RPSBLAST alignment for GI: 254780920 and conserved domain: TIGR01214

>gnl|CDD|162255 TIGR01214, rmlD, dTDP-4-dehydrorhamnose reductase. This enzyme catalyzes the last of 4 steps in making dTDP-rhamnose, a precursor of LPS core antigen, O-antigen, etc. Length = 287
 Score = 57.8 bits (140), Expect = 4e-09
 Identities = 39/171 (22%), Positives = 68/171 (39%), Gaps = 32/171 (18%)

Query: 2   RLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICD 61
           R+++TG  G +G  L + L  + ++ V +                         Q+D+ D
Sbjct: 1   RILITGANGQLGRELVQQLSPEGRVVVALTSS----------------------QLDLTD 38

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
            E +   L+  +PDA+VN AA + VD +    ++    N +    L              
Sbjct: 39  PEALERLLRAIRPDAVVNTAAYTDVDGAESDPEKAFAVNALAPQNLARAA---------- 88

Query: 122 KKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSATKASSDYLVLAWG 172
            +   R + ISTD V+    K  + ED   NP + Y  +K + +  + A G
Sbjct: 89  ARHGARLVHISTDYVFDGEGKRPYREDDATNPLNVYGQSKLAGEQAIRAAG 139