RPSBLAST alignment for GI: 254780920 and conserved domain: pfam04321

>gnl|CDD|113104 pfam04321, RmlD_sub_bind, RmlD substrate binding domain. L-rhamnose is a saccharide required for the virulence of some bacteria. Its precursor, dTDP-L-rhamnose, is synthesized by four different enzymes the final one of which is RmlD. The RmlD substrate binding domain is responsible for binding a sugar nucleotide. Length = 284
 Score = 59.9 bits (146), Expect = 9e-10
 Identities = 44/180 (24%), Positives = 75/180 (41%), Gaps = 43/180 (23%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
           ++VTG  G +G  L R L+ +  ++V+ +D+                      ++D+ D 
Sbjct: 1   ILVTGANGQLGRELTR-LLAERGVEVVALDRP---------------------ELDLTDP 38

Query: 63  ECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDK 122
           E + + ++E +PD +VN AA + VD++    +     N +G   L E             
Sbjct: 39  EAVAALVREARPDVVVNAAAYTAVDKAESEPELAYAVNALGPGNLAEACA---------- 88

Query: 123 KDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSATK---------ASSDYLVL--AW 171
                 + ISTD V+     G + ED P  P + Y  TK         A+  +L+L  AW
Sbjct: 89  ARGAPLIHISTDYVFDGAKGGPYREDDPTGPLNVYGRTKLAGEQAVLAANPRHLILRTAW 148