RPSBLAST alignment for GI: 254780920 and conserved domain: KOG1502

>gnl|CDD|36715 KOG1502, KOG1502, KOG1502, Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms]. Length = 327
 Score = 44.1 bits (104), Expect = 5e-05
 Identities = 72/346 (20%), Positives = 121/346 (34%), Gaps = 48/346 (13%)

Query: 1   MRLIVTGGAGFIGSALC-RYLVNDLKIQVLVID-----KLTYAGNLNSLKEISQSNLFSF 54
            ++ VTG +GFIGS +    L     ++  V D     K  +   L   KE     L  F
Sbjct: 7   KKVCVTGASGFIGSWIVKLLLSRGYTVRGTVRDPEDEKKTEHLRKLEGAKE----RLKLF 62

Query: 55  LQVDICDRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLW 114
            + D+ D      A+     D + + A+    D       E I   + GT  +LE     
Sbjct: 63  -KADLLDEGSFDKAIDGC--DGVFHTASPVDFDLEDP-EKELIDPAVKGTKNVLE----- 113

Query: 115 WSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSP----------YSATKASS 164
            +C  + K  +      ST  V  +      +  +     S           Y+ +K  +
Sbjct: 114 -ACK-KTKSVKRVVYTSSTAAVRYNGPNIGENSVVDEESWSDLDFCRCKKLWYALSKTLA 171

Query: 165 DYLVLAWGHTYGIPVLLSNCSNNYGPYHFPE-KLIPLAITRMIEGSHVFLYGDGQN-VRD 222
           +     +    G+ ++  N    +GP   P       A+ ++I+G    L     N    
Sbjct: 172 EKAAWEFAKENGLDLVTINPGLVFGPGLQPSLNSSLNALLKLIKG----LAETYPNFWLA 227

Query: 223 WLYVEDHVRALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDAL-IPKSYSHTELI 281
           ++ V D   A  L L+K     RY   G       +I   +  L     IPK        
Sbjct: 228 FVDVRDVALAHVLALEKPSAKGRYICVGEV-VSIKEIADILRELFPDYPIPK-------- 278

Query: 282 RFIEDRPGHDRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDN 327
           +  E+  G    + + S K+KS  G+  +  +E  L+ TV    + 
Sbjct: 279 KNAEEHEGFLTSFKVSSEKLKSLGGFKFR-PLEETLSDTVESLREK 323