HHsearch alignment for GI: 254780928 and conserved domain: TIGR00470
>TIGR00470 sepS O-phosphoseryl-tRNA(Cys) synthetase; InterPro: IPR005246 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology . The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric . Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices , and are mostly dimeric or multimeric, containing at least three conserved regions , , . However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases; these synthetases are further divided into three subclasses, a, b and c, according to sequence homology. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases . All known phenylalanyl-tRNA synthetases, excepting a monomeric mitochondrial form, have an alpha 2 beta 2 heterotetrameric structure. This family of archaeal proteins resembles known phenylalanyl-tRNA synthetase alpha chains but is longer and of unknown function; more generally, it resembles class 2 aminoacyl tRNA ligases. .
Probab=95.17 E-value=0.038 Score=33.11 Aligned_cols=80 Identities=18% Similarity=0.281 Sum_probs=48.4
Q ss_pred EEEECCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCC-CCCCCCCCCCCCHHHHHCCCHHHHHHHHHHHHHHHHHC
Q ss_conf 89998888389999999511205541123310133302587-64442111110001210000245788999999999751
Q gi|254780928|r 80 WISLRYDLTAPLARYVAENFDTIVFPCRTYRIGPVFRNEKH-GPGRFRQFIQCDVDNVGSSAETADAEMCMMMADTLEAV 158 (496)
Q Consensus 80 ~l~LRpDlT~~~aR~~~~~~~~~~~p~k~yy~g~vfR~e~p-~~Gr~REf~Q~g~eiiG~~~~~~DaEii~l~~~~l~~l 158 (496)
T Consensus 192 tlTLRSHMTsGWFItLs~i~dk~~lPlKLFSIDRCFRREQ~ED~shLmtYhSASCVvVdeevsvDdG--KaVAEgLL~qf 269 (558)
T TIGR00470 192 TLTLRSHMTSGWFITLSSIADKLKLPLKLFSIDRCFRREQKEDASHLMTYHSASCVVVDEEVSVDDG--KAVAEGLLEQF 269 (558)
T ss_pred CCCCHHHCCCHHHHHHHHHHHHCCCCCEEECCCCCCCCCCCCCCCCCCCEEEEEEEEECCCCCCCCC--HHHHHHHHHHH
T ss_conf 4320010100278889878751589711220032314466435310011345466785771243642--68899999870
Q ss_pred CCC
Q ss_conf 888
Q gi|254780928|r 159 GIK 161 (496)
Q Consensus 159 gl~ 161 (496)
T Consensus 270 GF~ 272 (558)
T TIGR00470 270 GFE 272 (558)
T ss_pred CCC
T ss_conf 854