RPSBLAST alignment for GI: 254780920 and conserved domain: pfam07993

>gnl|CDD|149205 pfam07993, NAD_binding_4, Male sterility protein. This family represents the C-terminal region of the male sterility protein in a number of arabidopsis and drosophila. A sequence-related jojoba acyl CoA reductase is also included. Length = 245
 Score = 46.4 bits (111), Expect = 1e-05
 Identities = 42/200 (21%), Positives = 75/200 (37%), Gaps = 39/200 (19%)

Query: 5   VTGGAGFIGSALCRYLVN---DLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQV---- 57
           +TG  GF+G  L   L+    ++KI  LV  K   +      +E+ +  LF  L+     
Sbjct: 1   LTGATGFLGKVLLEKLLRSCPEVKIYCLVRAKDGESALERLRQELLKYGLFDRLKALERI 60

Query: 58  -----DICDREC-IRSALKEF---QPDAIVNFAAESHVDRSILGADEFITTNIIGTFILL 108
                D+ +    +     +    + D I++ AA  +         +   TN++GT  +L
Sbjct: 61  IPVAGDLSEPNLGLSDEDFQELAEEVDVIIHNAATVNFVEPY---SDLRATNVLGTREVL 117

Query: 109 EETRLWWSCLSQDKKDQFRFLQIST----DEVYGSLDKGLFSE-----DMPYNPSSPYSA 159
              RL        K     F  +ST     E  G L++  +        +     + Y+ 
Sbjct: 118 ---RL---AKQMKKL---PFHHVSTAYVNGERGGLLEEKPYPLDEDEPALLGGLPNGYTQ 168

Query: 160 TKASSDYLVLAWGHTYGIPV 179
           +K  ++ LV       G+PV
Sbjct: 169 SKWLAEQLVREAAG--GLPV 186