RPSBLAST alignment for GI: 254780920 and conserved domain: TIGR02197

>gnl|CDD|162758 TIGR02197, heptose_epim, ADP-L-glycero-D-manno-heptose-6-epimerase. This family consists of examples of ADP-L-glycero-D-mannoheptose-6-epimerase, an enzyme involved in biosynthesis of the inner core of lipopolysaccharide (LPS) for Gram-negative bacteria. This enzyme is homologous to UDP-glucose 4-epimerase (TIGR01179) and belongs to the NAD dependent epimerase/dehydratase family (pfam01370). Length = 314
 Score = 72.7 bits (179), Expect = 1e-13
 Identities = 85/352 (24%), Positives = 135/352 (38%), Gaps = 66/352 (18%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLK--EISQSNLFSFLQVDIC 60
           +IVTGGAGFIGS L + L       +LV+D L       +L    I           D  
Sbjct: 1   IIVTGGAGFIGSNLVKALNERGITDILVVDNLRDGHKFLNLADLVI----------ADYI 50

Query: 61  DRECIRSALKE---FQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEET------ 111
           D+E     L++    + +AI +  A S             TT   G +++  E       
Sbjct: 51  DKEDFLDRLEKGAFGKIEAIFHQGACSD------------TTETDGEYMM--ENNYQYSK 96

Query: 112 RLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSATKASSDYLVLAW 171
           RL   C  +       F+  S+   YG  + G         P + Y  +K   D  V   
Sbjct: 97  RLLDWCAEKGIP----FIYASSAATYGDGEAGFREGRELERPLNVYGYSKFLFDQYVRRR 152

Query: 172 GHTYGIPVLLSNCS--NNYGPYHF-PEKLIPLAI---TRMIEGSHVFL------YGDGQN 219
                +   +      N YGP  +   K+  +A     ++  G +V L      + DG+ 
Sbjct: 153 VLPEALSAQVVGLRYFNVYGPREYHKGKMASVAFHLFNQIKAGGNVKLFKSSEGFKDGEQ 212

Query: 220 VRDWLYVEDHVRALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTE 279
           +RD++YV+D V     +L+ G  G  +N+G    R   D+        DA+  K+    E
Sbjct: 213 LRDFVYVKDVVDVNLWLLENGVSG-IFNLGTGRARSFNDLA-------DAVF-KALGKDE 263

Query: 280 LIRFIEDRPGHDR-RY----AIDSSKIKSEIGWFPQENMESGLNKTVCWYLD 326
            I +I   P   R +Y      D +K+++   + P   +E G+   V W L 
Sbjct: 264 KIEYI-PMPEALRGKYQYFTQADITKLRAAGYYGPFTTLEEGVKDYVQWLLA 314