HHsearch alignment for GI: 254780927 and conserved domain: PRK12830

>PRK12830 UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Reviewed.
Probab=100.00  E-value=0  Score=803.56  Aligned_cols=417  Identities=41%  Similarity=0.668  Sum_probs=393.1

Q ss_pred             CCEEEEECCCCEEEEEECCCCHHHHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHCCCEEEEECCCCEEEECCCCE
Q ss_conf             94389827973137897696466899999999746996999869836999999999997498999927741142024525
Q gi|254780927|r    1 MDRIKIIGGNKLNGTIAISGAKNASLPVMIASLLTSETLTLENIPDLADVKLLIRILRSHGVEILSDSSYNDQNKSYSST   80 (430)
Q Consensus         1 M~~l~V~g~~~L~G~i~vpgSKs~s~Ral~aaaLa~g~s~i~n~~~s~D~~~~~~~l~~lG~~i~~~~~~~~~~~~~~~~   80 (430)
T Consensus         1 M~kl~I~g~~~L~G~v~vpgsKS~~~r~l~aa~La~g~s~I~n~~~s~D~~~t~~~l~~lG~~i~~~~~~----------   70 (417)
T PRK12830          1 MEKIIINGGKPLNGEVTISGAKNSAVALIPAAILADGIVTLDGVPDISDVHSLVDILEELGGKVKRDGDT----------   70 (417)
T ss_pred             CCEEEEECCCCEEEEEECCCCHHHHHHHHHHHHHCCCCEEECCCCCCHHHHHHHHHHHHCCCEEEEECCE----------
T ss_conf             9769996989627799898858999999999986699499926997789999999999779989997999----------


Q ss_pred             EEEECCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCEEEEEEC
Q ss_conf             99943666586444023431132110225332333210453058663332012123433321033224568614899950
Q gi|254780927|r   81 MHFRCRHIVDLTGSYDLVSKMRASFWVIGPLLAREGYARISLPGGCAIGTRPVDLFVDSLKSLGVVIKIDGGYVDARVSS  160 (430)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~r~s~~~l~~lla~~~~~~v~l~G~~~l~~RP~~~l~~~L~~lGa~i~~~~g~~p~~i~g  160 (430)
T Consensus        71 ~~I~~~g~~~~~~~~~~~~~~r~s~~l~g~ll~~~~~~~~~l~G~~sL~~RPm~~~~~~L~~lGa~i~~~~~~~~i~--~  148 (417)
T PRK12830         71 LEIDPTGIQSMPLPNGKVKSLRASYYFMGALLGRFKKAVVGLPGGCDLGPRPIDQHIKGFEALGAEVTNEHGAMYLR--A  148 (417)
T ss_pred             EEEECCCCCCCCCCHHHHHCCCHHHHHHHHHHHHCCEEEEECCCCCCCCCCCHHHHHHHHHHCCCEEEECCCCEECC--C
T ss_conf             99978886777588225533622688888876215808995278721168977999999997697899778840014--7


Q ss_pred             CCCCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCEEECCCCCCCCCCCEE
Q ss_conf             24433333334346661135665044446873323322201599899875014544320244321202554222234200
Q gi|254780927|r  161 KGLRGTSYTFPKVSVGATQVMMMVASLSHGDTSIYNAAREPEVVDLAHCLNSMGAKISGMGSSTITIQGVTSLSGTRHRI  240 (430)
Q Consensus       161 ~~l~g~~i~l~~~S~q~~s~lLlaA~~a~G~t~I~~~~~~P~i~~t~~~L~~~Gv~I~~~~~~~i~I~g~~~l~~~~~~V  240 (430)
T Consensus       149 ~~l~g~~~~~~~~S~~~~~~lllaa~~a~G~tvi~~~~~~p~v~~~~~~L~~~G~~I~~~g~~~i~i~g~~~l~~~~~~V  228 (417)
T PRK12830        149 DELKGAHIYLDVVSVGATINIMLAAVKAKGRTVIENAAKEPEIIDVATLLNNMGANIKGAGTDVIRIEGVEELHGCRHQV  228 (417)
T ss_pred             CCCCCCEEECCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEECCCCEEEECCCCCCCCCEEEE
T ss_conf             88667469766777889999998765238973245556797179999999976984442697189993522444760230


Q ss_pred             CCCCHHCCHHHHHCCCCCCCEEEECCCCCCCCCHHHHHHHCCCCEEEECCCEEEEECCCCCCEEEEECCCCCCCCCCCHH
Q ss_conf             14310000100000124442010023456421046889752674367445126753267643157621535666421013
Q gi|254780927|r  241 LPDRIEAGTYAMAVAMTGGDVILKMTDSSLLKTVFKVMRQTGVDIDIIDEGIRVRWNGEKLRPVDVITAPFPGFPTDLQA  320 (430)
Q Consensus       241 ~~D~ssAa~fl~Aaalt~g~i~i~n~~~~~~~~~l~iL~~mGa~i~~~~~~i~V~~~~~~l~~~di~~~~~pg~~~D~~p  320 (430)
T Consensus       229 ~pD~~saa~f~~aaa~~~~~v~i~nv~~~~~~~~l~~L~~MGa~i~~~~~~i~v~~~-~~L~~i~i~~~~~P~~~~Dl~p  307 (417)
T PRK12830        229 IPDRIEAGTYMILAAACGGGVIINNVIPEHLESFIAKLEEMGVRVEVEDDSIFVEGQ-EPLKAVDIKTLPYPGFATDLQQ  307 (417)
T ss_pred             CCCCHHHHHHHHHHHHHCCCEEEECCCCHHHHHHHHHHHHCCCEEEEECCEEEEECC-CCCCCEEEECCCCCCCCCCHHH
T ss_conf             687066899999999829947996778324178999999769879981998999138-9855278625789898752256


Q ss_pred             HHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHCCCEEEEECCEEEEECCCCCEEEEEEECCHHHHHHHHHHHHHCCCEEE
Q ss_conf             46676313566416732046567566788974885899978969998889851015660818999999999985498199
Q gi|254780927|r  321 QFMAMMCCAAGISHITETIFENRFMHVQELVRLGARISLSGQTARVEGVQGLRGAPVMATDLRASVSLVIAALAAQGETE  400 (430)
Q Consensus       321 ~la~laa~A~G~s~I~e~i~e~R~~~~~eL~klG~~v~~~~d~l~I~G~~~l~g~~v~~~DHRiaMa~~ia~L~a~g~~~  400 (430)
T Consensus       308 ~l~~la~~A~G~t~i~~~v~e~R~ke~deL~kmGa~i~~~~d~~~I~G~~~l~G~~v~s~DHRiaMa~~ia~L~a~g~t~  387 (417)
T PRK12830        308 PLTPLLLKANGRSVVTDTIYEKRFKHVDELKRMGANIKVEGRSAIITGPSKLTGAKVKATDLRAGAALVIAGLMAEGVTE  387 (417)
T ss_pred             HHHHHHHHCCCCEEEEEEEHHHHHHHHHHHHHCCCEEEEECCEEEEECCCCCCCCEECCCCHHHHHHHHHHHHCCCCEEE
T ss_conf             78999982787469995012546676899996789399989999997998774862668858999999999974898099


Q ss_pred             EECCCEECCCCCCHHHHHHHCCCEEEEECC
Q ss_conf             924330117784878899866978999519
Q gi|254780927|r  401 ISRVYHLDRGFECLEKKLSRCGALIQRIKG  430 (430)
Q Consensus       401 I~~~~~i~ksyp~f~~~L~~LGa~Ie~i~~  430 (430)
T Consensus       388 I~~~~~i~~SyP~F~~~L~~LGa~Ier~~~  417 (417)
T PRK12830        388 ITNIEHIDRGYSNIIEKLKALGADIWREED  417 (417)
T ss_pred             ECCCCEEECCCHHHHHHHHHCCCEEEEECC
T ss_conf             867222668704199999967997999249