RYAID
Sbjct: 241 GTPGETYNIGGDAERRNIDVVHRICAVLDTLRPRDSGKHYADLITFVADRPGHDARYAID 300

Query: 298 SSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKE 337
           +SKI++E+GW P+++ ++G+  TV WYL+N  WW  +  +
Sbjct: 301 ASKIRAELGWSPEQSFDAGIEATVKWYLENEDWWEDILAQ 340


>gi|92118531|ref|YP_578260.1| dTDP-glucose 4,6-dehydratase [Nitrobacter hamburgensis X14]
 gi|91801425|gb|ABE63800.1| dTDP-glucose 4,6-dehydratase [Nitrobacter hamburgensis X14]
          Length = 350

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 183/334 (54%), Positives = 237/334 (70%), Gaps = 1/334 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSA+CR LV      V+ IDKLTYA NL SL  ++    ++F QVDIC
Sbjct: 1   MRVLVTGGAGFIGSAVCRRLVLGYGTAVVNIDKLTYAANLRSLDALAGEPGYAFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     +++PDA ++ AAESHVDRSI G   FI TN++GT+ +LE  R ++  L+ 
Sbjct: 61  DRADVEGVFAKYEPDATIHLAAESHVDRSITGPSAFINTNVVGTYNMLEAARKYYDRLTP 120

Query: 121 DKKDQFRFLQISTDEVYGSLDK-GLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           +++D+FRF+ +STDEVYGSL   GLF E+  Y PSSPYSA+KA+SD+L  AW  TY +PV
Sbjct: 121 ERRDRFRFVHVSTDEVYGSLGAAGLFCEETSYRPSSPYSASKAASDHLAHAWFKTYELPV 180

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           ++SNCSNNYGPY FPEKLIPLAI   IE   + +YG G+NVRDWLYV+DH   L  +L+ 
Sbjct: 181 IISNCSNNYGPYQFPEKLIPLAILNAIECKPLPIYGRGRNVRDWLYVDDHADGLIALLRC 240

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSS 299
           G  GE+YN GGN+ER N+++V  I   LD ++P       LIRF+ DRPGHD RYAID+S
Sbjct: 241 GSPGEKYNFGGNSERTNLEVVELICDTLDCMMPAPDERRSLIRFVADRPGHDLRYAIDAS 300

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRP 333
           K + E+GW P+   E G+ +TV WYLDN  WW P
Sbjct: 301 KARRELGWAPKGTFEKGIEQTVHWYLDNRSWWAP 334


>gi|319942929|ref|ZP_08017212.1| dTDP-glucose 4,6-dehydratase [Lautropia mirabilis ATCC 51599]
 gi|319743471|gb|EFV95875.1| dTDP-glucose 4,6-dehydratase [Lautropia mirabilis ATCC 51599]
          Length = 389

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 187/331 (56%), Positives = 240/331 (72%), Gaps = 3/331 (0%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIGS      +      V+ +DKLTYAGN  +L  +  +    F QVDICDR
Sbjct: 33  ILVTGGAGFIGSNFVLDWLAGSDEPVVNVDKLTYAGNRQNLASLEGNPAHHFEQVDICDR 92

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
           E I + L +++P A+V+FAAESHVDRSI G   F+ TN++GTF LLE  R +W+ L   +
Sbjct: 93  EAIDALLAKYKPRAMVHFAAESHVDRSIHGPAAFVQTNMVGTFTLLEAARQYWNQLQGAE 152

Query: 123 KDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           K+ FRFL +STDEVYGSL  D   F+E  PY P+SPYSA+KA SD+LV A+ HTYG+PVL
Sbjct: 153 KENFRFLHVSTDEVYGSLEADDPAFTETTPYQPNSPYSASKAGSDHLVRAYFHTYGMPVL 212

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
            +NCSNNYGPYHFPEKLIPL IT  + G ++ +YGDG+NVRDWL+V+DH  A+  VL+ G
Sbjct: 213 TTNCSNNYGPYHFPEKLIPLVITNALAGKNLPIYGDGKNVRDWLFVKDHCSAIRRVLEAG 272

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY-SHTELIRFIEDRPGHDRRYAIDSS 299
           + GE YN+GG+NE+ NIDIV +I  LLD + P +  S+  LI F++DRPGHDRRYAID++
Sbjct: 273 KPGETYNVGGHNEKTNIDIVRQICKLLDEMKPDAAGSYERLITFVKDRPGHDRRYAIDAA 332

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           KI  E+GW P E  E+G+ KTV WYLDN  W
Sbjct: 333 KIGRELGWTPAETFETGIRKTVRWYLDNQDW 363


>gi|299067780|emb|CBJ38990.1| dTDP-glucose 4,6 dehydratase, NAD(P)-binding [Ralstonia
           solanacearum CMR15]
          Length = 354

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 190/333 (57%), Positives = 236/333 (70%), Gaps = 4/333 (1%)

Query: 2   RLIVTGGAGFIGSALC-RYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
            ++VTGGAGFIG      +L N     V+ +DKLTYAGN  +L  + Q     F Q DIC
Sbjct: 3   HILVTGGAGFIGGNFVLNWLANPGADGVVNVDKLTYAGNRKTLAAVEQDPRHIFSQTDIC 62

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  + S L + +P A+V+FAAESHVDRSI G  EFI TNI+GTF LLE  R +W  L  
Sbjct: 63  DRAALDSLLAQHKPRAVVHFAAESHVDRSIHGPAEFIQTNIVGTFTLLEAVRAYWGGLDA 122

Query: 121 DKKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           D K  FRFL +STDEV+GSL      FSE  PY P+SPYSA+KA+SD+LV A+ HTYG+P
Sbjct: 123 DAKAAFRFLHVSTDEVFGSLSATDPQFSETTPYAPNSPYSASKAASDHLVRAYHHTYGLP 182

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           VL +NCSNNYGPYHFPEKLIPL IT  + G  + +YGDGQNVRDWLYV DH  A+  VL 
Sbjct: 183 VLTTNCSNNYGPYHFPEKLIPLMITNALSGKPLPVYGDGQNVRDWLYVGDHCAAIREVLG 242

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY-SHTELIRFIEDRPGHDRRYAID 297
           +GR+GE YN+GG NE+ N+++V+ +  LLD L PK+  S+ + I F++DRPGHDRRYAID
Sbjct: 243 RGRLGETYNVGGWNEKTNLEVVYTLCDLLDELKPKATGSYRDQIAFVKDRPGHDRRYAID 302

Query: 298 SSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           + K++ E+GW P E  E+GL KTV WYLDN  W
Sbjct: 303 ARKLERELGWKPAETFETGLRKTVQWYLDNQVW 335


>gi|312960465|ref|ZP_07774974.1| dTDP-glucose 4,6-dehydratase [Pseudomonas fluorescens WH6]
 gi|311285350|gb|EFQ63922.1| dTDP-glucose 4,6-dehydratase [Pseudomonas fluorescens WH6]
          Length = 355

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 191/347 (55%), Positives = 243/347 (70%), Gaps = 8/347 (2%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           +++VTGGAGFIGSA+ R+L+N+    V  +D LTYAGN +SL  +  S+ + F + DI D
Sbjct: 4   KILVTGGAGFIGSAVVRHLINE-NHSVANLDLLTYAGNTDSLASVENSSRYQFFKTDIGD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
              +      F+PDA+++ AAESHVDRSI G  +FI TNI+GT+ LLE  R +WS L+ D
Sbjct: 63  GPALDQIFMTFRPDAVMHLAAESHVDRSIDGPADFIRTNIVGTYTLLEAARRYWSALASD 122

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            K++FRF  +STDEVYG LD    LF+E  PY PSSPYSA+KASSD+LV AW  TYG+PV
Sbjct: 123 AKNRFRFHHVSTDEVYGDLDGPDSLFTETTPYAPSSPYSASKASSDHLVRAWQRTYGLPV 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIP  I   I G  + +YGDG  VRDWL+VEDH RAL  VL +
Sbjct: 183 LVTNCSNNYGPYHFPEKLIPHVILNAIHGRPLPVYGDGLQVRDWLFVEDHARALCEVLCR 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTE----LIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NE+ NI++V  +  LL+ L P   +  E    LI F++DRPGHD RYA
Sbjct: 243 GAVGETYNIGGHNEKTNIEVVETLCALLEELAPDKPAGVERYRDLITFVKDRPGHDLRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDN-NWWWRPLYKELKPD 341
           ID+ KI  E+GW P E  ESG+ KTV WYL N  WW R L  + +P+
Sbjct: 303 IDAGKIARELGWKPHETFESGIRKTVQWYLQNKTWWQRVLNGQYRPE 349


>gi|51243897|ref|YP_063781.1| dTDP-D-glucose-4,6-dehydratase [Desulfotalea psychrophila LSv54]
 gi|50874934|emb|CAG34774.1| probable dTDP-D-glucose-4,6-dehydratase [Desulfotalea psychrophila
           LSv54]
          Length = 369

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 180/335 (53%), Positives = 246/335 (73%), Gaps = 4/335 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++ +    V+ +DKLTYAGNL SL+ ++ +  + F QVDIC
Sbjct: 18  MKILVTGGAGFIGSAVIRHILENTDDSVVNLDKLTYAGNLESLEGVAGNEHYLFEQVDIC 77

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DRE +       QPDA+++ AAESHVDRSI G   F+ TNI+GT  +L+  + +WS L +
Sbjct: 78  DREELVRVFAIHQPDAVMHLAAESHVDRSIDGPATFVETNIVGTSTILQVAQKYWSALPE 137

Query: 121 DKKDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           ++++ FRF  +STDEVYG L   +  F+E+  Y PSSPYSA+KA+SD+LV AW  TYG P
Sbjct: 138 ERRECFRFHHVSTDEVYGDLADPEEFFTEETSYAPSSPYSASKAASDHLVRAWQRTYGFP 197

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYGPY FPEKLIPL I   +EG  + +YG+GQ +RDWL+VEDH RAL LVL+
Sbjct: 198 TIITNCSNNYGPYQFPEKLIPLMILNALEGKALPIYGNGQQIRDWLHVEDHARALLLVLR 257

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIP--KSYSHTELIRFIEDRPGHDRRYAI 296
           +G+IGE YNIGG+NE+ N+++V  +  +L  ++P  +  S+ +LI  + DRPGHD RYAI
Sbjct: 258 QGKIGETYNIGGHNEKSNLEVVHTLCDVLQEMVPGEEGSSYRDLISHVADRPGHDLRYAI 317

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           D+ KI+ E+GW PQE  ESG+ KTV WYLDN  WW
Sbjct: 318 DAGKIERELGWRPQETFESGIRKTVQWYLDNKGWW 352


>gi|261400016|ref|ZP_05986141.1| dTDP-glucose 4,6-dehydratase [Neisseria lactamica ATCC 23970]
 gi|269210234|gb|EEZ76689.1| dTDP-glucose 4,6-dehydratase [Neisseria lactamica ATCC 23970]
          Length = 346

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 182/331 (54%), Positives = 241/331 (72%), Gaps = 6/331 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL E++ +  ++F QV+ICDR
Sbjct: 9   ILVTGGAGFIGSAVVRHIIQNTQDSVVNVDKLTYAGNLESLTEVADNPRYAFEQVNICDR 68

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             +     +++PDA+++ AAESHVDRSI  A EFI TNI+GTF LLE  R +   +  +K
Sbjct: 69  AELDRVFAQYRPDAVMHLAAESHVDRSIDSAGEFIQTNIVGTFNLLEAARAYRRQMPSEK 128

Query: 123 KDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           ++ FRF  ISTDEVYG L     LF+E  PY PSSPY+A+KASSD+LV AW  TYG+P +
Sbjct: 129 REAFRFHHISTDEVYGDLGGTNDLFTETAPYAPSSPYAASKASSDHLVRAWQRTYGLPAI 188

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           +SNCSNNYGP  FPEKLIPL I   + G  + +YGDG  +RDWL+VEDH RALY ++ KG
Sbjct: 189 VSNCSNNYGPRQFPEKLIPLTILNALSGKPLPVYGDGMQIRDWLFVEDHARALYQLVSKG 248

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYAI 296
             GE YNIGG+NE+ NI++V  I  LL+ L P+  +    + +LI F++DRPGHD RYA+
Sbjct: 249 VAGETYNIGGHNEKANIEVVKTICALLEELAPEKPAGVARYEDLITFVQDRPGHDVRYAV 308

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDN 327
           D++KI  E+GW PQE  ESG+ KTV WYLDN
Sbjct: 309 DAAKIGRELGWKPQETFESGIRKTVQWYLDN 339


>gi|238798900|ref|ZP_04642366.1| dTDP-glucose 4,6-dehydratase [Yersinia mollaretii ATCC 43969]
 gi|238717254|gb|EEQ09104.1| dTDP-glucose 4,6-dehydratase [Yersinia mollaretii ATCC 43969]
          Length = 339

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 182/323 (56%), Positives = 234/323 (72%), Gaps = 6/323 (1%)

Query: 16  LCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPD 75
           + R++++     V+V+DKLTYAGNL SL  ++++  ++F QVDICDR  +     ++QPD
Sbjct: 1   MVRHIIDGTSDSVVVVDKLTYAGNLESLAVVAKNERYAFEQVDICDRAALDRVFAQYQPD 60

Query: 76  AIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDE 135
            +++ AAESHVDRSI G   FI TNI+GT+++LE  R +W  LS + K  FRF  ISTDE
Sbjct: 61  VVMHLAAESHVDRSIDGPAAFIETNIVGTYLMLEAARHYWQQLSAEAKLAFRFHHISTDE 120

Query: 136 VYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHF 193
           VYG L   + LF+E  PY PSSPYSA+KASSD+LV AW  TYG P L++NCSNNYGPYHF
Sbjct: 121 VYGDLHGTEDLFTETTPYAPSSPYSASKASSDHLVRAWLRTYGFPTLVTNCSNNYGPYHF 180

Query: 194 PEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKGRIGERYNIGGNNE 253
           PEKLIPL I   + G  + +YG+G  VRDWLYVEDH RALY V+ +G +GE YNIGG+NE
Sbjct: 181 PEKLIPLVILNALAGKPLPVYGNGAQVRDWLYVEDHARALYQVVTEGVVGETYNIGGHNE 240

Query: 254 RKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYAIDSSKIKSEIGWFP 309
           RKNI++V  I  LLD L+P   +    + +LI F++DRPGHD RYAID+ KI+ E+GW P
Sbjct: 241 RKNIEVVETICTLLDELVPAKPAGIAQYRDLITFVKDRPGHDMRYAIDAGKIERELGWRP 300

Query: 310 QENMESGLNKTVCWYLDNNWWWR 332
           QE  ESG+ KTV WYL+N  WWR
Sbjct: 301 QETFESGIRKTVLWYLNNESWWR 323


>gi|46487618|gb|AAS99159.1| RmlB [Escherichia coli]
          Length = 362

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 198/346 (57%), Positives = 247/346 (71%), Gaps = 14/346 (4%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL EI  +  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVINVDKLTYAGNLESLTEIENNERYKFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   I +     QPDAI++ AAESHVDRSI G  +FI TNI+GT+ILLEE R +W  LS+
Sbjct: 61  DSVAIANIFAHHQPDAIMHLAAESHVDRSITGPADFIETNIVGTYILLEEARKYWLALSE 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG----------LFSEDMPYNPSSPYSATKASSDYLVLA 170
           D+K  FRF  ISTDEVYG L             LF+E   Y+PSSPYSA+KASSD+LV A
Sbjct: 121 DRKGAFRFHHISTDEVYGDLPHPDEVSSDTILPLFTEQTSYSPSSPYSASKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   I G  + +YG+G+ +RDWLYVEDH 
Sbjct: 181 WRRTYGLPTIVTNCSNNYGPYHFPEKLIPLIILNAIAGKLLPVYGNGEQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTE----LIRFIED 286
           RALY V+ KG  GE YNIGG+NERKNID+V  I  +LD LI       E    LIR++ D
Sbjct: 241 RALYEVVTKGVPGETYNIGGHNERKNIDVVKTICRILDELIADKPDGIENFEQLIRYVSD 300

Query: 287 RPGHDRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           RPGHD RYAID+SKIK ++GW PQE  E+G+ KT+ WYL+N  WW+
Sbjct: 301 RPGHDLRYAIDASKIKQDLGWVPQETFETGITKTIHWYLNNKEWWQ 346


>gi|149909222|ref|ZP_01897879.1| dTDP-glucose 4,6-dehydratase [Moritella sp. PE36]
 gi|149807746|gb|EDM67692.1| dTDP-glucose 4,6-dehydratase [Moritella sp. PE36]
          Length = 363

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 187/344 (54%), Positives = 245/344 (71%), Gaps = 12/344 (3%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++++   QV+ +D LTYAGNL+S+     S+ + F  VDIC
Sbjct: 1   MKILVTGGAGFIGSAVIRHILSETDYQVVNLDSLTYAGNLDSIPATLLSSQYVFECVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           ++E +     + QPD +++ AAESHVDRSI   + F+ TNIIGT+ LLE  R++W  L+ 
Sbjct: 61  NKEQVDRVFLQHQPDIVMHLAAESHVDRSIESPNCFVETNIIGTYNLLESARVYWLSLAD 120

Query: 121 DKKDQFRFLQISTDEVYGSL--------DKGLFSEDMPYNPSSPYSATKASSDYLVLAWG 172
           +KK  FRF  ISTDEV+G L          GLF E   Y+PSSPYSATKAS+D+LV AW 
Sbjct: 121 EKKADFRFHHISTDEVFGDLACQGSKESQDGLFVETTAYDPSSPYSATKASADHLVRAWF 180

Query: 173 HTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRA 232
            TYG+P L++NCSNNYGPYHFPEKLIP  I   + G  + +YGDG  VRDWLYV+DH RA
Sbjct: 181 RTYGLPTLITNCSNNYGPYHFPEKLIPHMILNALNGQALPVYGDGLQVRDWLYVDDHARA 240

Query: 233 LYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTE----LIRFIEDRP 288
           L LV  KG+IGERYNIGG+NE++NID+V  +  +L+ L+P      E    LI+F+ DRP
Sbjct: 241 LVLVATKGQIGERYNIGGHNEKRNIDVVNSLCSVLEDLVPDKPDGVEHYRDLIQFVNDRP 300

Query: 289 GHDRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           GHD RYAID+SKI+ E+GW P+E   +G+ KTV WYLDN  WW+
Sbjct: 301 GHDLRYAIDASKIQRELGWQPEETFATGIRKTVQWYLDNTAWWQ 344


>gi|254467877|ref|ZP_05081283.1| dTDP-glucose 4,6-dehydratase [beta proteobacterium KB13]
 gi|207086687|gb|EDZ63970.1| dTDP-glucose 4,6-dehydratase [beta proteobacterium KB13]
          Length = 352

 Score =  386 bits (991), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 188/334 (56%), Positives = 243/334 (72%), Gaps = 4/334 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M +IVTG AGFIGS      +N+   +V+ +DKLTYAGNL +LK +     + F+Q DI 
Sbjct: 1   MSIIVTGAAGFIGSNFVLNWLNNNNEKVVALDKLTYAGNLENLKSVETKPNYVFVQGDIG 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D + I    +E QP A+VNFAAESHVDRSI G D+F+ TNIIGT+ LL+E R +++ L++
Sbjct: 61  DSKLIAEIFQEHQPRAVVNFAAESHVDRSIHGPDDFMQTNIIGTYRLLDEARSFFNALNE 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           D K QFRFL +STDEVYG+L      F E   Y P+SPYSA+KA+SD+LV AW HTYG+P
Sbjct: 121 DAKKQFRFLHVSTDEVYGTLSSTDPAFKETNQYEPNSPYSASKAASDHLVRAWHHTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           VL +NCSNNYGP+HFPEKLIPL I + ++G  + +YGDGQ +RDWLYV DH R +  VL+
Sbjct: 181 VLTTNCSNNYGPFHFPEKLIPLCILKALQGQDLPIYGDGQQIRDWLYVVDHCRGITTVLE 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIP--KSYSHTELIRFIEDRPGHDRRYAI 296
           KG +GE YNIGG NE+ N+++V  +  LLD L P   + S+ E I FI+DRPGHDRRYAI
Sbjct: 241 KGVVGETYNIGGWNEKTNLEVVHALCDLLDELKPLDDARSYREQITFIKDRPGHDRRYAI 300

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           D++KI +E+GW P+E  E+G+ KTV WYLDN  W
Sbjct: 301 DATKISNELGWKPEETFETGIRKTVQWYLDNQDW 334


>gi|238755770|ref|ZP_04617102.1| dTDP-glucose 4,6-dehydratase [Yersinia ruckeri ATCC 29473]
 gi|238705997|gb|EEP98382.1| dTDP-glucose 4,6-dehydratase [Yersinia ruckeri ATCC 29473]
          Length = 338

 Score =  386 bits (991), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 181/321 (56%), Positives = 231/321 (71%), Gaps = 6/321 (1%)

Query: 18  RYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAI 77
           R+++N     V+V+DKLTYAGNL SL  ++ +  + F QVDICDR  +      +QPDA+
Sbjct: 2   RHIINATADSVVVVDKLTYAGNLESLATVADNERYDFEQVDICDRAELDRVFAHYQPDAV 61

Query: 78  VNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVY 137
           ++ AAESHVDRSI G   FI TN++GT+ LLE  R +W  L+ ++K  FRF  ISTDEVY
Sbjct: 62  MHLAAESHVDRSIDGPAAFIETNVVGTYTLLEAARHYWQALAAEQKRAFRFHHISTDEVY 121

Query: 138 GSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPE 195
           G L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P L++NCSNNYGPYHFPE
Sbjct: 122 GDLHGTDDLFTETTPYAPSSPYSASKASSDHLVRAWQRTYGLPTLITNCSNNYGPYHFPE 181

Query: 196 KLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKGRIGERYNIGGNNERK 255
           KLIPL I   + G  + +YG G  VRDWLYVEDH RALY V+ +G +GE YNIGG+NERK
Sbjct: 182 KLIPLVILNALAGKPLPVYGTGAQVRDWLYVEDHARALYQVVTEGVVGETYNIGGHNERK 241

Query: 256 NIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYAIDSSKIKSEIGWFPQE 311
           NI++V  I  LLD L+P+  +    ++ELI +++DRPGHD RYAID+ KI+ E+GW PQE
Sbjct: 242 NIEVVETICTLLDELVPQKPAGLAHYSELITYVKDRPGHDMRYAIDAGKIERELGWHPQE 301

Query: 312 NMESGLNKTVCWYLDNNWWWR 332
             ESG+ KTV WYL +  WW+
Sbjct: 302 TFESGIRKTVNWYLSHTSWWQ 322


>gi|170726037|ref|YP_001760063.1| dTDP-glucose 4,6-dehydratase [Shewanella woodyi ATCC 51908]
 gi|169811384|gb|ACA85968.1| dTDP-glucose 4,6-dehydratase [Shewanella woodyi ATCC 51908]
          Length = 363

 Score =  386 bits (991), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 193/349 (55%), Positives = 244/349 (69%), Gaps = 11/349 (3%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIG+AL R+L+N+   +V+ +DKLTYAGNL SLK+I     + F+  DICD+
Sbjct: 5   ILVTGGAGFIGAALIRFLINETDNRVINLDKLTYAGNLLSLKDIEGDERYHFIHGDICDK 64

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             +   LK FQPD I+N AAESHVDRSI G   FI TNI+GTF LLE  R +   LS +K
Sbjct: 65  TLVCQTLKHFQPDFIMNLAAESHVDRSIEGPSAFIETNILGTFSLLEAARSYCLTLSDEK 124

Query: 123 KDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLL 181
           +  FRF  ISTDEVYG L D G F+E+ PY PSSPYSA+KA+SD+LV AW  TY +PV+L
Sbjct: 125 RHGFRFHHISTDEVYGELGDTGYFTEESPYLPSSPYSASKAASDHLVRAWSRTYNLPVVL 184

Query: 182 SNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKGR 241
           +NCSNNYG Y +PEKLIPL I   + G  + +YGDG+ +RDWLYV+DHVRALY V+ KG 
Sbjct: 185 TNCSNNYGAYQYPEKLIPLVIMNALSGKPIPIYGDGKQIRDWLYVDDHVRALYCVVTKGE 244

Query: 242 IGERYNIGGNNERKNIDIVFEIGFLLDAL-IPKSYSHTE-------LIRFIEDRPGHDRR 293
           +GE YNIGG NE+ N+++V  I  LL+ L +  +YS  E       LI ++ DRPGHD R
Sbjct: 245 VGETYNIGGCNEKTNLEVVTAICELLEELALTNAYSSNEIDGGFSSLITYVTDRPGHDTR 304

Query: 294 YAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKELKPDN 342
           YAID+ KI  E+ W P E+  SGL KTV WYL+N  W + +    KP N
Sbjct: 305 YAIDAGKIARELNWQPMESFNSGLRKTVIWYLENQAWCQSILS--KPQN 351


>gi|56752002|ref|YP_172703.1| dTDP-glucose 4,6-dehydratase [Synechococcus elongatus PCC 6301]
 gi|81300909|ref|YP_401117.1| dTDP-glucose 4,6-dehydratase [Synechococcus elongatus PCC 7942]
 gi|56686961|dbj|BAD80183.1| dTDP-glucose 4,6-dehydratase [Synechococcus elongatus PCC 6301]
 gi|81169790|gb|ABB58130.1| dTDP-glucose 4,6-dehydratase [Synechococcus elongatus PCC 7942]
          Length = 357

 Score =  385 bits (990), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 186/328 (56%), Positives = 244/328 (74%), Gaps = 2/328 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVND-LKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDI 59
           M++++TGGAGFIGSAL R+L+   L  +++ +DKL+YA +L SL+    S+ + F QVD+
Sbjct: 1   MKILITGGAGFIGSALIRHLLTTRLDARIINLDKLSYASDLTSLQPFEDSDRYVFEQVDL 60

Query: 60  CDRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLS 119
            D   +    + +QP A+++ AAESHVDRSI     FI +NI+GTF LLE  R +W  LS
Sbjct: 61  LDEAALTRIFQTYQPTAVMHLAAESHVDRSIDSPRPFIESNILGTFNLLEAARRYWQELS 120

Query: 120 QDKKDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           + ++  FRF  ISTDEVYGSL + GLF+E   Y+P SPYSA+KASSD+LV AW HTYG+P
Sbjct: 121 ESEQQTFRFHHISTDEVYGSLGETGLFTEATRYDPRSPYSASKASSDHLVRAWHHTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           VL++NCSNNYGP+ FPEKLIP+ I   I G+ + +YG+G N+RDWLYVEDH RAL  VL 
Sbjct: 181 VLVTNCSNNYGPWQFPEKLIPVIILNAIAGNPLPIYGNGGNIRDWLYVEDHTRALEQVLL 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDS 298
           KG+IGE YNIGG NER N+ +V  I  LLD L P+S S+ + + F+ DRPGHDRRYAID+
Sbjct: 241 KGQIGETYNIGGFNERTNLQVVETICDLLDELKPRSQSYRQQMEFVRDRPGHDRRYAIDA 300

Query: 299 SKIKSEIGWFPQENMESGLNKTVCWYLD 326
           S+I+ E+GW PQE+ E+GL KTVCWYL+
Sbjct: 301 SRIERELGWQPQESFETGLRKTVCWYLN 328


>gi|300692303|ref|YP_003753298.1| dTDP-glucose 4,6 dehydratase, NAD(P)-binding [Ralstonia
           solanacearum PSI07]
 gi|299079363|emb|CBJ52035.1| dTDP-glucose 4,6 dehydratase, NAD(P)-binding [Ralstonia
           solanacearum PSI07]
          Length = 354

 Score =  385 bits (990), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 188/332 (56%), Positives = 235/332 (70%), Gaps = 4/332 (1%)

Query: 3   LIVTGGAGFIGSALC-RYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++VTGGAGFIG      +L N     ++ +DKLTYAGN  +L  + +     F Q DICD
Sbjct: 4   ILVTGGAGFIGGNFVLNWLANPGTDSIVNVDKLTYAGNRKTLAAVERDPRHVFSQTDICD 63

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  + S   +++P A+V+FAAESHVDRSI G  EFI TNI+GTF LLE  R +W  L  D
Sbjct: 64  RAALDSLFAQYKPRAVVHFAAESHVDRSIHGPAEFIQTNIVGTFTLLEAVRAYWGGLDAD 123

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            K  FRFL +STDEV+GSL      FSE  PY P+SPYSA+KA+SD+LV A+ HTYG+PV
Sbjct: 124 AKAAFRFLHVSTDEVFGSLSSTDPQFSETTPYAPNSPYSASKAASDHLVRAYHHTYGLPV 183

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L +NCSNNYGPYHFPEKLIPL IT  + G  + +YGDGQNVRDWLYV DH  A+  VL +
Sbjct: 184 LTTNCSNNYGPYHFPEKLIPLMITNALSGKPLPVYGDGQNVRDWLYVGDHCAAIREVLAR 243

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY-SHTELIRFIEDRPGHDRRYAIDS 298
           GR+GE YN+GG NE+ N+D+V  +  LLD L PK+  S+ + I F++DRPGHDRRYAID+
Sbjct: 244 GRLGETYNVGGWNEKTNLDVVHTLCDLLDELKPKATGSYRDQIAFVKDRPGHDRRYAIDA 303

Query: 299 SKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
            K++ E+GW P E  E+GL KTV WYLDN  W
Sbjct: 304 RKLERELGWKPAETFETGLRKTVQWYLDNQVW 335


>gi|269965939|ref|ZP_06180032.1| dTDP-D-glucose 4,6-dehydratase [Vibrio alginolyticus 40B]
 gi|269829492|gb|EEZ83733.1| dTDP-D-glucose 4,6-dehydratase [Vibrio alginolyticus 40B]
          Length = 358

 Score =  385 bits (989), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 190/337 (56%), Positives = 253/337 (75%), Gaps = 6/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++  S  + F +VDIC
Sbjct: 1   MKILVTGGAGFIGSAVIRHIINNTEDSVVNVDKLTYAGNLESLSDVMDSERYVFEKVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DRE + +   + +PDA+++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L Q
Sbjct: 61  DRESLETVFSKHKPDAVMHLAAESHVDRSIDGPAAFIETNIVGTYALLEAARNYWNTLDQ 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           + K+QFRF  ISTDEVYG L+    LF+E  PY+PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 ESKEQFRFHHISTDEVYGDLEGTDDLFTETTPYSPSSPYSASKASSDHLVRAWLRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYGPYHFPEKLIPL I   +EG  + +YGDG  +RDWLYVEDH RALY V++
Sbjct: 181 TIITNCSNNYGPYHFPEKLIPLMILNALEGKSLPVYGDGMQIRDWLYVEDHARALYKVVR 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRY 294
           +G +GE YNIGG+NE+ NI++V  I  LL+ L+P        + +LI ++ DRPGHD RY
Sbjct: 241 EGLVGETYNIGGHNEKANIEVVKTICTLLEELVPNKPNGVKEYADLITYVSDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           AID++KI+ E+GW P+E  +SG+ KTV WYL+N  WW
Sbjct: 301 AIDATKIERELGWKPEETFDSGIRKTVEWYLENKIWW 337


>gi|281354881|ref|ZP_06241375.1| dTDP-glucose 4,6-dehydratase [Victivallis vadensis ATCC BAA-548]
 gi|281317761|gb|EFB01781.1| dTDP-glucose 4,6-dehydratase [Victivallis vadensis ATCC BAA-548]
          Length = 358

 Score =  385 bits (988), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 187/333 (56%), Positives = 236/333 (70%), Gaps = 4/333 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIGSAL RYL+ +   +V V+DKLTYAGNL SL E+S S+ F F + DICDR
Sbjct: 6   ILVTGGAGFIGSALVRYLIRETAERVCVVDKLTYAGNLESLAEVSGSDRFRFERADICDR 65

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             +     EF+PDA+++ AAESHVDRSI    +FI TNI+GT+ LLE  R +WS L    
Sbjct: 66  AELDRIFSEFRPDAVMHLAAESHVDRSIDAPGDFIRTNIVGTYTLLEAARNYWSGLPAGA 125

Query: 123 KDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           +++FRF  ISTDEV+G L    G F ED PY PSSPYSA+KASSD+LV AW  T+G+P L
Sbjct: 126 RERFRFHHISTDEVFGDLKDSDGFFREDTPYMPSSPYSASKASSDHLVRAWFRTFGMPTL 185

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           ++NCSNNYGP  FPEKLIPL I   ++   + +YGDG  VRDWLYVEDH RAL+L + +G
Sbjct: 186 VTNCSNNYGPRQFPEKLIPLMILSALDDKPLPVYGDGAQVRDWLYVEDHARALHLAVTRG 245

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPK--SYSHTELIRFIEDRPGHDRRYAIDS 298
             GE YNIGG+N + N+ +V  +  LLD L P+    S  E + F+ DRPGHD RYAID+
Sbjct: 246 VPGETYNIGGHNTKSNLQVVHTLCGLLDELSPRRDGRSRREQVVFVADRPGHDLRYAIDA 305

Query: 299 SKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           +KI+ E+GW P+E+ ESGL KTV WYL     W
Sbjct: 306 AKIQRELGWTPRESFESGLRKTVEWYLAERAGW 338


>gi|85060359|ref|YP_456061.1| dTDP-D-glucose-4,6-dehydratase [Sodalis glossinidius str.
           'morsitans']
 gi|84780879|dbj|BAE75656.1| dTDP-D-glucose-4,6-dehydratase [Sodalis glossinidius str.
           'morsitans']
          Length = 357

 Score =  385 bits (988), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 190/336 (56%), Positives = 234/336 (69%), Gaps = 6/336 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           L++TGGAGFIGSAL RY++     +VLV+DKLTYAGNL+SL  ++    + F + DI D 
Sbjct: 4   LLITGGAGFIGSALVRYILGATDYRVLVVDKLTYAGNLDSLAPVAGHPHYRFARADIGDG 63

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             +   L EFQP AI++ AAESHVDRSI G   FI TNI GT ILLE  R +W  L    
Sbjct: 64  PAMARLLAEFQPYAIMHLAAESHVDRSIDGPAAFIDTNITGTSILLEAAREYWQALPPAA 123

Query: 123 KDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           +  FRF  +STDEVYG L  D   F+E  PY PSSPYSA+KA+SD+L  AW  TYG+PVL
Sbjct: 124 RAAFRFHHVSTDEVYGDLPDDGSRFNESSPYAPSSPYSASKAASDHLARAWMRTYGLPVL 183

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           +++CSNNYGPYHFPEKLIPL I   + G  + +YGDG  +RDWLYVEDH RALY V+ +G
Sbjct: 184 VTHCSNNYGPYHFPEKLIPLMIINALAGKPLPVYGDGGQIRDWLYVEDHARALYQVVTRG 243

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLD-ALIPKSYSHT---ELIRFIEDRPGHDRRYAI 296
           R GE Y IGG+NER+NI++V  +  LL+ A  P     T   +LI  +EDRPGHDRRYAI
Sbjct: 244 RPGETYTIGGHNERRNIEVVEALCALLEQAGAPHPAGVTAFRQLITLVEDRPGHDRRYAI 303

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           D+ KI  E+GW PQE  +SGL KTV WYL +  WW+
Sbjct: 304 DAGKIARELGWRPQETFDSGLAKTVQWYLTHREWWQ 339


>gi|91976050|ref|YP_568709.1| dTDP-glucose 4,6-dehydratase [Rhodopseudomonas palustris BisB5]
 gi|91682506|gb|ABE38808.1| dTDP-glucose 4,6-dehydratase [Rhodopseudomonas palustris BisB5]
          Length = 353

 Score =  384 bits (987), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 185/334 (55%), Positives = 237/334 (70%), Gaps = 3/334 (0%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           + ++TGGAGFIGSA+ R L+     +VLV+DKLTYAGNL SL  +S S  FSF +VDI D
Sbjct: 4   KFMITGGAGFIGSAVVRRLIETSDHEVLVVDKLTYAGNLESLAPVSASPKFSFERVDITD 63

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
            E +R    EF PD +++ AAESHVDRSI G  EFI TN++GTF+LL+     W  L   
Sbjct: 64  VEAMRRVFAEFSPDIVMHLAAESHVDRSIDGPGEFIQTNLVGTFVLLQAALNHWRTLPAG 123

Query: 122 KKDQFRFLQISTDEVYGSLD-KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           +K  FRF  +STDEV+GSL   G F+E+  Y P+SPYSA+KA SD+LV AW HTYG+P++
Sbjct: 124 RKPGFRFHHVSTDEVFGSLGPSGSFNEETAYRPNSPYSASKAGSDHLVRAWHHTYGLPMV 183

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           ++NCSNNYGPY FPEKLI L I   +EG  + +YG G+NVRDWLYVEDH  AL LV + G
Sbjct: 184 MTNCSNNYGPYQFPEKLIALMIINALEGRPLPVYGTGENVRDWLYVEDHAEALLLVAETG 243

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY--SHTELIRFIEDRPGHDRRYAIDS 298
            +GE YNIGG++ER NI +V  I  ++D L P +      +LI F+ DRPGHD RYAID+
Sbjct: 244 GVGESYNIGGDSERTNISVVRSICRIVDELAPDAAIGPRDKLIEFVVDRPGHDLRYAIDA 303

Query: 299 SKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           +KI+ E+GW P+ + E+GL  TV WYLDN  WW+
Sbjct: 304 TKIERELGWKPRHSFETGLRHTVQWYLDNMGWWK 337


>gi|257455592|ref|ZP_05620822.1| dTDP-glucose 4,6-dehydratase [Enhydrobacter aerosaccus SK60]
 gi|257447058|gb|EEV22071.1| dTDP-glucose 4,6-dehydratase [Enhydrobacter aerosaccus SK60]
          Length = 355

 Score =  384 bits (987), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 192/334 (57%), Positives = 252/334 (75%), Gaps = 4/334 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIGSA+ RYL+N+   +VL +DKLTYAGNL SL+ +S +  + FL  DICD+
Sbjct: 6   ILVTGGAGFIGSAVVRYLINNTDNRVLNVDKLTYAGNLESLETVSNNPRYQFLHADICDK 65

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             +  A ++FQP+ +++ AAESHVDRSI G  +FI TNIIGT+ LLE  R +W   ++DK
Sbjct: 66  SAMTKAFQDFQPNIVMHLAAESHVDRSIDGPMDFIQTNIIGTYNLLEVARNYWQNFTEDK 125

Query: 123 KDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           K  F+F  ISTDEVYG L+  + LF+E   Y+PSSPYSA+KASSD+LV AW  TYG+P++
Sbjct: 126 KSSFKFHHISTDEVYGDLEGTEDLFTEATSYSPSSPYSASKASSDHLVRAWHRTYGLPIV 185

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           ++NCSNNYGPYHFPEKLIPL I   ++G  + +YGDG+ +RDWLYVEDH  ALYLV    
Sbjct: 186 ITNCSNNYGPYHFPEKLIPLVILNALDGKPLPVYGDGKQIRDWLYVEDHASALYLVATTA 245

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS--YSHTELIRFIEDRPGHDRRYAIDS 298
           ++GE YNIGG+NE++NID+V  I  +LD + P++   S+T+ I F++DRPGHD RYAID+
Sbjct: 246 KVGETYNIGGHNEKQNIDVVKTICTILDNIKPRTDGQSYTQQITFVKDRPGHDLRYAIDA 305

Query: 299 SKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           SKI  E+GW PQE  ESG+ KTV WYL+N  W R
Sbjct: 306 SKINKELGWQPQETFESGIEKTVEWYLNNLEWCR 339


>gi|83746223|ref|ZP_00943277.1| dTDP-glucose 4,6-dehydratase [Ralstonia solanacearum UW551]
 gi|207728133|ref|YP_002256527.1| dtdp-glucose 4,6-dehydratase protein [Ralstonia solanacearum MolK2]
 gi|207744132|ref|YP_002260524.1| dtdp-glucose 4,6-dehydratase protein [Ralstonia solanacearum
           IPO1609]
 gi|83727189|gb|EAP74313.1| dTDP-glucose 4,6-dehydratase [Ralstonia solanacearum UW551]
 gi|206591378|emb|CAQ56990.1| dtdp-glucose 4,6-dehydratase protein [Ralstonia solanacearum MolK2]
 gi|206595536|emb|CAQ62463.1| dtdp-glucose 4,6-dehydratase protein [Ralstonia solanacearum
           IPO1609]
          Length = 354

 Score =  384 bits (987), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 188/333 (56%), Positives = 234/333 (70%), Gaps = 4/333 (1%)

Query: 2   RLIVTGGAGFIGSALC-RYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
            ++VTGGAGFIG      +L N     V+ +DKLTYAGN  +L  +       F Q DIC
Sbjct: 3   HILVTGGAGFIGGNFVLNWLANPGTDSVVNVDKLTYAGNRKTLATVESDPRHVFSQTDIC 62

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  + S   +++P A+V+FAAESHVDRSI G  EFI TNI+GTF LLE  R +W  L  
Sbjct: 63  DRAALDSLFAQYKPRAVVHFAAESHVDRSIHGPAEFIQTNIVGTFTLLEAARAYWGGLDA 122

Query: 121 DKKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           D K  FRFL +STDEV+GSL      FSE  PY P+SPYSA+KA+SD+LV A+ HTYG+P
Sbjct: 123 DAKAAFRFLHVSTDEVFGSLSATDPQFSETTPYAPNSPYSASKAASDHLVRAYHHTYGLP 182

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           VL +NCSNNYGPYHFPEKLIPL IT  + G  + +YGDGQNVRDWLYV DH  A+  VL 
Sbjct: 183 VLTTNCSNNYGPYHFPEKLIPLMITNALSGKPLPVYGDGQNVRDWLYVGDHCAAIREVLA 242

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY-SHTELIRFIEDRPGHDRRYAID 297
           +GR+GE YN+GG NE+ N+++V  +  LLD L PK+  S+ + I F++DRPGHDRRYAID
Sbjct: 243 RGRLGETYNVGGWNEKTNLEVVHTLCDLLDELKPKATGSYRDQIAFVKDRPGHDRRYAID 302

Query: 298 SSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           + K++ E+GW P E  E+GL KTV WYLDN  W
Sbjct: 303 ARKLERELGWKPAETFETGLRKTVQWYLDNQVW 335


>gi|313667390|ref|YP_004047674.1| dTDP-glucose 4,6-dehydratase [Neisseria lactamica ST-640]
 gi|313004852|emb|CBN86278.1| dTDP-glucose 4,6-dehydratase [Neisseria lactamica 020-06]
          Length = 360

 Score =  384 bits (987), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 183/331 (55%), Positives = 239/331 (72%), Gaps = 6/331 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL E++ S  ++F QVDICDR
Sbjct: 9   ILVTGGAGFIGSAVVRHIIRNTRDAVVNVDKLTYAGNLESLTEVADSPRYAFEQVDICDR 68

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             +     +++PDA+++ AAESHVDRSI  A EFI TNI+GTF LLE  R +   +  ++
Sbjct: 69  AELDRVFAQYRPDAVMHLAAESHVDRSIDSAGEFIQTNIVGTFNLLEAARAYRRQMPSEQ 128

Query: 123 KDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           ++ FRF  ISTDEVYG L     LF+E  PY PSSPY+A+KASSD+LV AW  TYG+P +
Sbjct: 129 REAFRFHHISTDEVYGDLGGTDDLFTETAPYAPSSPYAASKASSDHLVRAWQRTYGLPAI 188

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           +SNCSNNYGP  FPEKLIPL I   + G  + +YGDG  +RDWL+VEDH  ALY ++ KG
Sbjct: 189 VSNCSNNYGPRQFPEKLIPLTILNALSGKPLPVYGDGMQIRDWLFVEDHAHALYQLVSKG 248

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYAI 296
             GE YNIGG+NE+ NI++V  I  LL+ L P+  +    + +LI F+ DRPGHD RYAI
Sbjct: 249 VAGETYNIGGHNEKANIEVVKTICALLEELAPEKPAGVARYEDLITFVPDRPGHDVRYAI 308

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDN 327
           D++KI  E+GW PQE  ESG+ KTV WYLDN
Sbjct: 309 DAAKIGRELGWKPQETFESGIRKTVQWYLDN 339


>gi|238784750|ref|ZP_04628753.1| dTDP-glucose 4,6-dehydratase [Yersinia bercovieri ATCC 43970]
 gi|238714346|gb|EEQ06355.1| dTDP-glucose 4,6-dehydratase [Yersinia bercovieri ATCC 43970]
          Length = 339

 Score =  384 bits (987), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 182/323 (56%), Positives = 233/323 (72%), Gaps = 6/323 (1%)

Query: 16  LCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPD 75
           + R++++     V+V+DKLTYAGNL SL  +++S  ++F QVDICDR  +     ++QPD
Sbjct: 1   MVRHIIDGTSDSVVVVDKLTYAGNLESLAVVAKSERYAFEQVDICDRAELDRVFAQYQPD 60

Query: 76  AIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDE 135
            +++ AAESHVDRSI G   FI TN++GT+ LLE  R +W  LS + K  FRF  ISTDE
Sbjct: 61  VVMHLAAESHVDRSIDGPAAFIETNVVGTYTLLEAARHYWQQLSAEAKLAFRFHHISTDE 120

Query: 136 VYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHF 193
           VYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P L++NCSNNYGPYHF
Sbjct: 121 VYGDLHGTDDLFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPTLVTNCSNNYGPYHF 180

Query: 194 PEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKGRIGERYNIGGNNE 253
           PEKLIPL I   + G  + +YG+G  VRDWLYVEDH RALY V+ +G +GE YNIGG+NE
Sbjct: 181 PEKLIPLVILNALAGKPLPVYGNGAQVRDWLYVEDHARALYQVVTEGVVGETYNIGGHNE 240

Query: 254 RKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYAIDSSKIKSEIGWFP 309
           R+NI++V  I  LLD L+P   +    + +LI F++DRPGHD RYAID+ KI+ E+GW P
Sbjct: 241 RRNIEVVETICALLDELVPAKPAGIAHYRDLITFVKDRPGHDMRYAIDAGKIERELGWRP 300

Query: 310 QENMESGLNKTVCWYLDNNWWWR 332
           QE  ESG+ KTV WYL+N  WWR
Sbjct: 301 QETFESGIRKTVLWYLNNESWWR 323


>gi|209964145|ref|YP_002297060.1| dTDP-glucose 4,6-dehydratase [Rhodospirillum centenum SW]
 gi|209957611|gb|ACI98247.1| dTDP-glucose 4,6-dehydratase [Rhodospirillum centenum SW]
          Length = 363

 Score =  384 bits (987), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 184/336 (54%), Positives = 236/336 (70%), Gaps = 2/336 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+LIVTGGAGFIGS + R L+    + +  +DKLTYA +  +L E+S S  + F ++DIC
Sbjct: 1   MKLIVTGGAGFIGSCVIRTLIRTTDVSICNVDKLTYAASPEALAEVSGSPRYRFERLDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   + +  +  QPDA+++ AAESHVDRSI     FI TN++GT+ LL  +  +W  L +
Sbjct: 61  DGPGLAALFEREQPDAVMHLAAESHVDRSIDDPAAFIMTNLVGTYTLLAASTAYWRGLPE 120

Query: 121 DKKDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            ++  FR+  +STDEVYGSL D G F+E  PY P+SPYSA+KA SD+L  AW HTYG+PV
Sbjct: 121 ARRASFRYHHVSTDEVYGSLGDVGAFTETTPYAPNSPYSASKAGSDHLARAWFHTYGLPV 180

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L+SNCSNNYGP+ FPEKLIPL I   I G  + +YG G NVRDWL+VEDH RAL+ VL +
Sbjct: 181 LVSNCSNNYGPFQFPEKLIPLMILNGIAGRPLPVYGRGMNVRDWLHVEDHARALWQVLTR 240

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY-SHTELIRFIEDRPGHDRRYAIDS 298
           G+ GE YNIGGN ER+NID+V  I  LLD L+P    S   LI  + DRPGHD RYAID+
Sbjct: 241 GQPGESYNIGGNAERRNIDVVHAICDLLDELVPDPQGSRRRLITHVSDRPGHDLRYAIDA 300

Query: 299 SKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           S+I+ ++GW PQE  E+GL  TV WYL N  WWRP+
Sbjct: 301 SRIRRDLGWVPQETFETGLRATVEWYLANEAWWRPI 336


>gi|309780786|ref|ZP_07675527.1| dTDP-glucose 4,6-dehydratase [Ralstonia sp. 5_7_47FAA]
 gi|308920468|gb|EFP66124.1| dTDP-glucose 4,6-dehydratase [Ralstonia sp. 5_7_47FAA]
          Length = 354

 Score =  384 bits (987), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 186/332 (56%), Positives = 236/332 (71%), Gaps = 4/332 (1%)

Query: 3   LIVTGGAGFIGSALC-RYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           ++VTGGAGFIG      +L +     ++ +DKLTYAGN  +L  + Q +   F Q DICD
Sbjct: 4   ILVTGGAGFIGGNFVLNWLADPSADGIVNVDKLTYAGNRKTLAAVEQDSRHVFSQTDICD 63

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     +++P A+V+FAAESHVDRSI G  EFI TNI+GTF LLE  R +WS L  +
Sbjct: 64  RAALDRLFAQYRPRAVVHFAAESHVDRSIHGPGEFIQTNIVGTFTLLEAARAYWSGLDDE 123

Query: 122 KKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            K  FRFL +STDEV+GSL      FSE  PY P+SPYSA+KA+SD+LV A+ HTYG+PV
Sbjct: 124 AKAAFRFLHVSTDEVFGSLGPTDPQFSETTPYAPNSPYSASKAASDHLVRAYHHTYGLPV 183

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L +NCSNNYGPYHFPEKLIPL IT  + G  + +YGDGQNVRDWLYV DH  A+   L +
Sbjct: 184 LTTNCSNNYGPYHFPEKLIPLMITNALSGKPLPVYGDGQNVRDWLYVGDHCAAIREALAR 243

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY-SHTELIRFIEDRPGHDRRYAIDS 298
           GR+GE YN+GG NE+ N+D+V+ +  LLD L PK+  S+ + I F++DRPGHDRRYAID+
Sbjct: 244 GRLGETYNVGGWNEKTNLDVVYTLCDLLDELKPKAAGSYRDQITFVKDRPGHDRRYAIDA 303

Query: 299 SKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
            K++ E+GW P E  E+GL KTV WYLDN  W
Sbjct: 304 RKLERELGWKPAETFETGLRKTVQWYLDNQAW 335


>gi|296315139|ref|ZP_06865080.1| dTDP-glucose 4,6-dehydratase [Neisseria polysaccharea ATCC 43768]
 gi|296837944|gb|EFH21882.1| dTDP-glucose 4,6-dehydratase [Neisseria polysaccharea ATCC 43768]
          Length = 360

 Score =  384 bits (987), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 180/336 (53%), Positives = 244/336 (72%), Gaps = 6/336 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL +I+ +  ++F + DICDR
Sbjct: 9   ILVTGGAGFIGSAVVRHIIQNTQDSVVNLDKLTYAGNLESLTDIADNPRYAFERADICDR 68

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             +     +++PDA+++ AAESHVDRSI  A EFI TNI+GTF LLE  R +W  +  ++
Sbjct: 69  AELNRVFAQYRPDAVMHLAAESHVDRSIDSAGEFIQTNIVGTFNLLEAARAYWQQMPSEQ 128

Query: 123 KDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           ++ FRF  ISTDEVYG L     L +E  PY PS+PY+A+KASSD+LV AW  TYG+P +
Sbjct: 129 REAFRFHHISTDEVYGDLHGTDDLSAETAPYAPSNPYAASKASSDHLVRAWQRTYGLPAI 188

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           +SNCSNNYGP  FPEKLIPL I   + G  + +YGDG  +RDWL+VEDH RALY V+ +G
Sbjct: 189 VSNCSNNYGPRQFPEKLIPLTILNALGGKPLPVYGDGAQIRDWLFVEDHARALYQVVTEG 248

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYAI 296
            +GE YNIGG+NE+ NI++V  I  LL+ L+P+  +    + +LI F+ DRPGHD RYAI
Sbjct: 249 VVGETYNIGGHNEKVNIEVVKTICALLEELVPEKPAGVARYEDLITFVPDRPGHDVRYAI 308

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           D++KI+ ++GW P E  ESG+ KTV WYLDN  WW+
Sbjct: 309 DAAKIRRDLGWQPLETFESGIRKTVQWYLDNKTWWQ 344


>gi|296136997|ref|YP_003644239.1| dTDP-glucose 4,6-dehydratase [Thiomonas intermedia K12]
 gi|295797119|gb|ADG31909.1| dTDP-glucose 4,6-dehydratase [Thiomonas intermedia K12]
          Length = 354

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 186/332 (56%), Positives = 233/332 (70%), Gaps = 4/332 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           + +TG AGFIG+    + +      VLV+D LTYAGNL SL  ++    + F +VDICDR
Sbjct: 2   IFLTGAAGFIGANFVHHWLGQKDEPVLVLDALTYAGNLESLAPVASDPRYHFARVDICDR 61

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             + + L + +P A+++FAAESHVDRSI G  +FI TN+ GTF LLE TR +W+ L   +
Sbjct: 62  PAVAALLAQHRPRALLHFAAESHVDRSIHGPGDFIRTNVQGTFELLEATRAYWAALPAPE 121

Query: 123 KDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           K  FRFL +STDEVYGSL      F+E  PY P+SPYSA+KA+SD+LV AW HTYG+PVL
Sbjct: 122 KAAFRFLHVSTDEVYGSLSPTDPAFTETTPYAPNSPYSASKAASDHLVRAWHHTYGLPVL 181

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
            +NCSNNYGPY FPEKLIPL I   +    + +YGDGQNVRDWLYV+DH RA+  VL+ G
Sbjct: 182 TTNCSNNYGPYQFPEKLIPLMIHNALADKSLPVYGDGQNVRDWLYVQDHCRAIARVLEAG 241

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPK--SYSHTELIRFIEDRPGHDRRYAIDS 298
           R+GE YN+GG NE KN+D+V  +  LLD L PK    S+   I F+ DRPGHDRRYAID+
Sbjct: 242 RLGETYNVGGCNEVKNLDVVHTLCDLLDQLRPKMDGSSYRAQITFVADRPGHDRRYAIDA 301

Query: 299 SKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
            KI+ E+GW PQE   +GL KTV WYLDN  W
Sbjct: 302 RKIERELGWTPQETFATGLRKTVQWYLDNPDW 333


>gi|17545401|ref|NP_518803.1| dTDP-glucose 4,6-dehydratase [Ralstonia solanacearum GMI1000]
 gi|17427693|emb|CAD14212.1| probable dtdp-glucose 4,6-dehydratase protein [Ralstonia
           solanacearum GMI1000]
          Length = 354

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 189/333 (56%), Positives = 234/333 (70%), Gaps = 4/333 (1%)

Query: 2   RLIVTGGAGFIGSALC-RYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
            ++VTGGAGFIG      +L N     V+ +DKLTYAGN  +L  I       F Q DIC
Sbjct: 3   HILVTGGAGFIGGNFVLNWLANPGADGVVNVDKLTYAGNRKTLAAIEHDPRHIFSQTDIC 62

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  + S   + +P A+V+FAAESHVDRSI G  EFI TNI+GTF LLE  R +W  L  
Sbjct: 63  DRAALDSLFAQHKPRAVVHFAAESHVDRSIHGPAEFIQTNIVGTFTLLEAVRAYWGGLDA 122

Query: 121 DKKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           D K  FRFL +STDEV+GSL      FSE  PY P+SPYSA+KA+SD+LV A+ HTYG+P
Sbjct: 123 DAKAAFRFLHVSTDEVFGSLSATDPQFSETTPYAPNSPYSASKAASDHLVRAYHHTYGLP 182

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           VL +NCSNNYGPYHFPEKLIPL IT  + G  + +YGDGQNVRDWLYV DH  A+  VL 
Sbjct: 183 VLTTNCSNNYGPYHFPEKLIPLMITNALSGKPLPVYGDGQNVRDWLYVGDHCAAIREVLA 242

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY-SHTELIRFIEDRPGHDRRYAID 297
           +GR+GE YN+GG NE+ N+++V+ +  LLD L PK+  S+ + I F++DRPGHDRRYAID
Sbjct: 243 RGRLGETYNVGGWNEKTNLEVVYTLCDLLDELKPKATGSYRDQIAFVKDRPGHDRRYAID 302

Query: 298 SSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           + K++ E+GW P E  E+GL KTV WYLDN  W
Sbjct: 303 ARKLERELGWKPAETFETGLRKTVQWYLDNQVW 335


>gi|157368414|ref|YP_001476403.1| dTDP-glucose 4,6-dehydratase [Serratia proteamaculans 568]
 gi|157320178|gb|ABV39275.1| dTDP-glucose 4,6-dehydratase [Serratia proteamaculans 568]
          Length = 355

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 197/337 (58%), Positives = 242/337 (71%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R++VTGGAGFIGSA+ R+++   +  VLV+DKLTYAGNL SL  ++ +  +SF QVDICD
Sbjct: 3   RILVTGGAGFIGSAVVRHIIEATQDSVLVLDKLTYAGNLESLSVVADNPRYSFEQVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E+QPD I++ AAESHVDRSI G   FI TN++GT+ +LE  R +W  L   
Sbjct: 63  RAALDRVFAEYQPDVIMHLAAESHVDRSIDGPAAFIETNVVGTYTMLEAARHYWQPLDAA 122

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L     LF+E  PY+PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKQSFRFHHISTDEVYGDLHGTDDLFTETTPYSPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YGDG  VRDWLYVEDH RALY V+ +
Sbjct: 183 LVTNCSNNYGPYHFPEKLIPLVILNAVAGKPLPVYGDGAQVRDWLYVEDHARALYQVVTE 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTE----LIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NERKNI++V  I  LL+ L P      E    LI +++DRPGHD RYA
Sbjct: 243 GVVGETYNIGGHNERKNIEVVQTICDLLEELAPNKPQGVEKYRDLITYVKDRPGHDMRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+ KI  E+GW PQE  ESG+ KTV WYL+N  WWR
Sbjct: 303 IDAGKIDRELGWRPQETFESGIRKTVSWYLNNEIWWR 339


>gi|300704904|ref|YP_003746507.1| dtdp-glucose 4,6 dehydratase, NAD(P)-binding [Ralstonia
           solanacearum CFBP2957]
 gi|299072568|emb|CBJ43918.1| dTDP-glucose 4,6 dehydratase, NAD(P)-binding [Ralstonia
           solanacearum CFBP2957]
          Length = 354

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 187/333 (56%), Positives = 234/333 (70%), Gaps = 4/333 (1%)

Query: 2   RLIVTGGAGFIGSALC-RYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
            ++VTGGAGFIG      +L N     ++ +DKLTYAGN  +L  +       F Q DIC
Sbjct: 3   HILVTGGAGFIGGNFVLNWLANPGTDSIVNVDKLTYAGNRKTLATVESDPRHVFSQTDIC 62

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  + S   +++P A+V+FAAESHVDRSI G  EFI TNI+GTF LLE  R +W  L  
Sbjct: 63  DRAALDSLFAQYKPRAVVHFAAESHVDRSIHGPAEFIQTNIVGTFTLLEAARAYWGGLDA 122

Query: 121 DKKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           D K  FRFL +STDEV+GSL      FSE  PY P+SPYSA+KA+SD+LV A+ HTYG+P
Sbjct: 123 DAKAAFRFLHVSTDEVFGSLSATDPQFSETTPYAPNSPYSASKAASDHLVRAYHHTYGLP 182

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           VL +NCSNNYGPYHFPEKLIPL IT  + G  + +YGDGQNVRDWLYV DH  A+  VL 
Sbjct: 183 VLTTNCSNNYGPYHFPEKLIPLMITNALSGKPLPVYGDGQNVRDWLYVGDHCAAIREVLA 242

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY-SHTELIRFIEDRPGHDRRYAID 297
           +GR+GE YN+GG NE+ N+++V  +  LLD L PK+  S+ + I F++DRPGHDRRYAID
Sbjct: 243 RGRLGETYNVGGWNEKTNLEVVHTLCDLLDELKPKATGSYRDQIAFVKDRPGHDRRYAID 302

Query: 298 SSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           + K++ E+GW P E  E+GL KTV WYLDN  W
Sbjct: 303 ARKLERELGWKPAETFETGLRKTVQWYLDNQVW 335


>gi|301154916|emb|CBW14379.1| dTDP-glucose 4,6-dehydratase [Haemophilus parainfluenzae T3T1]
          Length = 337

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 183/333 (54%), Positives = 244/333 (73%), Gaps = 6/333 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R+++TGG GFIGSAL RY++N  +  V+ IDKLTYA N ++L+E+  +  ++F QVDICD
Sbjct: 4   RILITGGFGFIGSALIRYIINQTQDSVINIDKLTYAANQSALEEVENNPRYTFEQVDICD 63

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
            + I S  +++QPDA+++ AAESHVDRSI GA +FI TNI+GT+ LLE  + +W  L + 
Sbjct: 64  LKAIESVFEKYQPDAVMHLAAESHVDRSITGAADFIQTNIVGTYALLEVAKNYWHTLDEA 123

Query: 122 KKDQFRFLQISTDEVYG--SLDKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG  SL +  F+E  PY+PSSPYSA+KA+SD+LV AW  TYG+PV
Sbjct: 124 KKSAFRFHHISTDEVYGDLSLSEPAFTEQSPYHPSSPYSASKAASDHLVQAWHRTYGLPV 183

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++N SNNYG Y   EKLIPL I+  + G  + +YGDG  +RDWL+VEDHV+ALYLVL K
Sbjct: 184 IITNSSNNYGAYQHAEKLIPLMISNAVMGKPLPIYGDGLQIRDWLFVEDHVQALYLVLTK 243

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHT----ELIRFIEDRPGHDRRYA 295
           GR+GE YNIGGN E+ N++++  I  LL+ L P   +H     +LI F++DRPGHD RY+
Sbjct: 244 GRVGENYNIGGNCEKTNLEVIKTICQLLEELAPNKPNHIKHYGDLITFVKDRPGHDVRYS 303

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNN 328
           +D SKI +E+GW  Q   E GL +TV WYL+NN
Sbjct: 304 LDCSKIHAELGWQSQITFEQGLRQTVKWYLENN 336


>gi|238750660|ref|ZP_04612159.1| dTDP-glucose 4,6-dehydratase [Yersinia rohdei ATCC 43380]
 gi|238711050|gb|EEQ03269.1| dTDP-glucose 4,6-dehydratase [Yersinia rohdei ATCC 43380]
          Length = 339

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 181/323 (56%), Positives = 234/323 (72%), Gaps = 6/323 (1%)

Query: 16  LCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPD 75
           + R+++N     V+V+DKLTYAGNL SL  ++QS+ ++F QVDIC R  +     ++QPD
Sbjct: 1   MVRHIINSTSDSVVVVDKLTYAGNLESLAVVAQSDRYAFEQVDICSRAELDRVFAQYQPD 60

Query: 76  AIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDE 135
            +++ AAESHVDRSI G   FI TN++GT+ +LE  R +W  LS + K  FRF  ISTDE
Sbjct: 61  VVMHLAAESHVDRSIDGPAAFIETNVVGTYQMLEAARHYWQPLSAEAKLAFRFHHISTDE 120

Query: 136 VYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHF 193
           VYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P L++NCSNNYGPYHF
Sbjct: 121 VYGDLHGTDDLFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPTLVTNCSNNYGPYHF 180

Query: 194 PEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKGRIGERYNIGGNNE 253
           PEKLIPL I   + G  + +YG+G  VRDWL+VEDH RALY V+ +G +GE YNIGG+NE
Sbjct: 181 PEKLIPLVILNALAGKPLPVYGNGAQVRDWLFVEDHARALYQVVTEGVVGETYNIGGHNE 240

Query: 254 RKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYAIDSSKIKSEIGWFP 309
           RKNI++V  I  LLD L+P+  +    + +LI +++DRPGHD RYAID+ KI+ E+GW P
Sbjct: 241 RKNIEVVETICSLLDELVPEKPAGIAHYRDLITYVKDRPGHDMRYAIDAGKIERELGWRP 300

Query: 310 QENMESGLNKTVCWYLDNNWWWR 332
           QE  ESG+ KTV WYL+N  WWR
Sbjct: 301 QETFESGIRKTVLWYLNNESWWR 323


>gi|585828|sp|P37761|RFBB_NEIGO RecName: Full=dTDP-glucose 4,6-dehydratase
 gi|520896|emb|CAA83652.1| dTDP-D-glucose 4,6-dehydratase [Neisseria gonorrhoeae]
 gi|1333793|emb|CAA79718.1| dTDP-D-glucose 4,6-dehydratase [Neisseria gonorrhoeae]
          Length = 346

 Score =  383 bits (984), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 179/331 (54%), Positives = 242/331 (73%), Gaps = 6/331 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL +I+ +  ++F QVDICDR
Sbjct: 9   ILVTGGAGFIGSAVVRHIIQNTRDSVVNLDKLTYAGNLESLTDIADNPRYAFEQVDICDR 68

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             +     +++PDA+++ AAESHVDR+I  A EFI TNI+GTF LLE  R +W  +  +K
Sbjct: 69  AELDRVFAQYRPDAVMHLAAESHVDRAIGSAGEFIRTNIVGTFDLLEAARAYWQQMPSEK 128

Query: 123 KDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           ++ FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KA++D+LV AW  TY +P +
Sbjct: 129 REAFRFHHISTDEVYGDLHGTDDLFTETTPYAPSSPYSASKAAADHLVRAWQRTYRLPSI 188

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           +SNCSNNYGP  FPEKLIPL I   + G  + +YGDG  +RDWL+VEDH RALY V+ +G
Sbjct: 189 VSNCSNNYGPRQFPEKLIPLMILNALSGKPLPVYGDGAQIRDWLFVEDHARALYQVVTEG 248

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYAI 296
            +GE YNIGG+NE+ N+++V  I  LL+ L P+  +    + +LI F++DRPGHD RYA+
Sbjct: 249 VVGETYNIGGHNEKTNLEVVKTICALLEELAPEKPAGVARYEDLITFVQDRPGHDARYAV 308

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDN 327
           D++KI+ ++GW P E  ESGL KTV WYLDN
Sbjct: 309 DAAKIRRDLGWLPLETFESGLRKTVQWYLDN 339


>gi|270264237|ref|ZP_06192504.1| dTDP-glucose 4,6-dehydratase [Serratia odorifera 4Rx13]
 gi|270041886|gb|EFA14983.1| dTDP-glucose 4,6-dehydratase [Serratia odorifera 4Rx13]
          Length = 357

 Score =  383 bits (984), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 194/337 (57%), Positives = 243/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R++VTGGAGFIGSA+ R+++   +  V+V+DKLTYAGNL SL  I+ +  +SF QVDICD
Sbjct: 5   RILVTGGAGFIGSAVVRHIIEATQDSVMVVDKLTYAGNLESLSVIADNERYSFEQVDICD 64

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     ++QPD I++ AAESHVDRSI G   FI TN++GT+ +LE  R +W  L  +
Sbjct: 65  RTALDRVFAQYQPDVIMHLAAESHVDRSIDGPAAFIETNVVGTYTMLEAARHYWHPLDAE 124

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           +K  FRF  ISTDEVYG L     LF+E  PY+PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 125 RKQNFRFHHISTDEVYGDLHGTDDLFTETTPYSPSSPYSASKASSDHLVRAWLRTYGLPT 184

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKLIPL I   + G  + +YGDG  VRDWLYVEDH RALY V+ +
Sbjct: 185 IVTNCSNNYGPYHFPEKLIPLVILNAVAGKPLPVYGDGAQVRDWLYVEDHARALYQVVTE 244

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTE----LIRFIEDRPGHDRRYA 295
           G +GE YNIGG+NERKNI++V  I  LL+ L P      E    LI +++DRPGHD RYA
Sbjct: 245 GVVGETYNIGGHNERKNIEVVHTICDLLEELAPNKPQGIEKYRDLITYVKDRPGHDMRYA 304

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+ KI  E+GW PQE  ESG+ KTV WYL+N  WWR
Sbjct: 305 IDAGKIDRELGWRPQETFESGIRKTVSWYLNNETWWR 341


>gi|94311667|ref|YP_584877.1| dTDP-glucose 4,6-dehydratase [Cupriavidus metallidurans CH34]
 gi|93355519|gb|ABF09608.1| dTDP-glucose 4,6 dehydratase, NAD(P)-binding protein [Cupriavidus
           metallidurans CH34]
          Length = 354

 Score =  383 bits (984), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 190/333 (57%), Positives = 235/333 (70%), Gaps = 4/333 (1%)

Query: 2   RLIVTGGAGFIGSALC-RYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
            ++VTGGAGFIG+     +L       V+ +DKLTYAGN  +L  +   +   F Q DIC
Sbjct: 3   HILVTGGAGFIGANFVLNWLAQPGADSVVNVDKLTYAGNRKTLASLDGDSRHVFSQTDIC 62

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR+ +   L E +P AIV+FAAESHVDRSI G  EFI TNI+GTF LLE  R +W+ L  
Sbjct: 63  DRDALDRLLAEHKPRAIVHFAAESHVDRSIHGPAEFIQTNIVGTFTLLEAVRAYWNGLDA 122

Query: 121 DKKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           + K  FRFL +STDEV+GSL      FSE   Y P+SPYSA+KA+SD+LV A+ HTYG+P
Sbjct: 123 EAKAAFRFLHVSTDEVFGSLGPADPQFSETTAYAPNSPYSASKAASDHLVRAYHHTYGLP 182

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           VL +NCSNNYGPYHFPEKLIPL IT  + G  + +YGDGQNVRDWLYV DH  A+  VL 
Sbjct: 183 VLTTNCSNNYGPYHFPEKLIPLMITNALSGKPLPVYGDGQNVRDWLYVGDHCSAIREVLA 242

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY-SHTELIRFIEDRPGHDRRYAID 297
           +GR+GE YN+GG NE  N+D+V  I  LLD L PK+  S+++ I F++DRPGHDRRYAID
Sbjct: 243 RGRVGETYNVGGWNEMTNLDVVHTICSLLDQLKPKAAGSYSDQINFVKDRPGHDRRYAID 302

Query: 298 SSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           + K++ E+GW P E  ESGL KTV WYLDN  W
Sbjct: 303 ARKLERELGWKPAETFESGLRKTVQWYLDNQPW 335


>gi|257792902|gb|ACV67279.1| RmlB [Escherichia coli]
          Length = 361

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 193/340 (56%), Positives = 244/340 (71%), Gaps = 10/340 (2%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL ++S S  + F   DIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +     + QPDA+++ AAESHVDRSI G   FI TNI+GT++LLE  R +WS L  
Sbjct: 61  DVAAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAVRNYWSALDG 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           DKK+ FRF  ISTDEVYG L          +  LF+E   Y PSSPYS++KASSD+LV A
Sbjct: 121 DKKNSFRFHHISTDEVYGDLPHPDEVNNTEELPLFTETTAYAPSSPYSSSKASSDHLVRA 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKLIPL I   +EG  + +YG G  +RDWLYVEDH 
Sbjct: 181 WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKGLPIYGKGDQIRDWLYVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGH 290
           RALY V+ +G+ GE YNIGG+NE+KNID+V  I  LLD ++PK  S+ E I ++ DRPGH
Sbjct: 241 RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH 300

Query: 291 DRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           DRRYAID+ KI  E+GW PQE  ESG+ KTV WYL N  W
Sbjct: 301 DRRYAIDAEKIGRELGWKPQETFESGIRKTVEWYLSNTKW 340


>gi|117924705|ref|YP_865322.1| dTDP-glucose 4,6-dehydratase [Magnetococcus sp. MC-1]
 gi|117608461|gb|ABK43916.1| dTDP-glucose 4,6-dehydratase [Magnetococcus sp. MC-1]
          Length = 354

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 178/330 (53%), Positives = 232/330 (70%), Gaps = 1/330 (0%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           +++VTGGAGFIGS L R LV   +  V+++D LTY+GNL SL  ++    + F+Q DICD
Sbjct: 3   KVLVTGGAGFIGSELVRQLVTQAECSVVMVDLLTYSGNLASLAPVAARPNYRFVQADICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     + QPDA+V+ AAESHVDRSI G   F+ TN++GT +LLE  R +W   +  
Sbjct: 63  RGAMSQLFVQEQPDAVVHLAAESHVDRSIDGPLTFVQTNVMGTAVLLESARAYWVQTAPA 122

Query: 122 KKDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           K+  FRFL +STDEVYG+L ++GLF+E  PY PSSPYSA+KA+SD+LV AW  TYG+P L
Sbjct: 123 KQQTFRFLHVSTDEVYGALGEQGLFTEQTPYAPSSPYSASKAASDHLVRAWYTTYGLPTL 182

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           ++NCSNNYGPY FPEKLIPL I   + G  + +YG G NVRDWLYV DH RAL  VL +G
Sbjct: 183 ITNCSNNYGPYQFPEKLIPLMILNALAGKPLPVYGQGSNVRDWLYVADHARALRQVLAQG 242

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSSK 300
           ++G+ YNIGG  ER N+ +V  +  LLD L P+   +  LI F++DRPGHD RYAID+SK
Sbjct: 243 QVGQTYNIGGGAERSNLTVVQTLCTLLDELQPREKPYASLIAFVQDRPGHDFRYAIDASK 302

Query: 301 IKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           I  ++GW P  + E GL +TV WYL +  W
Sbjct: 303 ISEQLGWQPTVSFEQGLRETVKWYLQHPQW 332


>gi|83950201|ref|ZP_00958934.1| dTDP-glucose 4,6-dehydratase [Roseovarius nubinhibens ISM]
 gi|83838100|gb|EAP77396.1| dTDP-glucose 4,6-dehydratase [Roseovarius nubinhibens ISM]
          Length = 349

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 181/335 (54%), Positives = 238/335 (71%), Gaps = 4/335 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSA+ R  V     +V+ +D LTYA  L+++ E++QS  + F  VDI 
Sbjct: 1   MRILVTGGAGFIGSAVVRRAVAQGH-EVINLDALTYAACLDNVAEVAQSPNYRFEHVDIR 59

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +    ++ +P+A+++ AAESHVDRSI G  EF+ TN+ GT  +LE  R  W    Q
Sbjct: 60  DRAALERVFRDHKPEAVMHLAAESHVDRSIDGPAEFVETNVTGTCNMLEAARGHWE--RQ 117

Query: 121 DKKDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            + + FRF  ISTDEV+GSL D+GLF+ED PY+P SPYSA+KA+SD+LV AW  TYG+P+
Sbjct: 118 GRPEGFRFHHISTDEVFGSLGDEGLFTEDTPYDPRSPYSASKAASDHLVRAWHETYGLPI 177

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGPYHFPEKL+P+ I   +EG  + +YG G NVRDWLYVEDH  AL  V++K
Sbjct: 178 VMTNCSNNYGPYHFPEKLVPVVIINALEGREIPVYGAGANVRDWLYVEDHAEALLQVVQK 237

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSS 299
           G +G  YNIGG  ER+NID+V  I  +LD   PK  S+ E I F+ DRPGHD RYAID+ 
Sbjct: 238 GAVGRSYNIGGEGERRNIDLVRHICAVLDDRRPKDTSYAEQITFVADRPGHDHRYAIDAR 297

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           +I+ E+GW P   +E G+ +TV WYL N  WWRPL
Sbjct: 298 RIRDELGWRPSVTVEEGIARTVDWYLANEAWWRPL 332


>gi|32170824|gb|AAP57700.1| dTDP-D-glucose-4,6-dehydratase [Sphingomonas elodea]
          Length = 353

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 182/336 (54%), Positives = 241/336 (71%), Gaps = 6/336 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
            +VTGG GFIGSA+ R+LV     +V+ +DKLTYAGN  SL  I  +  + F+  DI D 
Sbjct: 6   FLVTGG-GFIGSAVVRHLVRQ-GARVINLDKLTYAGNPASLTAIENAPNYRFVHADIADT 63

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             I   L+E Q D +++ AAESHVDRSI G  EFI TN++GTF LL+    +W  L  +K
Sbjct: 64  ATILPLLREEQVDVVMHLAAESHVDRSIDGPGEFIETNVVGTFKLLQSALQYWRELEGEK 123

Query: 123 KDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           ++ FRF  ISTDEV+G L  D G+F+E+ PY+PSSPYSA+KA+SD+LV AWGHTYG+PV+
Sbjct: 124 REGFRFHHISTDEVFGDLPFDSGIFTEETPYDPSSPYSASKAASDHLVRAWGHTYGLPVV 183

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           LSNCSNNYGP+HFPEKLIPL I   +EG  + +YG G+N+RDWLYV+DH +AL  +   G
Sbjct: 184 LSNCSNNYGPFHFPEKLIPLTILNALEGKPLPVYGKGENIRDWLYVDDHAKALATIATTG 243

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIP--KSYSHTELIRFIEDRPGHDRRYAIDS 298
           ++G+ YN+GG NER N+ +V  I  LLD  IP        ELI F+ DRPGHDRRYAID+
Sbjct: 244 KVGQSYNVGGRNERTNLQVVETICDLLDQRIPLADGRKRRELITFVTDRPGHDRRYAIDA 303

Query: 299 SKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           +K+++E+GW  +EN ++G+  T+ WYL+N WWW P+
Sbjct: 304 TKLETELGWKAEENFDTGIAATIDWYLENEWWWGPI 339


>gi|59802213|ref|YP_208925.1| hypothetical protein NGO1897 [Neisseria gonorrhoeae FA 1090]
 gi|194099850|ref|YP_002002987.1| RfbB [Neisseria gonorrhoeae NCCP11945]
 gi|240015151|ref|ZP_04722064.1| RfbB [Neisseria gonorrhoeae DGI18]
 gi|240017599|ref|ZP_04724139.1| RfbB [Neisseria gonorrhoeae FA6140]
 gi|240081743|ref|ZP_04726286.1| RfbB [Neisseria gonorrhoeae FA19]
 gi|240114019|ref|ZP_04728509.1| RfbB [Neisseria gonorrhoeae MS11]
 gi|240118976|ref|ZP_04733038.1| RfbB [Neisseria gonorrhoeae PID1]
 gi|240122222|ref|ZP_04735184.1| RfbB [Neisseria gonorrhoeae PID24-1]
 gi|240124512|ref|ZP_04737468.1| RfbB [Neisseria gonorrhoeae PID332]
 gi|254494777|ref|ZP_05107948.1| dTDP-glucose 4,6-dehydratase [Neisseria gonorrhoeae 1291]
 gi|260439484|ref|ZP_05793300.1| RfbB [Neisseria gonorrhoeae DGI2]
 gi|268597841|ref|ZP_06132008.1| dTDP-D-glucose 4,6-dehydratase [Neisseria gonorrhoeae FA19]
 gi|268600085|ref|ZP_06134252.1| dTDP-glucose 4,6-dehydratase [Neisseria gonorrhoeae MS11]
 gi|268604690|ref|ZP_06138857.1| dTDP-glucose 4,6-dehydratase [Neisseria gonorrhoeae PID1]
 gi|268683146|ref|ZP_06150008.1| dTDP-glucose 4,6-dehydratase [Neisseria gonorrhoeae PID332]
 gi|291042718|ref|ZP_06568459.1| dTDP-D-glucose 4,6-dehydratase [Neisseria gonorrhoeae DGI2]
 gi|293398256|ref|ZP_06642461.1| dTDP-glucose 4,6-dehydratase [Neisseria gonorrhoeae F62]
 gi|59719108|gb|AAW90513.1| dTDP-D-glucose 4,6-dehydratase [Neisseria gonorrhoeae FA 1090]
 gi|193935140|gb|ACF30964.1| RfbB [Neisseria gonorrhoeae NCCP11945]
 gi|226513817|gb|EEH63162.1| dTDP-glucose 4,6-dehydratase [Neisseria gonorrhoeae 1291]
 gi|268551629|gb|EEZ46648.1| dTDP-D-glucose 4,6-dehydratase [Neisseria gonorrhoeae FA19]
 gi|268584216|gb|EEZ48892.1| dTDP-glucose 4,6-dehydratase [Neisseria gonorrhoeae MS11]
 gi|268588821|gb|EEZ53497.1| dTDP-glucose 4,6-dehydratase [Neisseria gonorrhoeae PID1]
 gi|268623430|gb|EEZ55830.1| dTDP-glucose 4,6-dehydratase [Neisseria gonorrhoeae PID332]
 gi|291013152|gb|EFE05118.1| dTDP-D-glucose 4,6-dehydratase [Neisseria gonorrhoeae DGI2]
 gi|291611519|gb|EFF40589.1| dTDP-glucose 4,6-dehydratase [Neisseria gonorrhoeae F62]
          Length = 346

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 178/331 (53%), Positives = 242/331 (73%), Gaps = 6/331 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL +I+ +  ++F QVDICDR
Sbjct: 9   ILVTGGAGFIGSAVVRHIIQNTRDSVVNLDKLTYAGNLESLTDIADNPRYAFEQVDICDR 68

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             +     +++PDA+++ AAESHVDR+I  A EFI TNI+GTF LLE  R +W  +  +K
Sbjct: 69  AELDRVFAQYRPDAVMHLAAESHVDRAIGSAGEFIRTNIVGTFDLLEAARAYWQQMPSEK 128

Query: 123 KDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           ++ FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KA++D+LV AW  TY +P +
Sbjct: 129 REAFRFHHISTDEVYGDLHGTDDLFTETTPYAPSSPYSASKAAADHLVRAWQRTYRLPSI 188

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           +SNCSNNYGP  FPEKLIPL I   + G  + +YGDG  +RDWL+VEDH RALY V+ +G
Sbjct: 189 VSNCSNNYGPRQFPEKLIPLMILNALSGKPLPVYGDGAQIRDWLFVEDHARALYQVVTEG 248

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYAI 296
            +GE YNIGG+NE+ N++++  I  LL+ L P+  +    + +LI F++DRPGHD RYA+
Sbjct: 249 VVGETYNIGGHNEKTNLEVIKTICALLEELAPEKPAGVARYEDLITFVQDRPGHDARYAV 308

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDN 327
           D++KI+ ++GW P E  ESGL KTV WYLDN
Sbjct: 309 DAAKIRRDLGWLPLETFESGLRKTVQWYLDN 339


>gi|238794279|ref|ZP_04637892.1| dTDP-glucose 4,6-dehydratase [Yersinia intermedia ATCC 29909]
 gi|238726363|gb|EEQ17904.1| dTDP-glucose 4,6-dehydratase [Yersinia intermedia ATCC 29909]
          Length = 339

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 181/323 (56%), Positives = 230/323 (71%), Gaps = 6/323 (1%)

Query: 16  LCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPD 75
           + R++++     V+V+DKLTYAGNL SL  ++ S  ++F QVDICDR  +      +QPD
Sbjct: 1   MVRHIIDGTSDSVVVVDKLTYAGNLESLAVVAHSERYAFEQVDICDRAELDRVFAHYQPD 60

Query: 76  AIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDE 135
            +++ AAESHVDRSI G   FI TN++GT+ LLE  R +W  LS + K  FRF  ISTDE
Sbjct: 61  MVMHLAAESHVDRSIDGPAAFIETNVVGTYTLLEAARHYWQQLSAEAKQAFRFHHISTDE 120

Query: 136 VYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHF 193
           VYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P L++NCSNNYGPYHF
Sbjct: 121 VYGDLHGTDDLFTETTPYAPSSPYSASKASSDHLVRAWLRTYGLPTLVTNCSNNYGPYHF 180

Query: 194 PEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKGRIGERYNIGGNNE 253
           PEKLIPL I   + G  + +YG+G  VRDWLYVEDH RALY V+ +G +GE YNIGG+NE
Sbjct: 181 PEKLIPLVILNALAGKPLPVYGNGAQVRDWLYVEDHARALYQVVTEGAVGETYNIGGHNE 240

Query: 254 RKNIDIVFEIGFLLDALIPKSYSHTE----LIRFIEDRPGHDRRYAIDSSKIKSEIGWFP 309
           RKNI++V  +  LLD L+P   +  E    LI +++DRPGHD RYAID+ KI+ E+GW P
Sbjct: 241 RKNIEVVETLCTLLDELVPAKPAGIEHYRDLITYVKDRPGHDMRYAIDAGKIERELGWRP 300

Query: 310 QENMESGLNKTVCWYLDNNWWWR 332
           QE  ESG+ KT+ WYL+N  WWR
Sbjct: 301 QETFESGIRKTLLWYLNNESWWR 323


>gi|239997868|ref|ZP_04717792.1| RfbB [Neisseria gonorrhoeae 35/02]
 gi|240124615|ref|ZP_04737501.1| RfbB [Neisseria gonorrhoeae SK-92-679]
 gi|268593714|ref|ZP_06127881.1| dTDP-D-glucose 4,6-dehydratase [Neisseria gonorrhoeae 35/02]
 gi|268683182|ref|ZP_06150044.1| dTDP-glucose 4,6-dehydratase [Neisseria gonorrhoeae SK-92-679]
 gi|268547103|gb|EEZ42521.1| dTDP-D-glucose 4,6-dehydratase [Neisseria gonorrhoeae 35/02]
 gi|268623466|gb|EEZ55866.1| dTDP-glucose 4,6-dehydratase [Neisseria gonorrhoeae SK-92-679]
 gi|317165318|gb|ADV08859.1| hypothetical protein NGTW08_1904 [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 346

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 178/331 (53%), Positives = 242/331 (73%), Gaps = 6/331 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL +I+ +  ++F QVDICDR
Sbjct: 9   ILVTGGAGFIGSAVVRHIIQNTRNSVVNLDKLTYAGNLESLTDIADNPRYAFEQVDICDR 68

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             +     +++PDA+++ AAESHVDR+I  A EFI TNI+GTF LLE  R +W  +  +K
Sbjct: 69  AELDRVFAQYRPDAVMHLAAESHVDRAIGSAGEFIRTNIVGTFDLLEAARAYWQQMPSEK 128

Query: 123 KDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           ++ FRF  ISTDEVYG L     LF+E  PY PSSPYSA+KA++D+LV AW  TY +P +
Sbjct: 129 REAFRFHHISTDEVYGDLHGTDDLFTETTPYAPSSPYSASKAAADHLVRAWQRTYRLPSI 188

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           +SNCSNNYGP  FPEKLIPL I   + G  + +YGDG  +RDWL+VEDH RALY V+ +G
Sbjct: 189 VSNCSNNYGPRQFPEKLIPLMILNALSGKPLPVYGDGAQIRDWLFVEDHARALYQVVTEG 248

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYAI 296
            +GE YNIGG+NE+ N++++  I  LL+ L P+  +    + +LI F++DRPGHD RYA+
Sbjct: 249 VVGETYNIGGHNEKTNLEVIKTICALLEELAPEKPAGVARYEDLITFVQDRPGHDARYAV 308

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDN 327
           D++KI+ ++GW P E  ESGL KTV WYLDN
Sbjct: 309 DAAKIRRDLGWLPLETFESGLRKTVQWYLDN 339


>gi|329897707|ref|ZP_08272185.1| dTDP-glucose 4,6-dehydratase [gamma proteobacterium IMCC3088]
 gi|328921054|gb|EGG28466.1| dTDP-glucose 4,6-dehydratase [gamma proteobacterium IMCC3088]
          Length = 354

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 185/337 (54%), Positives = 242/337 (71%), Gaps = 6/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+L+ D +  V+ +DKLTYAGNL SL+EI  S L++F QVDIC
Sbjct: 1   MKVLVTGGAGFIGSAVVRHLIRDKQYGVVNVDKLTYAGNLESLREIDGSPLYTFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +   ++    +  PD +++ AAESHVDRSI G   FI TN++GT+ +LE  R +W  L  
Sbjct: 61  NLAELQRVFADHCPDKVMHLAAESHVDRSIDGPSAFIETNMVGTYCMLEAARHYWLSLVG 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           + ++ FRF  ISTDEVYG L     LF+E   Y PSSPYSA+KA SD+LV AW  TYG+P
Sbjct: 121 EARESFRFHHISTDEVYGDLHGTDDLFTETTHYAPSSPYSASKAGSDHLVRAWHRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+++NCSNNYGPYHFPEKLIPL I   I G  + +YG+G  +RDWLYVEDH RAL  V+ 
Sbjct: 181 VVVTNCSNNYGPYHFPEKLIPLLILNAIHGKTLPVYGEGLQIRDWLYVEDHARALVRVVF 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY----SHTELIRFIEDRPGHDRRY 294
            G++GE YNIGG+NE++NID+V  I  +L+ L P+       + +LI  + DRPGHD RY
Sbjct: 241 DGKVGETYNIGGHNEKRNIDVVHTICDILEDLRPEKPEGVDQYRDLITHVADRPGHDLRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           AID+SKI+ E+ W P+E+ ESG+ KTV WYLDN  WW
Sbjct: 301 AIDASKIQRELDWVPEESFESGIRKTVEWYLDNEAWW 337


>gi|294341173|emb|CAZ89574.1| dTDP-glucose 4,6-dehydratase [Thiomonas sp. 3As]
          Length = 354

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 186/332 (56%), Positives = 232/332 (69%), Gaps = 4/332 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           + +TG AGFIG+    + +      VLV+D LTYAGNL SL  ++    + F Q+DICDR
Sbjct: 2   IFLTGAAGFIGANFVHHWLGQKDEPVLVLDALTYAGNLESLAPVASDPRYHFAQLDICDR 61

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             + + L   +P A+++FAAESHVDRSI G  +FI TN+ GTF LLE  R +W+ L   +
Sbjct: 62  PAVTALLTTHRPRALLHFAAESHVDRSIHGPGDFIRTNVQGTFELLEAIRAYWAGLPAPE 121

Query: 123 KDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           K  FRFL +STDEVYGSL      F+E  PY P+SPYSA+KA+SD+LV AW HTYG+PVL
Sbjct: 122 KAAFRFLHVSTDEVYGSLSPTDPAFTETTPYAPNSPYSASKAASDHLVRAWHHTYGLPVL 181

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
            +NCSNNYGPY FPEKLIPL I   + G  + +YGDGQNVRDWLYV+DH RA+  VL+ G
Sbjct: 182 TTNCSNNYGPYQFPEKLIPLMIHNALAGKPLPVYGDGQNVRDWLYVQDHCRAIARVLEAG 241

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPK--SYSHTELIRFIEDRPGHDRRYAIDS 298
           R+GE YN+GG NE KN+D+V  +  LLD L PK    S+   I F+ DRPGHDRRYAID+
Sbjct: 242 RLGETYNVGGCNEVKNLDVVHTLCDLLDQLRPKMDGSSYRAQITFVADRPGHDRRYAIDA 301

Query: 299 SKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
            KI+ E+GW PQE   +GL KTV WYLDN  W
Sbjct: 302 RKIERELGWTPQETFATGLRKTVQWYLDNPDW 333


>gi|217978848|ref|YP_002362995.1| dTDP-glucose 4,6-dehydratase [Methylocella silvestris BL2]
 gi|217504224|gb|ACK51633.1| dTDP-glucose 4,6-dehydratase [Methylocella silvestris BL2]
          Length = 356

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 183/333 (54%), Positives = 235/333 (70%), Gaps = 3/333 (0%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R++VTGGAGFIGSA+ R ++ +    VLV+DKLTYAGNL+SLK ++    + F++ DI D
Sbjct: 8   RILVTGGAGFIGSAVVREIIGETPHSVLVVDKLTYAGNLDSLKPVAADPRYDFIRADIVD 67

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
              ++S   +FQPD +++ AAESHVDRSI G  EFI TN++GTF LL+ T  +W  L   
Sbjct: 68  APRMQSVFAQFQPDIVMHLAAESHVDRSIDGPGEFIQTNVVGTFTLLQATLGYWRGLPAA 127

Query: 122 KKDQFRFLQISTDEVYGSLD-KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           ++  FRF  ISTDEV+GSL  +G F E   Y P+SPYSA+KA+SD+LV AW HTYG+P +
Sbjct: 128 RQTSFRFHHISTDEVFGSLGPEGFFIETTAYCPNSPYSASKAASDHLVNAWRHTYGLPTV 187

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           LSNCSNNYGPYHFPEKLIPL I   +EG  + +YG G N+RDWLYVEDH RAL  V  +G
Sbjct: 188 LSNCSNNYGPYHFPEKLIPLTIINALEGKPLPVYGAGANIRDWLYVEDHARALLTVATQG 247

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY--SHTELIRFIEDRPGHDRRYAIDS 298
            +G  Y IGG+NE+ N+D+V  I  L+D L P         L+ F+ DRPGHD RYAID 
Sbjct: 248 AVGGSYCIGGHNEKTNLDVVHAICALVDELAPDRAIGPRAGLVSFVSDRPGHDLRYAIDP 307

Query: 299 SKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           SKI  ++GW P+E  ESGL +TV WYL++  WW
Sbjct: 308 SKIAVDLGWRPRETFESGLRQTVQWYLEHRDWW 340


>gi|213616299|ref|ZP_03372125.1| dTDP-glucose 4,6-dehydratase [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-2068]
          Length = 320

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 179/306 (58%), Positives = 223/306 (72%), Gaps = 6/306 (1%)

Query: 35  TYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNFAAESHVDRSILGAD 94
           TYAGNL SL  ++QS+ F+F +VDICDR  +    +++QPD++++ AAESHVDRSI G  
Sbjct: 1   TYAGNLMSLASVAQSDRFAFEKVDICDRASLEQVFQQYQPDSVMHLAAESHVDRSIDGPA 60

Query: 95  EFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKG--LFSEDMPYN 152
            FI TNI+GT+ LLE  R +WS L  D K  FRF  ISTDEVYG L      F+E  PY 
Sbjct: 61  AFIETNIVGTYTLLEAARAYWSALDADAKAAFRFHHISTDEVYGDLHTADDFFTETTPYA 120

Query: 153 PSSPYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVF 212
           PSSPYSA+KASSD+LV AW  TYG+P L++NCSNNYGPYHFPEKLIPL I   + G  + 
Sbjct: 121 PSSPYSASKASSDHLVRAWLRTYGLPTLVTNCSNNYGPYHFPEKLIPLMILNALAGKPLP 180

Query: 213 LYGDGQNVRDWLYVEDHVRALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIP 272
           +YG+GQ +RDWLYVEDH RALY V+  G +GE YNIGG+NERKN+D+V  I  LL+ L P
Sbjct: 181 VYGNGQQIRDWLYVEDHARALYHVVTNGAVGETYNIGGHNERKNLDVVRTICALLEELAP 240

Query: 273 KS----YSHTELIRFIEDRPGHDRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNN 328
           +      ++ +LI F++DRPGHD RYAID+SKI  E+GW PQE  ESG+ KTV WYL N 
Sbjct: 241 QKPQGVANYHDLITFVDDRPGHDLRYAIDASKIARELGWTPQETFESGMRKTVQWYLANE 300

Query: 329 WWWRPL 334
            WW+P+
Sbjct: 301 AWWKPV 306


>gi|238026391|ref|YP_002910622.1| DTDP-glucose 4,6-dehydratase [Burkholderia glumae BGR1]
 gi|237875585|gb|ACR27918.1| DTDP-glucose 4,6-dehydratase [Burkholderia glumae BGR1]
          Length = 353

 Score =  382 bits (982), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 191/352 (54%), Positives = 239/352 (67%), Gaps = 8/352 (2%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIG+      +      VL +DKLTYAGNL +LK +  +    F +VDICDR
Sbjct: 2   ILVTGGAGFIGANFVLDWLAQSGEAVLNVDKLTYAGNLGTLKSLQGNPAHVFARVDICDR 61

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             I + L E +P AI++FAAESHVDRSI G  EF+ TN++GTF LLE  R +W+ L  D 
Sbjct: 62  AAIDALLAEHRPRAILHFAAESHVDRSIHGPAEFVQTNVVGTFTLLEAARQYWNTLEADA 121

Query: 123 KDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           K  FRFL +STDEV+GSL      FSE  PY P+SPYSATKA SD+LV A+ HTYG+PVL
Sbjct: 122 KAAFRFLHVSTDEVFGSLSASDPQFSETTPYAPNSPYSATKAGSDHLVRAYFHTYGLPVL 181

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
            +NCSNNYGPY FPEKLIPL I   + G  + +YGDGQNVRDWLYV DH  A+  VL +G
Sbjct: 182 TTNCSNNYGPYQFPEKLIPLMIANALAGKPLPVYGDGQNVRDWLYVGDHCSAIREVLARG 241

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY-SHTELIRFIEDRPGHDRRYAIDSS 299
             GE YN+GG NE+KN+D+V  +  LLD L PK+  S+ E + F+ DRPGHDRRYAID+ 
Sbjct: 242 VPGETYNVGGWNEKKNLDVVHVLCDLLDTLRPKAAGSYREQVTFVTDRPGHDRRYAIDAR 301

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKELKPDNDYSKWKNLN 351
           K++ E+GW P E  E+G+ KTV WYLDN  W   +        +Y  W  +N
Sbjct: 302 KLERELGWKPAETFETGMEKTVRWYLDNQPWAAEV-----ASGEYRNWVEMN 348


>gi|121533497|ref|ZP_01665325.1| dTDP-glucose 4,6-dehydratase [Thermosinus carboxydivorans Nor1]
 gi|121308056|gb|EAX48970.1| dTDP-glucose 4,6-dehydratase [Thermosinus carboxydivorans Nor1]
          Length = 354

 Score =  382 bits (982), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 186/332 (56%), Positives = 242/332 (72%), Gaps = 4/332 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLV-IDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           + VTGGAGFIG+   R++++  +   ++ +DKLTYAGNL+SL ++  +    F++  I D
Sbjct: 4   IFVTGGAGFIGTNFVRHMLSTYQDTTIINLDKLTYAGNLDSLADVLNNPRHIFVKGGIED 63

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +   L +++P A+VNFAAESHVDRSI G   FI TNI+GTF LLE  R +W  L++ 
Sbjct: 64  RSLVEYLLAQYRPQAVVNFAAESHVDRSIDGPAAFIQTNIVGTFQLLEAVRAYWQALAEV 123

Query: 122 KKDQFRFLQISTDEVYGSLD-KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           +K+ FRFL +STDEVYGSL  +G F+E  PY P+SPYSA+KA+SD+LV AW HTYG+PVL
Sbjct: 124 EKENFRFLHVSTDEVYGSLGPEGYFTEATPYAPNSPYSASKAASDHLVRAWHHTYGLPVL 183

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
            +NCSNNYGPY FPEKLIPL I   ++G  + +YGDG+NVRDWLYV DH RA+  VL+ G
Sbjct: 184 TTNCSNNYGPYQFPEKLIPLMILNALDGKPLPVYGDGRNVRDWLYVLDHCRAIDTVLRYG 243

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPK--SYSHTELIRFIEDRPGHDRRYAIDS 298
           R GE YNIGGNNE+ NI++V  I  +LD + P+    S+   I F++DRPGHDRRYAID+
Sbjct: 244 RPGETYNIGGNNEKANIEVVETICDILDEMQPRPDGSSYRTQITFVQDRPGHDRRYAIDA 303

Query: 299 SKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           SKIK E+GW PQE   +G+ KTV WYL N  W
Sbjct: 304 SKIKRELGWQPQETFATGIRKTVEWYLANRAW 335


>gi|254489386|ref|ZP_05102589.1| dTDP-glucose 4,6-dehydratase [Roseobacter sp. GAI101]
 gi|214041893|gb|EEB82533.1| dTDP-glucose 4,6-dehydratase [Roseobacter sp. GAI101]
          Length = 345

 Score =  382 bits (982), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 182/335 (54%), Positives = 236/335 (70%), Gaps = 4/335 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+L+VTGGAGFIGSA+ R  V      V+ +D LTYA  L ++  ++ S L++F Q DIC
Sbjct: 1   MKLLVTGGAGFIGSAVVRLAVAQGH-GVVNLDALTYAACLENVASVADSPLYAFEQADIC 59

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +     + QPDA+++ AAESHVDRSI G   FI TNI GT+ LLE  R +W     
Sbjct: 60  DRAALDRIFADHQPDAVMHLAAESHVDRSIDGPGAFIQTNITGTYTLLEAARAYWQ--GA 117

Query: 121 DKKDQFRFLQISTDEVYGSLD-KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            K D+FRF  ISTDEV+GSL   G F+ED PY+P SPYSA+KA+SD+LV AWG TYG+P+
Sbjct: 118 GKPDRFRFHHISTDEVFGSLGPTGQFTEDTPYDPRSPYSASKAASDHLVRAWGETYGLPI 177

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGP+HFPEKL+P+ I + + G  + +YGDG NVRDWL+VEDH  AL  VL K
Sbjct: 178 IMTNCSNNYGPFHFPEKLVPVVILKALAGQPIPVYGDGANVRDWLFVEDHADALLTVLTK 237

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSS 299
           G++G  YNIGG NE  N+++V  I  LLD   P+   H +LI F+ DRPGHD+RYAID +
Sbjct: 238 GKLGRSYNIGGENEVSNLELVKMICALLDDRHPEGAPHADLITFVTDRPGHDQRYAIDPA 297

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           +I+SE+ W P   +E GL +TV WYL+N  WWR L
Sbjct: 298 RIRSELNWKPSVTVEEGLARTVDWYLENEDWWRAL 332


>gi|53804360|ref|YP_113744.1| dTDP-glucose 4,6-dehydratase [Methylococcus capsulatus str. Bath]
 gi|53758121|gb|AAU92412.1| dTDP-glucose 4,6-dehydratase [Methylococcus capsulatus str. Bath]
          Length = 357

 Score =  382 bits (982), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 186/331 (56%), Positives = 236/331 (71%), Gaps = 3/331 (0%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           L+VTGGAGFIG       +    ++V+ +D LTY+GNL +L E+  +    F+   I DR
Sbjct: 4   LLVTGGAGFIGGNFVLRQLRRGGVEVVNLDALTYSGNLRTLAEVEDNPNHDFVLGSIGDR 63

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
           E +   L+ +QPDA+VNFAAE+HVDRSI G D F+ TN+IGTF LLE TR +W  L  ++
Sbjct: 64  ELVEYLLERYQPDAVVNFAAETHVDRSIDGPDAFVHTNVIGTFELLEATRWYWRQLDGER 123

Query: 123 KDQFRFLQISTDEVYGSLDK-GLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLL 181
           +  FRFL +STDEVYG+L   G F+E+ PY P+SPYSA+KA SD+LV A+ HTYG+PVL 
Sbjct: 124 RKAFRFLHVSTDEVYGTLGATGKFTEETPYRPNSPYSASKAGSDHLVRAYFHTYGLPVLT 183

Query: 182 SNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKGR 241
           +NCSNNYGPY FPEKLIPL I   ++G  + +YG G NVRDWLYVEDH RA+  VL +GR
Sbjct: 184 TNCSNNYGPYQFPEKLIPLMIDHALQGLPLPVYGAGTNVRDWLYVEDHCRAIETVLARGR 243

Query: 242 IGERYNIGGNNERKNIDIVFEIGFLLDALIPKS--YSHTELIRFIEDRPGHDRRYAIDSS 299
            GE YN+GGNNE+ NI++V  I  LLD  +P S    H +LIRF++DRPGHD RYAID+ 
Sbjct: 244 PGEVYNVGGNNEKTNIEVVETICALLDEFLPDSPHRPHRQLIRFVQDRPGHDLRYAIDAG 303

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           KI  E+GW P+E  E+GL KTV WYL N  W
Sbjct: 304 KIGRELGWQPEETFETGLRKTVRWYLANRDW 334


>gi|109898449|ref|YP_661704.1| dTDP-glucose 4,6-dehydratase [Pseudoalteromonas atlantica T6c]
 gi|109700730|gb|ABG40650.1| dTDP-glucose 4,6-dehydratase [Pseudoalteromonas atlantica T6c]
          Length = 363

 Score =  382 bits (981), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 180/347 (51%), Positives = 243/347 (70%), Gaps = 15/347 (4%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+L+ + +  V+ +D LTYAGN  S+ +   S+ + F QVDIC
Sbjct: 1   MKILVTGGAGFIGSAVVRHLLANTQDSVINVDVLTYAGNTESIPQELHSDRYRFEQVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   I+      QPDA+++ AAESHVDRSI G   FI TN++GT+ LL+  R +W  L +
Sbjct: 61  DAAEIKRVFNAHQPDAVMHLAAESHVDRSIDGPGAFIQTNVVGTYTLLDAARAYWQDLPE 120

Query: 121 DKKDQFRFLQISTDEVYGSL----------DKGLFSEDMPYNPSSPYSATKASSDYLVLA 170
           ++K QF F  ISTDEVYG L          +  LF+E+ PY PSSPYSA+KASSD+LV +
Sbjct: 121 ERKGQFIFHHISTDEVYGDLPHPDEVSGGGELPLFTENTPYAPSSPYSASKASSDHLVRS 180

Query: 171 WGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHV 230
           W  TYG+P +++NCSNNYGPYHFPEKL+P  I   + G  + +YGDG  +RDWL+VEDH 
Sbjct: 181 WQRTYGLPTVITNCSNNYGPYHFPEKLVPHVILNALAGKPLPVYGDGSQIRDWLFVEDHA 240

Query: 231 RALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY-----SHTELIRFIE 285
           RAL LV+K G +GE +NIGG+NE++N+D+V  I  LLD L P+       ++ +LI F++
Sbjct: 241 RALCLVVKSGSVGETFNIGGHNEKRNLDVVRTICALLDELAPQQRAADISAYADLITFVK 300

Query: 286 DRPGHDRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           DRPGHD RYAID+S I+  +GW P+E+  SG+ KTV WYL N  WW+
Sbjct: 301 DRPGHDARYAIDASHIQKALGWKPEEDFVSGMRKTVQWYLSNESWWQ 347


>gi|190150740|ref|YP_001969265.1| dTDP-glucose 4,6-dehydratase [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|307264142|ref|ZP_07545736.1| dTDP-glucose 4,6-dehydratase [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|189915871|gb|ACE62123.1| dTDP-glucose 4,6-dehydratase [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|306870516|gb|EFN02266.1| dTDP-glucose 4,6-dehydratase [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
          Length = 354

 Score =  382 bits (981), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 193/336 (57%), Positives = 249/336 (74%), Gaps = 6/336 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           +++VTGGAGFIGSA+ R+++ND +  V+ +DKLTYAGNL SL  +  S+ +SF QVDIC+
Sbjct: 3   KILVTGGAGFIGSAVVRHIINDTQDSVVNVDKLTYAGNLESLLMVENSSRYSFEQVDICN 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     + QPDA+++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L  D
Sbjct: 63  RAELDRVFAQHQPDAVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARHYWNSLDTD 122

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L+    LF+E  PY+PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKAAFRFHHISTDEVYGDLEGTDDLFTETTPYSPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGP+HFPEKLIPL I   +EG  + +YG+GQ +RDWL+VEDH RALY V+ +
Sbjct: 183 IVTNCSNNYGPFHFPEKLIPLMILNALEGKKLPVYGNGQQIRDWLFVEDHARALYKVVTE 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
           G IGE YNIGG+NE+ NID+V  I  LL+ L+P   +    + +LI ++ DRPGHD RYA
Sbjct: 243 GEIGETYNIGGHNEKANIDVVRTICSLLEELVPNKPTGVKKYEDLITYVTDRPGHDVRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           ID+SKI  E+GW PQE  E+G+ KTV WYL+N  WW
Sbjct: 303 IDASKIGRELGWKPQETFETGIRKTVEWYLNNTEWW 338


>gi|288942435|ref|YP_003444675.1| dTDP-glucose 4,6-dehydratase [Allochromatium vinosum DSM 180]
 gi|288897807|gb|ADC63643.1| dTDP-glucose 4,6-dehydratase [Allochromatium vinosum DSM 180]
          Length = 355

 Score =  382 bits (981), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 185/333 (55%), Positives = 237/333 (71%), Gaps = 3/333 (0%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           L+VTGGAGFIG     +++    ++V+ +D+LTYAGNL++L  ++      F+Q DI D 
Sbjct: 4   LLVTGGAGFIGGNFVHHILEQADVRVVNLDRLTYAGNLDTLAGLAGDPRHVFVQGDIADA 63

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
           E +   L+E++ DA+VNFAAESHVDRSI G  EFI TN++GTF LL+  R +W+ L    
Sbjct: 64  ELVGRLLREYEVDAVVNFAAESHVDRSIDGPAEFIQTNVVGTFNLLDRARDYWTGLGPAA 123

Query: 123 KDQFRFLQISTDEVYGSLD-KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLL 181
           +  FRFL +STDEVYGSL   GLF+E  PY P+SPYSA+KA+SD+LV AW HTYG+PVL 
Sbjct: 124 RATFRFLHVSTDEVYGSLGPTGLFTETTPYAPNSPYSASKAASDHLVRAWFHTYGLPVLT 183

Query: 182 SNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKGR 241
           +NCSNNYGPY FPEKLIPL I +   G  + +YGDG NVRDWL+V DH RA+  VL+ G 
Sbjct: 184 TNCSNNYGPYQFPEKLIPLMILKAQAGEPLPIYGDGGNVRDWLFVLDHCRAIARVLEAGT 243

Query: 242 IGERYNIGGNNERKNIDIVFEIGFLLDALIPKS--YSHTELIRFIEDRPGHDRRYAIDSS 299
            GE YN+GGN+ER N+ +V  +  LLD  +P S    H+ L  F+ DRPGHDRRYAID+S
Sbjct: 244 PGEVYNVGGNSERTNLQVVDTLCALLDERLPDSPHRPHSRLKTFVADRPGHDRRYAIDAS 303

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           K+K E+GW P E  ESG+ +TV WYLDN  W R
Sbjct: 304 KLKRELGWEPTETFESGMRRTVDWYLDNPEWCR 336


>gi|330815725|ref|YP_004359430.1| DTDP-glucose 4,6-dehydratase [Burkholderia gladioli BSR3]
 gi|327368118|gb|AEA59474.1| DTDP-glucose 4,6-dehydratase [Burkholderia gladioli BSR3]
          Length = 353

 Score =  382 bits (980), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 192/352 (54%), Positives = 240/352 (68%), Gaps = 8/352 (2%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIG+      +      VL +DKLTYAGNL +LK +  +    F +VDICDR
Sbjct: 2   ILVTGGAGFIGANFVLDWLAQSDEPVLNVDKLTYAGNLGTLKSLQDNPNHVFARVDICDR 61

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             I + L E +P AI++FAAESHVDRSI G  +F+ TN++GTF +LE TR +W+ L  D 
Sbjct: 62  AAIDALLVEHRPRAILHFAAESHVDRSIHGPADFVQTNVVGTFTMLEATRQYWNTLDADA 121

Query: 123 KDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           K  FRFL +STDEV+GSL      FSE  PY P+SPYSATKA SD+LV A+ HTYG+PVL
Sbjct: 122 KTSFRFLHVSTDEVFGSLSATDPQFSETTPYAPNSPYSATKAGSDHLVRAYFHTYGLPVL 181

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
            +NCSNNYGPY FPEKLIPL I   + G  + +YGDGQNVRDWLYV DH  A+  VL +G
Sbjct: 182 TTNCSNNYGPYQFPEKLIPLMIANALAGKPLPVYGDGQNVRDWLYVGDHCSAIREVLARG 241

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS-YSHTELIRFIEDRPGHDRRYAIDSS 299
             GE YN+GG NE+KN+D+V  +  LLD L PK+  S+ E I F+ DRPGHDRRYAID+ 
Sbjct: 242 VPGETYNVGGWNEKKNLDVVHVLCDLLDELKPKAGASYREQIAFVTDRPGHDRRYAIDAR 301

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKELKPDNDYSKWKNLN 351
           K++ E+GW P E  E+G+ KTV WYLDN  W      E     +Y  W  +N
Sbjct: 302 KLERELGWKPAETFETGMAKTVRWYLDNQVW-----AEEVASGEYRNWVEMN 348


>gi|83944594|ref|ZP_00957044.1| dTDP-glucose 4,6-dehydratase [Sulfitobacter sp. EE-36]
 gi|83844571|gb|EAP82458.1| dTDP-glucose 4,6-dehydratase [Sulfitobacter sp. EE-36]
          Length = 345

 Score =  381 bits (979), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 181/335 (54%), Positives = 236/335 (70%), Gaps = 4/335 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+L+VTGGAGFIGSA+ R  +      VL +D LTYA  L+++  ++ S L++F Q +IC
Sbjct: 1   MKLLVTGGAGFIGSAVVRLAIAR-GYSVLNLDALTYAACLDNVASVADSPLYAFEQANIC 59

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DRE +    +  +PDA+++ AAESHVDRSI G   FI TN+ GT+ LLE  R +W     
Sbjct: 60  DREALDRIFEAHKPDAVMHLAAESHVDRSIDGPGAFIQTNVTGTYTLLEAARAYWQ--DA 117

Query: 121 DKKDQFRFLQISTDEVYGSL-DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            K   FRF  ISTDEVYGSL   G F+E+ PY+P SPYSA+KA+SD+LV AWG TYG+P+
Sbjct: 118 GKLGSFRFHHISTDEVYGSLGSTGQFTEETPYDPRSPYSASKAASDHLVRAWGETYGLPI 177

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +L+NCSNNYGPYHFPEKL+P+ I + + G  + +YGDG NVRDWL+VEDH  AL  VL K
Sbjct: 178 VLTNCSNNYGPYHFPEKLVPVVILKALAGERIPVYGDGANVRDWLFVEDHADALLTVLTK 237

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSS 299
           G +G  YNIGG NE  N+++V  I  LLD   P+   H +LI F+ DRPGHD+RYAID +
Sbjct: 238 GELGRSYNIGGENEVSNLELVKMICALLDDRHPEGAPHADLITFVADRPGHDQRYAIDPT 297

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           +I++E+GW P   +E GL +TV WYL+N  WWR L
Sbjct: 298 RIRTELGWRPSVTVEEGLARTVDWYLENEDWWRAL 332


>gi|320540290|ref|ZP_08039942.1| dTDP-glucose 4,6-dehydratase [Serratia symbiotica str. Tucson]
 gi|320029610|gb|EFW11637.1| dTDP-glucose 4,6-dehydratase [Serratia symbiotica str. Tucson]
          Length = 355

 Score =  381 bits (978), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 192/337 (56%), Positives = 244/337 (72%), Gaps = 6/337 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R+++TGGAGFIGSA+ R+++N     V+V+DKLTYAGNL SL  ++ +  ++F QVDICD
Sbjct: 3   RILITGGAGFIGSAVVRHIINATTDSVVVVDKLTYAGNLESLALVADNARYAFEQVDICD 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     E+QPD +++ AAESHVDRSI G   FI TN++GT+ LLE  R +W  LS  
Sbjct: 63  RMALDRVFAEYQPDKVMHLAAESHVDRSIDGPAAFIETNVLGTYTLLEAARHYWQPLSAK 122

Query: 122 KKDQFRFLQISTDEVYGSL--DKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L    GLF+E  PY+PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKPGFRFHHISTDEVYGDLLGTDGLFTETTPYSPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           L++NCSNNYGPYHFPEKLIPL I   + G  + +YGDG  VRDWLYVEDH RALY V+  
Sbjct: 183 LVTNCSNNYGPYHFPEKLIPLVILNAVAGKSLPVYGDGAQVRDWLYVEDHARALYQVVTS 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G +GE YNIGG+N+RKN ++V+ I  LL+ L P       ++ +LI +++DRPGHD  YA
Sbjct: 243 GVVGETYNIGGHNQRKNSEVVYSICDLLEELAPNKPQGVANYRDLITYVKDRPGHDMHYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWR 332
           ID+ KI+ E+GW PQE  ESG+ KTV WYL +  WWR
Sbjct: 303 IDAGKIERELGWRPQETFESGIRKTVSWYLHHESWWR 339


>gi|240129192|ref|ZP_04741853.1| RfbB [Neisseria gonorrhoeae SK-93-1035]
 gi|268687575|ref|ZP_06154437.1| dTDP-glucose 4,6-dehydratase [Neisseria gonorrhoeae SK-93-1035]
 gi|268627859|gb|EEZ60259.1| dTDP-glucose 4,6-dehydratase [Neisseria gonorrhoeae SK-93-1035]
          Length = 346

 Score =  381 bits (978), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 178/331 (53%), Positives = 241/331 (72%), Gaps = 6/331 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL +I+ +  ++F QVDICDR
Sbjct: 9   ILVTGGAGFIGSAVVRHIIQNTRDSVVNLDKLTYAGNLESLTDIADNPRYAFEQVDICDR 68

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             +     +++PDA+++ AAESHVDR+I  A EFI TNI+GTF LLE  R +W  +  +K
Sbjct: 69  AELDRVFAQYRPDAVMHLAAESHVDRAIGSAGEFIRTNIVGTFDLLEAARAYWQQMPSEK 128

Query: 123 KDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
            + FRF  ISTDEVYG L     LF+E  PY PS+PYSA+KA++D+LV AW  TY +P +
Sbjct: 129 HEAFRFHHISTDEVYGDLHGTDDLFTETTPYAPSNPYSASKAAADHLVRAWQRTYRLPSI 188

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           +SNCSNNYGP  FPEKLIPL I   + G  + +YGDG  +RDWL+VEDH RALY V+ +G
Sbjct: 189 VSNCSNNYGPRQFPEKLIPLMILNALSGKPLPVYGDGAQIRDWLFVEDHARALYQVVTEG 248

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYAI 296
            +GE YNIGG+NE+ N++++  I  LL+ L P+  +    + +LI F++DRPGHD RYAI
Sbjct: 249 VVGETYNIGGHNEKTNLEVIKTICALLEELAPEKPAGVARYEDLITFVQDRPGHDARYAI 308

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDN 327
           D++KI+ ++GW P E  ESGL KTV WYLDN
Sbjct: 309 DAAKIRRDLGWLPLETFESGLRKTVQWYLDN 339


>gi|119898168|ref|YP_933381.1| dTDP-glucose 4,6-dehydratase [Azoarcus sp. BH72]
 gi|119670581|emb|CAL94494.1| dTDP-glucose 4,6-dehydratase [Azoarcus sp. BH72]
          Length = 358

 Score =  381 bits (978), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 184/331 (55%), Positives = 237/331 (71%), Gaps = 3/331 (0%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIG       + +    VL +D LTYAGNL +L  ++      F + DICDR
Sbjct: 2   ILVTGGAGFIGGNFVLDWIAETGEPVLNLDALTYAGNLETLASLADDERHVFKRGDICDR 61

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
           E +   L+ ++P AIV+FAAESHVDRSI G  EFI TN+ GTF LLE  R +W+ L  D 
Sbjct: 62  ELVDGLLQTYRPRAIVHFAAESHVDRSIHGPGEFIRTNVQGTFTLLEAARAYWNGLPPDA 121

Query: 123 KDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           +  FRFL +STDEVYGSL+     F+E  P+ P+SPYSA+KA+SD+LV AW HTYG+PVL
Sbjct: 122 RAGFRFLHVSTDEVYGSLEPQAPAFTERHPFEPNSPYSASKAASDHLVRAWYHTYGLPVL 181

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
            +NCSNNYGP+HFPEKLIPL I   + G  + +YGDG NVRDWLYV+DH  A+  VL +G
Sbjct: 182 TTNCSNNYGPFHFPEKLIPLMIVNALAGRPLPVYGDGLNVRDWLYVKDHCSAIRRVLAQG 241

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIP-KSYSHTELIRFIEDRPGHDRRYAIDSS 299
           R+GE YN+GG NE++NIDIV  +  LLD + P  + S+  LI F++DRPGHDRRYAID+S
Sbjct: 242 RLGETYNVGGWNEKRNIDIVHTVCALLDEMRPDPAGSYARLITFVQDRPGHDRRYAIDAS 301

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
           KI++E+GW P E  E+G+ KT+ WYL+N  W
Sbjct: 302 KIENELGWRPAETFETGIRKTIAWYLENPGW 332


>gi|307250736|ref|ZP_07532670.1| dTDP-glucose 4,6-dehydratase [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306857240|gb|EFM89362.1| dTDP-glucose 4,6-dehydratase [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
          Length = 354

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 192/336 (57%), Positives = 249/336 (74%), Gaps = 6/336 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           +++VTGGAGFIGSA+ R+++ND +  V+ +DKLTYAGNL SL  +  S+ +SF QVDIC+
Sbjct: 3   KILVTGGAGFIGSAVVRHIINDTQDSVVNVDKLTYAGNLESLLMVENSSRYSFEQVDICN 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     + QPDA+++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L  D
Sbjct: 63  RAELDRVFAQHQPDAVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARHYWNSLDTD 122

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L+    LF+E  PY+PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKAAFRFHHISTDEVYGDLEGTNDLFTETTPYSPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGP+HFPEKLIPL I   +EG  + +YG+GQ +RDWL+VEDH RALY V+ +
Sbjct: 183 IVTNCSNNYGPFHFPEKLIPLMILNALEGKKLPVYGNGQQIRDWLFVEDHARALYKVVTE 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYA 295
           G IGE YNIGG+NE+ NID+V  I  LL+ L+P   +    + +LI ++ DRPGHD RYA
Sbjct: 243 GEIGETYNIGGHNEKANIDVVRTICSLLEELVPNKPTGVKKYEDLITYVTDRPGHDVRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           ID+SKI  ++GW PQE  E+G+ KTV WYL+N  WW
Sbjct: 303 IDASKIGRKLGWKPQETFETGIRKTVEWYLNNTEWW 338


>gi|119512441|ref|ZP_01631523.1| dTDP-glucose 4,6-dehydratase [Nodularia spumigena CCY9414]
 gi|119462907|gb|EAW43862.1| dTDP-glucose 4,6-dehydratase [Nodularia spumigena CCY9414]
          Length = 359

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 185/333 (55%), Positives = 241/333 (72%), Gaps = 3/333 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           + ++VTGGAGFIG+             V+ +DKLTYA NL +L E+     + F+Q DI 
Sbjct: 2   LTILVTGGAGFIGANFVLLARQLGWANVINLDKLTYASNLGTLAELQGDKNYHFVQGDIG 61

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           + E +   L+++QPDAI+NFAAESHVDRSIL  ++FI TN++GTF LLE +R +W  LS 
Sbjct: 62  NLELVGYLLEKYQPDAIINFAAESHVDRSILSPEDFIQTNVVGTFKLLEASRFYWQKLSA 121

Query: 121 DKKDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            K+ +FRFL +STDEVYGSL+     F ED PY P+SPY+A+KA+SD+ V A+ HTYG P
Sbjct: 122 SKQSEFRFLHVSTDEVYGSLNPKDPAFCEDTPYAPNSPYAASKAASDHFVRAYYHTYGFP 181

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            L +NCSNNYGP  FPEKLIPL I   +EG  + +YGDGQN+RDWLYV DH  A+ LVL+
Sbjct: 182 TLTTNCSNNYGPRQFPEKLIPLTILNAMEGKSLPIYGDGQNIRDWLYVIDHCEAINLVLQ 241

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPK-SYSHTELIRFIEDRPGHDRRYAID 297
           +G++GE YNIGG NE+ N+ +V +I  ++D L PK  +SH+ LI F++DRPGHDRRYAID
Sbjct: 242 QGKVGETYNIGGINEKTNLIVVEKICAIIDELAPKPDFSHSSLITFVKDRPGHDRRYAID 301

Query: 298 SSKIKSEIGWFPQENMESGLNKTVCWYLDNNWW 330
            SKI  E+GW P EN +SGL KTV WYL+N+ W
Sbjct: 302 CSKISDELGWQPHENFDSGLFKTVQWYLNNSDW 334


>gi|163748304|ref|ZP_02155586.1| dTDP-glucose 4,6-dehydratase [Oceanibulbus indolifex HEL-45]
 gi|161378423|gb|EDQ02910.1| dTDP-glucose 4,6-dehydratase [Oceanibulbus indolifex HEL-45]
          Length = 345

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 182/335 (54%), Positives = 236/335 (70%), Gaps = 4/335 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+L+VTGGAGFIGSA+ R  +      V+ +D LTYA  L++L  +S    ++F   DI 
Sbjct: 1   MKLLVTGGAGFIGSAVVRLALAQGH-AVVNLDALTYAACLDNLAGVSDRPGYAFEHADIR 59

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D + +     +  PDA+++ AAESHVDRSI G   FI TN+ GT+ LL+  R +W    +
Sbjct: 60  DAQALVRIFTDHTPDAVLHLAAESHVDRSIDGPGAFIDTNVTGTYTLLQAARAYWE--GR 117

Query: 121 DKKDQFRFLQISTDEVYGSLD-KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            + D FRF  +STDEVYGSL  +G F+E+ PY P+SPYSA+KA+SD+LV AWG TYG+PV
Sbjct: 118 GRPDGFRFHHVSTDEVYGSLGAEGYFTEETPYAPNSPYSASKAASDHLVRAWGETYGMPV 177

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           LLSNCSNNYGPYHFPEKLIP+ I   + G  + +YG G+N+RDWLYVEDH  AL  VL K
Sbjct: 178 LLSNCSNNYGPYHFPEKLIPVVILNALSGKPIPIYGTGENIRDWLYVEDHAEALLTVLTK 237

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSS 299
           G +G  YNIGGN E +NID+V +I  LLD L P  +++ +LI F+EDRPGHD RYAID+S
Sbjct: 238 GAVGRSYNIGGNAEARNIDLVRQICALLDELRPARHAYADLITFVEDRPGHDARYAIDAS 297

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           +I++E+GW P   +E GL  TV WYLDN  WW+ L
Sbjct: 298 RIRTELGWQPSVTLEEGLRHTVAWYLDNPAWWQAL 332


>gi|312100474|gb|ADQ27860.1| dTDP-glucose 4,6-dehydratase [Burkholderia pseudomallei]
          Length = 400

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 191/352 (54%), Positives = 238/352 (67%), Gaps = 8/352 (2%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIG+      +      VL +DKLTYAGNL +LK +  +    F +VDICDR
Sbjct: 49  ILVTGGAGFIGANFVLDWLTQSDEAVLNVDKLTYAGNLGTLKSLQGNPKHVFARVDICDR 108

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             I + L + +P AIV+FAAESHVDRSI G  +F+ TN++GTF LLE  R +WS L  D 
Sbjct: 109 AAIDALLAQHKPRAIVHFAAESHVDRSIHGPADFVQTNVVGTFTLLEAARQYWSALGTDA 168

Query: 123 KDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           K  FRFL +STDEV+GSL      FSE  PY P+SPYSATKA SD+LV A+ HTYG+PVL
Sbjct: 169 KAAFRFLHVSTDEVFGSLSPADPQFSETTPYAPNSPYSATKAGSDHLVRAYHHTYGLPVL 228

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
            +NCSNNYGPY FPEKLIPL I   + G  + +YGDGQNVRDWLYV DH  A+  VL +G
Sbjct: 229 TTNCSNNYGPYQFPEKLIPLMIANALGGKPLPVYGDGQNVRDWLYVGDHCSAIREVLARG 288

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS-YSHTELIRFIEDRPGHDRRYAIDSS 299
             GE YN+GG NE+KN+D+V  +  LLD   PK+  S+ + I ++ DRPGHDRRYAID+ 
Sbjct: 289 VPGETYNVGGWNEKKNLDVVHTLCDLLDEARPKAGGSYRDQITYVTDRPGHDRRYAIDAR 348

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKELKPDNDYSKWKNLN 351
           K++ E+GW P E  E+GL KTV WYLD+  W   +        DY KW   N
Sbjct: 349 KLERELGWKPAETFETGLAKTVRWYLDHQEWVDEVVS-----GDYRKWVETN 395


>gi|240116755|ref|ZP_04730817.1| RfbB [Neisseria gonorrhoeae PID18]
 gi|268602426|ref|ZP_06136593.1| dTDP-glucose 4,6-dehydratase [Neisseria gonorrhoeae PID18]
 gi|268586557|gb|EEZ51233.1| dTDP-glucose 4,6-dehydratase [Neisseria gonorrhoeae PID18]
          Length = 346

 Score =  380 bits (976), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 177/331 (53%), Positives = 241/331 (72%), Gaps = 6/331 (1%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIGSA+ R+++ + +  V+ +DKLTYAGNL SL +I+ +  ++F QVDICDR
Sbjct: 9   ILVTGGAGFIGSAVVRHIIQNTRDSVVNLDKLTYAGNLESLTDIADNPRYAFEQVDICDR 68

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             +     +++PDA+++ AAESHVDR+I  A EFI TNI+GTF LLE  R +W  +  +K
Sbjct: 69  AELDRVFAQYRPDAVMHLAAESHVDRAIGSAGEFIRTNIVGTFDLLEAARAYWQQMPSEK 128

Query: 123 KDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
            + FRF  ISTDEVYG L     LF+E  PY PS+PYSA+KA++D+LV AW  TY +P +
Sbjct: 129 HEAFRFHHISTDEVYGDLHGTDDLFTETTPYAPSNPYSASKAAADHLVRAWQRTYRLPSI 188

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           +SNCSNNYGP  FPEKLIPL I   + G  + +YGDG  +RDWL+VEDH RALY V+ +G
Sbjct: 189 VSNCSNNYGPRQFPEKLIPLMILNALSGKPLPVYGDGAQIRDWLFVEDHARALYQVVTEG 248

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYAI 296
            +GE YNIGG+NE+ N++++  I  LL+ L P+  +    + +LI F++DRPGHD RYA+
Sbjct: 249 VVGETYNIGGHNEKTNLEVIKTICALLEELAPEKPAGVARYEDLITFVQDRPGHDARYAV 308

Query: 297 DSSKIKSEIGWFPQENMESGLNKTVCWYLDN 327
           D++KI+ ++GW P E  ESGL KTV WYLDN
Sbjct: 309 DAAKIRRDLGWLPLETFESGLRKTVQWYLDN 339


>gi|293611245|ref|ZP_06693543.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292826496|gb|EFF84863.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 355

 Score =  380 bits (976), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 192/355 (54%), Positives = 255/355 (71%), Gaps = 11/355 (3%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M++++TGGAGFIGSA+ R+++ + K +VL +DKLTYAGNL SL  ++ +  + F Q DIC
Sbjct: 1   MKILITGGAGFIGSAVVRHIIQNTKNEVLNVDKLTYAGNLESLISVADNPRYQFSQTDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +    + FQPDA+++ AAESHVDRSI G   FI TN+IGT+ +LE +R +W  LS 
Sbjct: 61  DRAALDKLFETFQPDAVMHLAAESHVDRSITGPYAFIETNVIGTYQMLEASRAYWLGLSD 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           +KK  FRF  ISTDEVYG L+    LF+E   Y+PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 EKKAAFRFHHISTDEVYGDLEGTTDLFTETTSYSPSSPYSASKASSDHLVRAWNRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           VL++NCSNNYGP+HFPEKLIPL I   ++   + +YG+GQ +RDWL+VEDH RALY V+ 
Sbjct: 181 VLVTNCSNNYGPFHFPEKLIPLMILNALQAKPLPVYGNGQQIRDWLFVEDHARALYTVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRY 294
           +G IGE YNIGG+NE+ N+D+V+ I  LL+ L PK       + +LI +++DRPGHD RY
Sbjct: 241 QGVIGETYNIGGHNEKANLDVVYAICDLLEELAPKKPEGVAQYKDLITYVKDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKELKPDNDYSKWKN 349
           AID++KIK E+ W P+E+ E+GL KTV WYL+N  W      E     +Y  W N
Sbjct: 301 AIDATKIKDELNWVPEESFETGLRKTVEWYLNNKEW-----VEHVQSGEYQSWLN 350


>gi|76808899|ref|YP_334535.1| dTDP-glucose 4,6-dehydratase [Burkholderia pseudomallei 1710b]
 gi|254195972|ref|ZP_04902397.1| dTDP-glucose 4,6-dehydratase [Burkholderia pseudomallei S13]
 gi|76578352|gb|ABA47827.1| dTDP-glucose 4,6-dehydratase [Burkholderia pseudomallei 1710b]
 gi|169652716|gb|EDS85409.1| dTDP-glucose 4,6-dehydratase [Burkholderia pseudomallei S13]
          Length = 400

 Score =  380 bits (976), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 191/352 (54%), Positives = 238/352 (67%), Gaps = 8/352 (2%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIG+      +      VL +DKLTYAGNL +LK +  +    F +VDICDR
Sbjct: 49  ILVTGGAGFIGANFVLDWLAQSDEAVLNVDKLTYAGNLGTLKSLQGNPKHVFARVDICDR 108

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             I + L + +P AIV+FAAESHVDRSI G  +F+ TN++GTF LLE  R +WS L  D 
Sbjct: 109 AAIDALLAQHKPRAIVHFAAESHVDRSIHGPADFVQTNVVGTFTLLEAARQYWSALGTDA 168

Query: 123 KDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           K  FRFL +STDEV+GSL      FSE  PY P+SPYSATKA SD+LV A+ HTYG+PVL
Sbjct: 169 KAAFRFLHVSTDEVFGSLSPADPQFSETTPYAPNSPYSATKAGSDHLVRAYHHTYGLPVL 228

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
            +NCSNNYGPY FPEKLIPL I   + G  + +YGDGQNVRDWLYV DH  A+  VL +G
Sbjct: 229 TTNCSNNYGPYQFPEKLIPLMIANALGGKPLPVYGDGQNVRDWLYVGDHCSAIREVLARG 288

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS-YSHTELIRFIEDRPGHDRRYAIDSS 299
             GE YN+GG NE+KN+D+V  +  LLD   PK+  S+ + I ++ DRPGHDRRYAID+ 
Sbjct: 289 VPGETYNVGGWNEKKNLDVVHTLCDLLDEARPKAGGSYRDQITYVTDRPGHDRRYAIDAR 348

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKELKPDNDYSKWKNLN 351
           K++ E+GW P E  E+GL KTV WYLD+  W   +        DY KW   N
Sbjct: 349 KLERELGWKPAETFETGLAKTVRWYLDHQEWVDEVVS-----GDYRKWVETN 395


>gi|84684394|ref|ZP_01012295.1| dTDP-glucose 4,6-dehydratase [Maritimibacter alkaliphilus HTCC2654]
 gi|84667373|gb|EAQ13842.1| dTDP-glucose 4,6-dehydratase [Rhodobacterales bacterium HTCC2654]
          Length = 346

 Score =  380 bits (976), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 184/335 (54%), Positives = 242/335 (72%), Gaps = 4/335 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R  ++  + +V+ +D LTYA  L+++  ++ +  ++F QVDI 
Sbjct: 1   MKILVTGGAGFIGSAVVRLAISRGQ-EVVNLDALTYAACLDNVASVADAPGYAFEQVDIR 59

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  +   L + +PDAI++ AAESHVDRSI G   FI TN++GTF LLE  R +W    Q
Sbjct: 60  DRPALDRVLSDHRPDAIMHLAAESHVDRSIDGPATFIETNVMGTFNLLEAARSYWD--GQ 117

Query: 121 DKKDQFRFLQISTDEVYGSLD-KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            +   FRF  ISTDEV+GSL  +G F+E+ PY+P SPYSA+KASSD+LV AW  TYG+PV
Sbjct: 118 GRDPAFRFHHISTDEVFGSLGPEGQFTEESPYDPRSPYSASKASSDHLVRAWHETYGLPV 177

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +L+NCSNNYGPYHFPEKLIP+ I + + G  + +YGDG NVRDWLYVEDH  AL LVL++
Sbjct: 178 VLTNCSNNYGPYHFPEKLIPIVILKALAGEPIPIYGDGSNVRDWLYVEDHADALLLVLEE 237

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSS 299
           G IG  YNIGG NER N+D+V  +  +LD + PK  S+ + I F+ DRPGHD RYAID +
Sbjct: 238 GAIGRSYNIGGENERSNLDLVRTLCTILDRMAPKEGSYGDQITFVADRPGHDARYAIDPT 297

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           +I+ E+GW P   +E GL KTV WYLDN  WW+ L
Sbjct: 298 RIRDELGWRPSVTVEEGLEKTVRWYLDNRDWWQAL 332


>gi|121598415|ref|YP_992263.1| dTDP-glucose 4,6-dehydratase [Burkholderia mallei SAVP1]
 gi|124385907|ref|YP_001028705.1| dTDP-glucose 4,6-dehydratase [Burkholderia mallei NCTC 10229]
 gi|238560981|ref|ZP_00442594.2| dTDP-glucose 4,6-dehydratase [Burkholderia mallei GB8 horse 4]
 gi|251767280|ref|ZP_02266641.2| dTDP-glucose 4,6-dehydratase [Burkholderia mallei PRL-20]
 gi|254207600|ref|ZP_04913950.1| dTDP-glucose 4,6-dehydratase [Burkholderia mallei JHU]
 gi|254356498|ref|ZP_04972774.1| dTDP-glucose 4,6-dehydratase [Burkholderia mallei 2002721280]
 gi|121227225|gb|ABM49743.1| dTDP-glucose 4,6-dehydratase [Burkholderia mallei SAVP1]
 gi|124293927|gb|ABN03196.1| dTDP-glucose 4,6-dehydratase [Burkholderia mallei NCTC 10229]
 gi|147751494|gb|EDK58561.1| dTDP-glucose 4,6-dehydratase [Burkholderia mallei JHU]
 gi|148025495|gb|EDK83649.1| dTDP-glucose 4,6-dehydratase [Burkholderia mallei 2002721280]
 gi|238525298|gb|EEP88726.1| dTDP-glucose 4,6-dehydratase [Burkholderia mallei GB8 horse 4]
 gi|243063266|gb|EES45452.1| dTDP-glucose 4,6-dehydratase [Burkholderia mallei PRL-20]
          Length = 400

 Score =  380 bits (976), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 191/352 (54%), Positives = 238/352 (67%), Gaps = 8/352 (2%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIG+      +      VL +DKLTYAGNL +LK +  +    F +VDICDR
Sbjct: 49  ILVTGGAGFIGANFVLDWLAQSDEAVLNVDKLTYAGNLGTLKSLQGNPKHVFARVDICDR 108

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             I + L + +P AIV+FAAESHVDRSI G  +F+ TN++GTF LLE  R +WS L  D 
Sbjct: 109 AAIDALLAQHKPRAIVHFAAESHVDRSIHGPADFVQTNVVGTFTLLEAARQYWSALGTDA 168

Query: 123 KDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           K  FRFL +STDEV+GSL      FSE  PY P+SPYSATKA SD+LV A+ HTYG+PVL
Sbjct: 169 KAAFRFLHVSTDEVFGSLSPADPQFSETTPYAPNSPYSATKAGSDHLVRAYHHTYGLPVL 228

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
            +NCSNNYGPY FPEKLIPL I   + G  + +YGDGQNVRDWLYV DH  A+  VL +G
Sbjct: 229 TTNCSNNYGPYQFPEKLIPLMIANALGGKPLPVYGDGQNVRDWLYVGDHCSAIREVLARG 288

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS-YSHTELIRFIEDRPGHDRRYAIDSS 299
             GE YN+GG NE+KN+D+V  +  LLD   PK+  S+ + I ++ DRPGHDRRYAID+ 
Sbjct: 289 VPGETYNVGGWNEKKNLDVVHTLCDLLDEARPKAGGSYRDQITYVTDRPGHDRRYAIDAR 348

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKELKPDNDYSKWKNLN 351
           K++ E+GW P E  E+GL KTV WYLD+  W   +        DY KW   N
Sbjct: 349 KLERELGWKPAETFETGLAKTVRWYLDHQEWVDEVVS-----GDYRKWVETN 395


>gi|187922880|ref|YP_001894522.1| dTDP-glucose 4,6-dehydratase [Burkholderia phytofirmans PsJN]
 gi|187714074|gb|ACD15298.1| dTDP-glucose 4,6-dehydratase [Burkholderia phytofirmans PsJN]
          Length = 353

 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 189/352 (53%), Positives = 239/352 (67%), Gaps = 8/352 (2%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIG+      +N     VL +DKLTYAGNL +LK    +    F++ DICDR
Sbjct: 2   ILVTGGAGFIGANFVLDWLNASDEAVLNVDKLTYAGNLGTLKSQQNNPKHVFVRADICDR 61

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             + +   E +P A+++FAAESHVDRSI G  +F+ TN++GTF LLE  R +W+ L +  
Sbjct: 62  AALDALFAEHKPRAVLHFAAESHVDRSIHGPADFVQTNVVGTFTLLEAARQYWTALGEAD 121

Query: 123 KDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           K  FRFL +STDEV+GSL      FSE  PY P+SPYSATKA SD+LV A+ HTYG+PVL
Sbjct: 122 KAAFRFLHVSTDEVFGSLSATDPQFSETTPYAPNSPYSATKAGSDHLVRAYHHTYGLPVL 181

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
            +NCSNNYGPY FPEKLIPL I   + G  + +YGDGQNVRDWLYV DH  A+  VL +G
Sbjct: 182 TTNCSNNYGPYQFPEKLIPLMIANALGGKALPVYGDGQNVRDWLYVGDHCSAIREVLARG 241

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS-YSHTELIRFIEDRPGHDRRYAIDSS 299
             GE YNIGG NE+KN+D+V  +  LLD L PK+  S+ + I +++DRPGHDRRYAID+ 
Sbjct: 242 TPGETYNIGGWNEKKNLDVVHTLCDLLDQLRPKTGASYRDQITYVKDRPGHDRRYAIDAR 301

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKELKPDNDYSKWKNLN 351
           K++ E+GW P E  E+GL KTV WYLDN  W      +     DY KW   N
Sbjct: 302 KLERELGWKPAETFETGLAKTVQWYLDNQAW-----SDEVASGDYRKWVETN 348


>gi|110635096|ref|YP_675304.1| dTDP-glucose 4,6-dehydratase [Mesorhizobium sp. BNC1]
 gi|110286080|gb|ABG64139.1| dTDP-glucose 4,6-dehydratase [Chelativorans sp. BNC1]
          Length = 352

 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 184/339 (54%), Positives = 233/339 (68%), Gaps = 5/339 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR++VTGGAGFIGSA+CR L  +    V+ +DKLTYAGN  SL EI   + + F++ DIC
Sbjct: 1   MRILVTGGAGFIGSAVCRRLAANRGNVVINVDKLTYAGNRTSLSEIETQSNYHFVRADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   +R     F  D I++ AAESHVDRSI G   FI  NI+GTF LLE    +W  L  
Sbjct: 61  DMRKMRETFDRFAIDGIMHLAAESHVDRSIDGPAAFIEANIVGTFRLLEAALDYWRSLDG 120

Query: 121 DKKDQFRFLQISTDEVYGSLD---KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGI 177
           +++ +FRF  +STDEV+G L       F E  PY PSSPYSA+KA++D+LV AW  TYG+
Sbjct: 121 ERRARFRFHHVSTDEVFGDLPFDPSKKFDETTPYAPSSPYSASKAAADHLVRAWHATYGL 180

Query: 178 PVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVL 237
           PV+LSNCSNNYGP+HFPEKLIPL I   +E   + +YG G+NVRDWL+VEDH RAL  V 
Sbjct: 181 PVVLSNCSNNYGPFHFPEKLIPLTILNALEEKPLPVYGSGENVRDWLFVEDHARALEQVF 240

Query: 238 KKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPK--SYSHTELIRFIEDRPGHDRRYA 295
           + GR+GE Y IGGN+ER N+ +V  I  LLD   P+       +LI F+ DRPGHDRRYA
Sbjct: 241 RHGRVGESYAIGGNSERTNLAVVETICDLLDTRRPRPGGKPRRDLIVFVHDRPGHDRRYA 300

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           ID+SKI  E+GW P  + E+GL +T+ WYL N WWW+P+
Sbjct: 301 IDASKIDRELGWKPSVSFETGLARTIDWYLANAWWWKPI 339


>gi|145629948|ref|ZP_01785730.1| dTDP-glucose 46-dehydratase [Haemophilus influenzae R3021]
 gi|145632245|ref|ZP_01787980.1| dTDP-glucose 46-dehydratase [Haemophilus influenzae 3655]
 gi|145634035|ref|ZP_01789746.1| dTDP-glucose 46-dehydratase [Haemophilus influenzae PittAA]
 gi|145636997|ref|ZP_01792661.1| dTDP-glucose 46-dehydratase [Haemophilus influenzae PittHH]
 gi|145638308|ref|ZP_01793918.1| dTDP-glucose 46-dehydratase [Haemophilus influenzae PittII]
 gi|148826482|ref|YP_001291235.1| dTDP-glucose 46-dehydratase [Haemophilus influenzae PittEE]
 gi|229844752|ref|ZP_04464891.1| dTDP-glucose 46-dehydratase [Haemophilus influenzae 6P18H1]
 gi|319775194|ref|YP_004137682.1| dTDP-glucose 4,6-dehydratase [Haemophilus influenzae F3047]
 gi|329122884|ref|ZP_08251455.1| dTDP-glucose 4,6-dehydratase [Haemophilus aegyptius ATCC 11116]
 gi|144984229|gb|EDJ91652.1| dTDP-glucose 46-dehydratase [Haemophilus influenzae R3021]
 gi|144987152|gb|EDJ93682.1| dTDP-glucose 46-dehydratase [Haemophilus influenzae 3655]
 gi|145268479|gb|EDK08472.1| dTDP-glucose 46-dehydratase [Haemophilus influenzae PittAA]
 gi|145269855|gb|EDK09794.1| dTDP-glucose 46-dehydratase [Haemophilus influenzae PittHH]
 gi|145272637|gb|EDK12544.1| dTDP-glucose 46-dehydratase [Haemophilus influenzae PittII]
 gi|148716642|gb|ABQ98852.1| dTDP-glucose 46-dehydratase [Haemophilus influenzae PittEE]
 gi|229812466|gb|EEP48156.1| dTDP-glucose 46-dehydratase [Haemophilus influenzae 6P18H1]
 gi|309751459|gb|ADO81443.1| dTDP-glucose 4,6-dehydratase [Haemophilus influenzae R2866]
 gi|317449785|emb|CBY85992.1| dTDP-glucose 4,6-dehydratase [Haemophilus influenzae F3047]
 gi|327471815|gb|EGF17255.1| dTDP-glucose 4,6-dehydratase [Haemophilus aegyptius ATCC 11116]
          Length = 334

 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 182/334 (54%), Positives = 247/334 (73%), Gaps = 6/334 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M +++TGG+GFIGSAL RY++   +  V+ IDKLTYA N ++LKE+  +  ++F Q+DIC
Sbjct: 1   MNILITGGSGFIGSALIRYIIYQTQDSVINIDKLTYAANQSALKEVENNPRYAFEQIDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D + I S  +++QPDA+++ AAESHVDRSI GA +FI TNI+GT+ LLE  + +W  L +
Sbjct: 61  DLKAIESVFEKYQPDAVMHLAAESHVDRSISGAADFIQTNIVGTYTLLEVAKNYWHTLDE 120

Query: 121 DKKDQFRFLQISTDEVYG--SLDKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            KK  FRF  ISTDEVYG  SL +  F+E  PY+PSSPYSA+KA+SD+LV AW  TYG+P
Sbjct: 121 AKKTTFRFHHISTDEVYGDLSLSEPAFTEYSPYHPSSPYSASKAASDHLVYAWHRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+++N SNNYG Y  PEKLIPL I+  + G  + +YGDGQ +RDWL+VE+HV+ALYLVL 
Sbjct: 181 VIITNSSNNYGAYQHPEKLIPLVISNALMGKPLPIYGDGQQIRDWLFVEEHVQALYLVLT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           KGR+GE YNIGGN E+ N+++V  I  LL+ L P   +    + +LI F++DRPGHD RY
Sbjct: 241 KGRVGENYNIGGNCEKTNLEVVKTICQLLEELAPNKPNNIKYYDDLIIFVKDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNN 328
           ++D SKI +E+GW P+   E GL++TV WYL N+
Sbjct: 301 SLDCSKIHAELGWQPKITFERGLSQTVQWYLFNS 334


>gi|145628207|ref|ZP_01784008.1| dTDP-glucose 46-dehydratase [Haemophilus influenzae 22.1-21]
 gi|148828056|ref|YP_001292809.1| dTDP-glucose 46-dehydratase [Haemophilus influenzae PittGG]
 gi|144979982|gb|EDJ89641.1| dTDP-glucose 46-dehydratase [Haemophilus influenzae 22.1-21]
 gi|148719298|gb|ABR00426.1| dTDP-glucose 46-dehydratase [Haemophilus influenzae PittGG]
          Length = 334

 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 182/334 (54%), Positives = 247/334 (73%), Gaps = 6/334 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M +++TGG+GFIGSAL RY++   +  V+ IDKLTYA N ++LKE+  +  ++F Q+DIC
Sbjct: 1   MNILITGGSGFIGSALIRYIIYQTQDSVINIDKLTYAANQSALKEVENNPRYAFEQIDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D + I S  +++QPDA+++ AAESHVDRSI GA +FI TNI+GT+ LLE  + +W  L +
Sbjct: 61  DLKAIESVFEKYQPDAVMHLAAESHVDRSISGAADFIQTNIVGTYTLLEVAKNYWHTLDE 120

Query: 121 DKKDQFRFLQISTDEVYG--SLDKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            KK  FRF  ISTDEVYG  SL +  F+E  PY+PSSPYSA+KA+SD+LV AW  TYG+P
Sbjct: 121 AKKTTFRFHHISTDEVYGDLSLSEPAFTEYSPYHPSSPYSASKAASDHLVYAWHRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+++N SNNYG Y  PEKLIPL I+  + G  + +YGDGQ +RDWL+VE+HV+ALYLVL 
Sbjct: 181 VIITNSSNNYGAYQHPEKLIPLMISNALMGKPLPIYGDGQQIRDWLFVEEHVQALYLVLT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           KGR+GE YNIGGN E+ N+++V  I  LL+ L P   +    + +LI F++DRPGHD RY
Sbjct: 241 KGRVGENYNIGGNCEKTNLEVVKTICQLLEELAPNKPNNIKYYDDLIIFVKDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNN 328
           ++D SKI +E+GW P+   E GL++TV WYL N+
Sbjct: 301 SLDCSKIHAELGWQPKITFERGLSQTVQWYLFNS 334


>gi|312100404|gb|ADQ27800.1| dTDP-4-glucose 4,6-dehydratase [Burkholderia pseudomallei]
 gi|312100444|gb|ADQ27838.1| dTDP-4-glucose 4,6-dehydratase [Burkholderia pseudomallei]
          Length = 400

 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 191/352 (54%), Positives = 238/352 (67%), Gaps = 8/352 (2%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIG+      +      VL +DKLTYAGNL +LK +  +    F +VDICDR
Sbjct: 49  ILVTGGAGFIGANFVLDWLAQSDEAVLNVDKLTYAGNLGTLKSLQGNPKHVFARVDICDR 108

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             I + L + +P AIV+FAAESHVDRSI G  +F+ TN++GTF LLE  R +WS L  D 
Sbjct: 109 AAIDALLAQHKPRAIVHFAAESHVDRSIHGPADFVQTNVVGTFTLLEAARQYWSALGPDA 168

Query: 123 KDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           K  FRFL +STDEV+GSL      FSE  PY P+SPYSATKA SD+LV A+ HTYG+PVL
Sbjct: 169 KAAFRFLHVSTDEVFGSLSPADPQFSETTPYAPNSPYSATKAGSDHLVRAYHHTYGLPVL 228

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
            +NCSNNYGPY FPEKLIPL I   + G  + +YGDGQNVRDWLYV DH  A+  VL +G
Sbjct: 229 TTNCSNNYGPYQFPEKLIPLMIANALGGKPLPVYGDGQNVRDWLYVGDHCSAIREVLARG 288

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS-YSHTELIRFIEDRPGHDRRYAIDSS 299
             GE YN+GG NE+KN+D+V  +  LLD   PK+  S+ + I ++ DRPGHDRRYAID+ 
Sbjct: 289 VPGETYNVGGWNEKKNLDVVHTLCDLLDEARPKAGGSYRDQITYVTDRPGHDRRYAIDAR 348

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKELKPDNDYSKWKNLN 351
           K++ E+GW P E  E+GL KTV WYLD+  W   +        DY KW   N
Sbjct: 349 KLERELGWKPAETFETGLAKTVRWYLDHQEWVDEVVS-----GDYRKWVETN 395


>gi|238759808|ref|ZP_04620965.1| dTDP-glucose 4,6-dehydratase [Yersinia aldovae ATCC 35236]
 gi|238701951|gb|EEP94511.1| dTDP-glucose 4,6-dehydratase [Yersinia aldovae ATCC 35236]
          Length = 339

 Score =  379 bits (974), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 180/323 (55%), Positives = 231/323 (71%), Gaps = 6/323 (1%)

Query: 16  LCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPD 75
           + R++++     VLV+DKLTYAGNL SL  ++ S  ++F  VDICDR  +     ++QPD
Sbjct: 1   MVRHIIDGTSDSVLVVDKLTYAGNLESLAVVAHSERYAFELVDICDRAELDRVFAQYQPD 60

Query: 76  AIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDE 135
            +++ AAESHVDRSI G   FI TN++GT+ +LE  R +W  L  + K  FRF  ISTDE
Sbjct: 61  VVMHLAAESHVDRSIDGPAAFIETNVVGTYTMLEAARHYWQQLRAEAKLAFRFHHISTDE 120

Query: 136 VYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHF 193
           VYG L     LF+E  PY PSSPYSA+KASSD+LV AW  TYG+P L++NCSNNYGPYHF
Sbjct: 121 VYGDLHGTDDLFTETTPYAPSSPYSASKASSDHLVRAWQRTYGLPTLVTNCSNNYGPYHF 180

Query: 194 PEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKGRIGERYNIGGNNE 253
           PEKLIPL I   + G  + +YG+G  VRDWL+VEDH RALY V+ +G +GE YNIGG+NE
Sbjct: 181 PEKLIPLVILNALAGKPLPVYGNGAQVRDWLFVEDHARALYQVVTEGVVGETYNIGGHNE 240

Query: 254 RKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRYAIDSSKIKSEIGWFP 309
           RKNI++V  I  LLD LIP   +    + +LI +++DRPGHD RYAID+SKI+ E+GW P
Sbjct: 241 RKNIEVVETICTLLDELIPAKPAGIVHYRDLITYVKDRPGHDMRYAIDASKIERELGWRP 300

Query: 310 QENMESGLNKTVCWYLDNNWWWR 332
           QE  ESG+ KTV WYL+N  WW+
Sbjct: 301 QETFESGIRKTVLWYLNNKSWWQ 323


>gi|307246376|ref|ZP_07528452.1| dTDP-glucose 4,6-dehydratase [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307255362|ref|ZP_07537172.1| dTDP-glucose 4,6-dehydratase [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307259812|ref|ZP_07541530.1| dTDP-glucose 4,6-dehydratase [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|306852709|gb|EFM84938.1| dTDP-glucose 4,6-dehydratase [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306861671|gb|EFM93655.1| dTDP-glucose 4,6-dehydratase [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306866110|gb|EFM97980.1| dTDP-glucose 4,6-dehydratase [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
          Length = 353

 Score =  379 bits (974), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 188/337 (55%), Positives = 250/337 (74%), Gaps = 6/337 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R+++N+ +  V+ +DKLTYAGNL SL+ +   + + F  VDIC
Sbjct: 1   MKILVTGGAGFIGSAIVRHIINNTQDSVINVDKLTYAGNLESLQMVENHSRYIFEHVDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           +R  +     ++QPDA+++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L  
Sbjct: 61  NRAELERVFAQYQPDAVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNSLDT 120

Query: 121 DKKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
           DKK  FRF  ISTDEVYG L+    LF+E  PY+PSSPYSA+KASSD+LV AW  TYG+P
Sbjct: 121 DKKSLFRFHHISTDEVYGDLEGTDDLFTETTPYSPSSPYSASKASSDHLVRAWLRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
            +++NCSNNYGP+HFPEKLIPL I   +EG  + +YG+GQ +RDWL+VEDH RALY V+ 
Sbjct: 181 TIVTNCSNNYGPFHFPEKLIPLMILNALEGKPLPVYGNGQQIRDWLFVEDHARALYKVVT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           +G++GE YNIGG+NE+ NID+V  I  LL+ L+P   +    + +LI ++ DRPGHD RY
Sbjct: 241 EGKVGETYNIGGHNEKANIDVVRTICSLLEELVPNKPAGVKKYEDLITYVTDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           AID++KI  E+GW PQE  E+G+ KTV WYL+N  WW
Sbjct: 301 AIDATKIGRELGWQPQETFETGIRKTVEWYLNNTEWW 337


>gi|167580853|ref|ZP_02373727.1| dTDP-glucose 4,6-dehydratase [Burkholderia thailandensis TXDOH]
          Length = 353

 Score =  379 bits (974), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 190/352 (53%), Positives = 238/352 (67%), Gaps = 8/352 (2%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIG+      +      VL +DKLTYAGNL +LK +  +    F +VDICDR
Sbjct: 2   ILVTGGAGFIGANFVLDWLAQSDEAVLNVDKLTYAGNLGTLKSLQGNPKHVFARVDICDR 61

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             I + L +++P AI++FAAESHVDRSI G  +F+ TN++GTF LLE  R +WS L  D 
Sbjct: 62  AAIDALLAQYKPRAILHFAAESHVDRSIHGPADFVQTNVVGTFTLLEAARQYWSALDADA 121

Query: 123 KDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           K  FRFL +STDEV+GSL      FSE  PY P+SPYSATKA SD+LV A+ HTYG+P L
Sbjct: 122 KAAFRFLHVSTDEVFGSLSPADPQFSETTPYAPNSPYSATKAGSDHLVRAYHHTYGLPTL 181

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
            +NCSNNYGPY FPEKLIPL I   + G  + +YGDGQNVRDWLYV DH  A+  VL +G
Sbjct: 182 TTNCSNNYGPYQFPEKLIPLMIANALGGKPLPVYGDGQNVRDWLYVGDHCSAIREVLARG 241

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY-SHTELIRFIEDRPGHDRRYAIDSS 299
             GE YN+GG NE+KN+D+V  +  LLD   PK+  S+ + I ++ DRPGHDRRYAID+ 
Sbjct: 242 VPGETYNVGGWNEKKNLDVVHTLCDLLDEARPKAAGSYRDQITYVTDRPGHDRRYAIDAR 301

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKELKPDNDYSKWKNLN 351
           K++ E+GW P E  E+GL KTV WYLDN  W   +        DY KW   N
Sbjct: 302 KLERELGWKPAETFETGLAKTVRWYLDNQEWVDEV-----ASGDYRKWVETN 348


>gi|83719152|ref|YP_442015.1| dTDP-glucose 4,6-dehydratase [Burkholderia thailandensis E264]
 gi|83652977|gb|ABC37040.1| dTDP-glucose 4,6-dehydratase [Burkholderia thailandensis E264]
          Length = 397

 Score =  379 bits (974), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 189/352 (53%), Positives = 238/352 (67%), Gaps = 8/352 (2%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIG+      +      VL +DKLTYAGNL +LK +  +    F +VDICDR
Sbjct: 46  ILVTGGAGFIGANFVLDWLAQSDEAVLNVDKLTYAGNLGTLKSLQGNPKHVFARVDICDR 105

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             I + L +++P AI++FAAESHVDRSI G  +F+ TN++GTF LLE  R +WS L  D 
Sbjct: 106 AAIDALLAQYKPRAILHFAAESHVDRSIHGPADFVQTNVVGTFTLLEAARQYWSALDADA 165

Query: 123 KDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           K  FRFL +STDEV+GSL      FSE  PY P+SPYSATKA SD+LV A+ HTYG+P L
Sbjct: 166 KAAFRFLHVSTDEVFGSLSPADPQFSETTPYAPNSPYSATKAGSDHLVRAYHHTYGLPTL 225

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
            +NCSNNYGPY FPEKLIPL I   + G  + +YGDGQNVRDWLYV DH  A+  VL +G
Sbjct: 226 TTNCSNNYGPYQFPEKLIPLMIANALGGKPLPVYGDGQNVRDWLYVGDHCSAIREVLARG 285

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY-SHTELIRFIEDRPGHDRRYAIDSS 299
             GE YN+GG NE+KN+D+V  +  LLD   PK+  S+ + I ++ DRPGHDRRYAID+ 
Sbjct: 286 VPGETYNVGGWNEKKNLDVVHTLCDLLDEARPKAAGSYRDQITYVTDRPGHDRRYAIDAR 345

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKELKPDNDYSKWKNLN 351
           K++ E+GW P E  E+GL KTV WYLD+  W   +        DY KW   N
Sbjct: 346 KLERELGWKPAETFETGLAKTVRWYLDSQEWVDEVAS-----GDYRKWVETN 392


>gi|303252477|ref|ZP_07338641.1| dTDP-glucose 4,6-dehydratase [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|307248512|ref|ZP_07530530.1| dTDP-glucose 4,6-dehydratase [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|302648678|gb|EFL78870.1| dTDP-glucose 4,6-dehydratase [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|306854988|gb|EFM87173.1| dTDP-glucose 4,6-dehydratase [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
          Length = 354

 Score =  379 bits (974), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 190/336 (56%), Positives = 249/336 (74%), Gaps = 6/336 (1%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           +++VTGGAGFIGSA+ R+++ND +  V+ +DKLTYAGNL SL  +  S  + F QVDIC+
Sbjct: 3   KILVTGGAGFIGSAVVRHIINDTQDSVVNVDKLTYAGNLESLLMVENSPRYVFEQVDICN 62

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
           R  +     + QPDA+++ AAESHVDRSI G   FI TNI+GT+ LLE  R +W+ L  D
Sbjct: 63  RAELDRVFAQHQPDAVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARYYWNSLDAD 122

Query: 122 KKDQFRFLQISTDEVYGSLD--KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
           KK  FRF  ISTDEVYG L+  + LF+E  PY+PSSPYSA+KASSD+LV AW  TYG+P 
Sbjct: 123 KKSLFRFHHISTDEVYGDLEGTEDLFTETTPYSPSSPYSASKASSDHLVRAWLRTYGLPT 182

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +++NCSNNYGP+HFPEKLIPL I   +EG  + +YG+GQ +RDWL+VEDH RALY V+ +
Sbjct: 183 IVTNCSNNYGPFHFPEKLIPLMILNALEGKPLPVYGNGQQIRDWLFVEDHARALYKVVTE 242

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKS----YSHTELIRFIEDRPGHDRRYA 295
           G++GE YNIGG+NE+ NID+V  I  LL+ L+P      + + +LI ++ DRPGHD RYA
Sbjct: 243 GKVGETYNIGGHNEKANIDVVRTICSLLEELVPNKPAGVHKYEDLITYVTDRPGHDVRYA 302

Query: 296 IDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           ID++KI  E+GW PQE  E+G+ KTV WYL+N  WW
Sbjct: 303 IDATKIGRELGWKPQETFETGIRKTVEWYLNNTEWW 338


>gi|260576535|ref|ZP_05844524.1| dTDP-glucose 4,6-dehydratase [Rhodobacter sp. SW2]
 gi|259021258|gb|EEW24565.1| dTDP-glucose 4,6-dehydratase [Rhodobacter sp. SW2]
          Length = 346

 Score =  379 bits (974), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 181/335 (54%), Positives = 238/335 (71%), Gaps = 4/335 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R  V      V+ +D LTYA  L+++  ++ SNL+SF Q DI 
Sbjct: 1   MKILVTGGAGFIGSAVVRLAVARGH-AVINLDALTYAACLDNVASVAGSNLYSFEQADIR 59

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DR  + +     +PDA+++ AAESHVDRSI G  +FI+TNI GT+ LLE  R +W+  + 
Sbjct: 60  DRAALDAVFARHRPDAVMHLAAESHVDRSIDGPGDFISTNITGTYTLLEAARAFWT--AA 117

Query: 121 DKKDQFRFLQISTDEVYGSLD-KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            +   FRF  ISTDEV+G+L   G F+ED PY P+SPY+A+KA+SD+LV AW  TYG+PV
Sbjct: 118 GRPAGFRFHHISTDEVFGTLGPTGQFTEDTPYAPNSPYAASKAASDHLVRAWSETYGLPV 177

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           +L+NCSNNYGP+HFPEKLIP+ I   + G  + +YG G+NVRDWL+VEDH  AL  VL++
Sbjct: 178 VLTNCSNNYGPFHFPEKLIPVVILNALAGKPIPVYGRGENVRDWLFVEDHADALLCVLER 237

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSS 299
           G +G  YNIGG NE +NID+V  I  LLD + P    H  LIRF+ DRPGHD RYAID S
Sbjct: 238 GALGRSYNIGGENEARNIDLVRMICSLLDEMHPAGAPHDRLIRFVTDRPGHDARYAIDPS 297

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPL 334
           +I++E+GW P   +E GL +TV WYLDN  WW+ L
Sbjct: 298 RIRNELGWRPSVTLEQGLRRTVRWYLDNPGWWQAL 332


>gi|229845924|ref|ZP_04466036.1| dTDP-glucose 46-dehydratase [Haemophilus influenzae 7P49H1]
 gi|229810928|gb|EEP46645.1| dTDP-glucose 46-dehydratase [Haemophilus influenzae 7P49H1]
          Length = 334

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 182/334 (54%), Positives = 247/334 (73%), Gaps = 6/334 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M +++TGG+GFIGSAL RY++   +  V+ IDKLTYA N ++LKE+  +  ++F Q+DIC
Sbjct: 1   MNILITGGSGFIGSALIRYIIYQTQDSVINIDKLTYAANQSALKEVENNPRYAFEQIDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D + I S  +++QPDA+++ AAESHVDRSI GA +FI TNI+GT+ LLE  + +W  L +
Sbjct: 61  DLKAIESVFEKYQPDAVMHLAAESHVDRSISGAADFIQTNIVGTYTLLEVAKNYWHTLDE 120

Query: 121 DKKDQFRFLQISTDEVYG--SLDKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            KK  FRF  ISTDEVYG  SL +  F+E  PY+PSSPYSA+KA+SD+LV AW  TYG+P
Sbjct: 121 AKKTTFRFHHISTDEVYGDLSLSEPAFTEYSPYHPSSPYSASKAASDHLVYAWHRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+++N SNNYG Y  PEKLIPL I+  + G  + +YGDGQ +RDWL+VE+HV+ALYLVL 
Sbjct: 181 VIITNSSNNYGAYQHPEKLIPLVISNALMGKLLPIYGDGQQIRDWLFVEEHVQALYLVLT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           KGR+GE YNIGGN E+ N+++V  I  LL+ L P   +    + +LI F++DRPGHD RY
Sbjct: 241 KGRVGENYNIGGNCEKTNLEVVKTICQLLEELAPNKPNNIKYYDDLIIFVKDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNN 328
           ++D SKI +E+GW P+   E GL++TV WYL N+
Sbjct: 301 SLDCSKIHAELGWQPKITFERGLSQTVQWYLFNS 334


>gi|118588017|ref|ZP_01545427.1| dTDP-glucose 4,6-dehydratase [Stappia aggregata IAM 12614]
 gi|118439639|gb|EAV46270.1| dTDP-glucose 4,6-dehydratase [Stappia aggregata IAM 12614]
          Length = 360

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 184/332 (55%), Positives = 234/332 (70%), Gaps = 1/332 (0%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M+++VTGGAGFIGSA+ R LV+     V+ +D LTYAGN+ SL  +  +    F++ DI 
Sbjct: 1   MKVLVTGGAGFIGSAVVRKLVSQQLAGVVTVDALTYAGNMASLAPVLDTRQHRFVKADIR 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D   + S L++  PDA+++ AAESHVDRSI G   FI TNI+GT  LLE  R +WS L  
Sbjct: 61  DGAAMASLLEKEAPDAVMHLAAESHVDRSIDGPAAFIDTNIVGTCTLLEAVRGYWSGLPL 120

Query: 121 DKKDQFRFLQISTDEVYGSLD-KGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPV 179
            +K+ FRF  +STDEVYGSL   G F E   Y P+SPYSA+KA+SD+LV AW HTYG+PV
Sbjct: 121 PRKEAFRFHHVSTDEVYGSLGPSGAFKETTAYAPNSPYSASKAASDHLVRAWHHTYGLPV 180

Query: 180 LLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKK 239
           + +NCSNNYGPY FPEKLIPL I   +E   + +YG G N+RDWL+VEDH  AL+LVL +
Sbjct: 181 VTTNCSNNYGPYQFPEKLIPLMILNGLEDKPLPVYGAGANIRDWLHVEDHADALWLVLTR 240

Query: 240 GRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSS 299
           G  G+ YNIGG+ ER+NID+V+ I  LLD L+P   S  ELI F+ DRPGHD RYA+D S
Sbjct: 241 GVPGQVYNIGGDAERRNIDVVYLICDLLDELVPSGKSRHELITFVTDRPGHDARYAMDIS 300

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWW 331
           +I +E+GW P  + ESGL +TV WYL N  WW
Sbjct: 301 RITAELGWRPSHSFESGLRQTVDWYLANRSWW 332


>gi|309973630|gb|ADO96831.1| dTDP-glucose 4,6-dehydratase [Haemophilus influenzae R2846]
          Length = 334

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 182/334 (54%), Positives = 247/334 (73%), Gaps = 6/334 (1%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           M +++TGG+GFIGSAL RY++   +  V+ IDKLTYA N ++LKE+  +  ++F Q+DIC
Sbjct: 1   MNILITGGSGFIGSALIRYIIYQTQDSVINIDKLTYAANQSALKEVENNPRYAFEQIDIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           D + I S  +++QPDA+++ AAESHVDRSI GA +FI TNI+GT+ LLE  + +W  L +
Sbjct: 61  DLKAIESVFEKYQPDAVMHLAAESHVDRSISGAADFIQTNIVGTYTLLEVAKNYWYTLDE 120

Query: 121 DKKDQFRFLQISTDEVYG--SLDKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIP 178
            KK  FRF  ISTDEVYG  SL +  F+E  PY+PSSPYSA+KA+SD+LV AW  TYG+P
Sbjct: 121 AKKTTFRFHHISTDEVYGDLSLSEPAFTEYSPYHPSSPYSASKAASDHLVYAWHRTYGLP 180

Query: 179 VLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLK 238
           V+++N SNNYG Y  PEKLIPL I+  + G  + +YGDGQ +RDWL+VE+HV+ALYLVL 
Sbjct: 181 VIITNSSNNYGAYQHPEKLIPLVISNALMGKPLPIYGDGQQIRDWLFVEEHVQALYLVLT 240

Query: 239 KGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYS----HTELIRFIEDRPGHDRRY 294
           KGR+GE YNIGGN E+ N+++V  I  LL+ L P   +    + +LI F++DRPGHD RY
Sbjct: 241 KGRVGENYNIGGNCEKTNLEVVKTICQLLEELAPNKPNNIKYYDDLIIFVKDRPGHDVRY 300

Query: 295 AIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNN 328
           ++D SKI +E+GW P+   E GL++TV WYL N+
Sbjct: 301 SLDCSKIHAELGWQPKITFERGLSQTVQWYLFNS 334


>gi|293407679|gb|ADE44333.1| putative dTDP-glucose 4,6-dehydratase [Burkholderia pseudomallei]
          Length = 353

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 191/352 (54%), Positives = 238/352 (67%), Gaps = 8/352 (2%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTGGAGFIG+      +      VL +DKLTYAGNL +LK +  +    F +VDICDR
Sbjct: 2   ILVTGGAGFIGANFVLDWLAQSDEAVLNVDKLTYAGNLGTLKSLQGNPKHVFARVDICDR 61

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
             I + L + +P AIV+FAAESHVDRSI G  +F+ TN++GTF LLE  R +WS L  D 
Sbjct: 62  AAIDALLAQHKPRAIVHFAAESHVDRSIHGPADFVQTNVVGTFTLLEAARQYWSALGPDA 121

Query: 123 KDQFRFLQISTDEVYGSLDKG--LFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
           K  FRFL +STDEV+GSL      FSE  PY P+SPYSATKA SD+LV A+ HTYG+PVL
Sbjct: 122 KAAFRFLHVSTDEVFGSLSPADPQFSETTPYAPNSPYSATKAGSDHLVRAYHHTYGLPVL 181

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
            +NCSNNYGPY FPEKLIPL I   + G  + +YGDGQNVRDWLYV DH  A+  VL +G
Sbjct: 182 TTNCSNNYGPYQFPEKLIPLMIANALGGKPLPVYGDGQNVRDWLYVGDHCSAIREVLARG 241

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSY-SHTELIRFIEDRPGHDRRYAIDSS 299
             GE YN+GG NE+KN+D+V  +  LLD   PK+  S+ + I ++ DRPGHDRRYAID+ 
Sbjct: 242 VPGETYNVGGWNEKKNLDVVHTLCDLLDEARPKAAGSYRDQITYVTDRPGHDRRYAIDAR 301

Query: 300 KIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKELKPDNDYSKWKNLN 351
           K++ E+GW P E  E+GL KTV WYLD+  W   +        DY KW   N
Sbjct: 302 KLERELGWKPAETFETGLAKTVRWYLDHQEWVDEVVS-----GDYRKWVETN 348


>gi|261868370|ref|YP_003256292.1| hypothetical pro