RPSBLAST alignment for GI: 254780920 and conserved domain: PRK09186

>gnl|CDD|169699 PRK09186, PRK09186, flagellin modification protein A; Provisional. Length = 256
 Score = 44.6 bits (106), Expect = 4e-05
 Identities = 25/84 (29%), Positives = 39/84 (46%), Gaps = 6/84 (7%)

Query: 4  IVTGGAGFIGSALCRYLV-NDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDR 62
          ++TG  G IGSAL + ++     +    IDK      L SL +  +S   S +++DI D+
Sbjct: 8  LITGAGGLIGSALVKAILEAGGIVIAADIDKEALNELLESLGKEFKSKKLSLVELDITDQ 67

Query: 63 ECIRSALKEFQP-----DAIVNFA 81
          E +   L +        D  VN A
Sbjct: 68 ESLEEFLSKSAEKYGKIDGAVNCA 91